F416384

General Info

Members Datasets Scaffolds Average Seq Length
345 171 690 199

Family's Representative Sequence

Representative Sequence 3300013307|Ga0157372_10051784|Ga0157372_100517844
Length 227
Sequence MDRAARFDVRTLVDVLLRRNDSCRHNPRMPLRNRVTPLGDVIATPERGLVYGNRGCLHNKAGVVVRRAATRRWIACQLSYRGWYQGATPRPGRFTGLFFLDDATAFAAGHRPCALCRRDDYKSLLAITGHSGADAIDLDLQEQRTGPRARVTVASLPDGAFVLLDDEPHLVLDGAVRRWSPGGYGPARGAPKSAALVTPQLLVPVLAAGWSPLVPFLHPSAHATMAS

Samples

Sample ID Description Type Environment
1 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
2 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
9 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
10 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
11 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
12 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
13 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
14 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
15 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
16 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
17 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
18 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
19 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
20 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
21 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
22 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
23 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
24 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
25 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
26 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
27 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
28 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
29 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
30 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
31 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
32 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
33 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
34 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
35 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
36 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
37 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
38 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
39 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
40 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
41 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
42 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
43 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
44 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
45 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
46 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
47 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
48 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
49 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
50 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
51 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
52 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
53 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
54 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
55 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
85 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
86 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
87 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
88 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
89 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
90 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
91 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
92 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
93 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
94 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
95 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
96 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
97 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
98 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
99 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
100 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
101 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
102 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
103 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
104 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
105 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
106 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
107 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
108 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
109 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
110 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
111 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
112 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
113 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
114 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
115 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
116 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
117 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
118 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
119 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
120 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
121 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
122 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
123 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
124 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
125 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
126 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
127 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
128 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
129 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
130 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
131 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
132 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
133 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
134 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
135 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
136 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
137 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
138 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
139 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
140 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
141 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
142 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
143 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
144 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
145 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
146 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
147 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
148 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
149 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
150 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
151 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
152 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
153 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
154 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
155 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
156 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
157 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
158 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
159 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
160 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
161 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
162 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
163 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
164 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
165 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
166 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
167 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
168 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
169 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
170 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
171 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.13
Metatranscriptomes 0.87
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 9.86
Rhizosphere 88.41
Stem 0
Stem Tuber 0
Unclassified 9.86

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157372_10051784 3300013307 Bacteria 4570
2 rootH1_10182417 3300003323 Bacteria 2601
3 Ga0070658_10118843 3300005327 Bacteria 2195
4 Ga0070658_10210414 3300005327 Bacteria 1643
5 Ga0070683_100037771 3300005329 Bacteria 4422
6 Ga0070680_100016517 3300005336 Bacteria 5808
7 Ga0070680_100101482 3300005336 Bacteria 2389
8 Ga0070680_100116700 3300005336 Bacteria 2225
9 Ga0070680_100242128 3300005336 Unclassified 1525
10 Ga0070682_100031764 3300005337 Unclassified 3196
11 Ga0070682_100227887 3300005337 Bacteria 1330
12 Ga0070660_100003437 3300005339 Bacteria 10896
13 Ga0070660_100026810 3300005339 Bacteria 4293
14 Ga0070661_100050998 3300005344 Bacteria 3028
15 Ga0070659_100009158 3300005366 Bacteria 7264
16 Ga0070659_100019202 3300005366 Bacteria 5174
17 Ga0070659_100066925 3300005366 Bacteria 2848
18 Ga0070714_100037632 3300005435 Bacteria 4066
19 Ga0070714_100047842 3300005435 Bacteria 3635
20 Ga0070714_100063921 3300005435 Bacteria 3166
21 Ga0070714_100204800 3300005435 Bacteria 1806
22 Ga0070714_100648996 3300005435 Bacteria 1016
23 Ga0070714_100852551 3300005435 Bacteria 883
24 Ga0070713_100002241 3300005436 Bacteria 12548
25 Ga0070713_100050180 3300005436 Bacteria 3445
26 Ga0070713_100140360 3300005436 Bacteria 2140
27 Ga0070710_10001575 3300005437 Bacteria 10765
28 Ga0070710_10040612 3300005437 Bacteria 2565
29 Ga0070710_10171646 3300005437 Bacteria 1351
30 Ga0070701_10744867 3300005438 Bacteria 663
31 Ga0070711_100011517 3300005439 Bacteria 5496
32 Ga0070711_100018713 3300005439 Bacteria 4428
33 Ga0070711_100173650 3300005439 Bacteria 1644
34 Ga0070678_100113271 3300005456 Bacteria 2126
35 Ga0070678_100264373 3300005456 Bacteria 1448
36 Ga0070681_10004494 3300005458 Bacteria 13303
37 Ga0070681_10019008 3300005458 Bacteria 6878
38 Ga0070681_10107361 3300005458 Bacteria 2732
39 Ga0070681_10139049 3300005458 Bacteria 2358
40 Ga0070681_10204960 3300005458 Bacteria 1889
41 Ga0070707_100000328 3300005468 Bacteria 46683
42 Ga0070698_100304335 3300005471 Bacteria 1525
43 Ga0070679_100010734 3300005530 Bacteria 8699
44 Ga0070679_100015624 3300005530 Bacteria 7295
45 Ga0070679_100068844 3300005530 Bacteria 3530
46 Ga0070679_100182974 3300005530 Bacteria 2067
47 Ga0070679_100268195 3300005530 Bacteria 1661
48 Ga0070679_100303395 3300005530 Bacteria 1547
49 Ga0070679_100587192 3300005530 Bacteria 1057
50 Ga0070679_100641074 3300005530 Bacteria 1005
51 Ga0070684_100016906 3300005535 Bacteria 5975
52 Ga0070684_100261667 3300005535 Bacteria 1583
53 Ga0070684_100510595 3300005535 Bacteria 1114
54 Ga0068853_100200362 3300005539 Bacteria 1816
55 Ga0068853_100396089 3300005539 Bacteria 1292
56 Ga0070693_100212934 3300005547 Bacteria 1262
57 Ga0068855_100073583 3300005563 Bacteria 3969
58 Ga0068855_100092428 3300005563 Bacteria 3489
59 Ga0068855_100108056 3300005563 Bacteria 3195
60 Ga0068855_100138950 3300005563 Bacteria 2771
61 Ga0068855_100144211 3300005563 Bacteria 2712
62 Ga0070664_100112040 3300005564 Bacteria 2382
63 Ga0070664_100600186 3300005564 Bacteria 1021
64 Ga0068857_100166772 3300005577 Bacteria 2000
65 Ga0068856_100067083 3300005614 Bacteria 3545
66 Ga0068856_100707520 3300005614 Bacteria 1028
67 Ga0070702_100117750 3300005615 Unclassified 1658
68 Ga0068852_100613493 3300005616 Bacteria 1093
69 Ga0068852_100650431 3300005616 Bacteria 1061
70 Ga0068864_100192756 3300005618 Unclassified 1869
71 Ga0070717_10005916 3300006028 Bacteria 8956
72 Ga0070717_10012964 3300006028 Bacteria 6367
73 Ga0070717_10234157 3300006028 Unclassified 1617
74 Ga0070717_10483907 3300006028 Bacteria 1118
75 Ga0070715_10000547 3300006163 Bacteria 9895
76 Ga0070716_100012239 3300006173 Bacteria 4344
77 Ga0070712_100055434 3300006175 Bacteria 2776
78 Ga0070712_100240575 3300006175 Unclassified 1442
79 Ga0070712_100581279 3300006175 Bacteria 946
80 Ga0075434_100011904 3300006871 Bacteria 8226
81 Ga0075434_100329838 3300006871 Unclassified 1546
82 Ga0075435_100006915 3300007076 Bacteria 8048
83 Ga0075435_100463650 3300007076 Unclassified 1093
84 Ga0105251_10291882 3300009011 Unclassified 738
85 Ga0111539_10444558 3300009094 Unclassified 1510
86 Ga0105245_10056221 3300009098 Bacteria 3536
87 Ga0105245_10126005 3300009098 Bacteria 2398
88 Ga0105245_10477851 3300009098 Bacteria 1259
89 Ga0105241_10951090 3300009174 Unclassified 801
90 Ga0105248_10355778 3300009177 Bacteria 1649
91 Ga0105237_10060992 3300009545 Bacteria 3772
92 Ga0105237_10199645 3300009545 Bacteria 1999
93 Ga0105238_10041072 3300009551 Bacteria 4686
94 Ga0105238_10169840 3300009551 Bacteria 2157
95 Ga0105239_10592422 3300010375 Bacteria 1264
96 Ga0157370_10020332 3300013104 Bacteria 6631
97 Ga0157370_10166329 3300013104 Bacteria 2051
98 Ga0157369_10107063 3300013105 Bacteria 2975
99 Ga0157369_10109776 3300013105 Bacteria 2933
100 Ga0157369_10152210 3300013105 Bacteria 2445
101 Ga0157369_11100030 3300013105 Bacteria 812
102 Ga0157374_10032819 3300013296 Bacteria 4731
103 Ga0157374_10654795 3300013296 Unclassified 1062
104 Ga0157372_10106265 3300013307 Bacteria 3211
105 Ga0157372_11029713 3300013307 Bacteria 953
106 Ga0157375_10590024 3300013308 Bacteria 1271
107 Ga0182008_10451059 3300014497 Bacteria 699
108 Ga0157379_10633578 3300014968 Bacteria 1000
109 Ga0157376_10018483 3300014969 Bacteria 5346
110 Ga0206356_10433064 3300020070 Bacteria 1657
111 Ga0206356_10906755 3300020070 Bacteria 1190
112 Ga0206353_11432200 3300020082 Bacteria 1359
113 Ga0213876_10103605 3300021384 Bacteria 1509
114 Ga0213871_10029514 3300021441 Bacteria 1422
115 Ga0207692_10019244 3300025898 Bacteria 3082
116 Ga0207692_10035492 3300025898 Bacteria 2423
117 Ga0207685_10002625 3300025905 Bacteria 4170
118 Ga0207699_10008096 3300025906 Bacteria 5170
119 Ga0207699_10008517 3300025906 Bacteria 5068
120 Ga0207705_10156845 3300025909 Unclassified 1708
121 Ga0207707_10025310 3300025912 Bacteria 5191
122 Ga0207707_10155329 3300025912 Bacteria 2001
123 Ga0207707_10309307 3300025912 Bacteria 1365
124 Ga0207671_10236440 3300025914 Unclassified 1434
125 Ga0207693_10002991 3300025915 Bacteria 14628
126 Ga0207693_10008709 3300025915 Bacteria 8296
127 Ga0207693_10050096 3300025915 Bacteria 3280
128 Ga0207693_10346640 3300025915 Bacteria 1162
129 Ga0207663_10013346 3300025916 Bacteria 4463
130 Ga0207663_10034272 3300025916 Unclassified 3034
131 Ga0207663_10324284 3300025916 Bacteria 1158
132 Ga0207663_10368607 3300025916 Bacteria 1091
133 Ga0207660_10034064 3300025917 Bacteria 3527
134 Ga0207660_10042250 3300025917 Bacteria 3199
135 Ga0207660_10139437 3300025917 Bacteria 1853
136 Ga0207657_10002359 3300025919 Bacteria 20451
137 Ga0207657_10007689 3300025919 Bacteria 11016
138 Ga0207657_10059670 3300025919 Bacteria 3276
139 Ga0207657_10195188 3300025919 Bacteria 1631
140 Ga0207649_10015515 3300025920 Bacteria 4280
141 Ga0207652_10016738 3300025921 Bacteria 5991
142 Ga0207652_10037677 3300025921 Bacteria 4092
143 Ga0207652_10079436 3300025921 Bacteria 2866
144 Ga0207652_10086206 3300025921 Bacteria 2753
145 Ga0207652_10087670 3300025921 Bacteria 2729
146 Ga0207652_10554778 3300025921 Unclassified 1032
147 Ga0207646_10000835 3300025922 Bacteria 40092
148 Ga0207646_10325831 3300025922 Bacteria 1388
149 Ga0207694_10027310 3300025924 Bacteria 4346
150 Ga0207694_10241585 3300025924 Bacteria 1476
151 Ga0207687_10507848 3300025927 Bacteria 1007
152 Ga0207700_10068410 3300025928 Bacteria 2722
153 Ga0207664_10001898 3300025929 Bacteria 13744
154 Ga0207664_10048590 3300025929 Bacteria 3337
155 Ga0207664_10071978 3300025929 Bacteria 2786
156 Ga0207664_10307364 3300025929 Bacteria 1396
157 Ga0207690_10007676 3300025932 Bacteria 6400
158 Ga0207690_10080255 3300025932 Bacteria 2276
159 Ga0207690_10124954 3300025932 Bacteria 1874
160 Ga0207690_10195921 3300025932 Bacteria 1531
161 Ga0207665_10000336 3300025939 Bacteria 32436
162 Ga0207711_10409295 3300025941 Bacteria 1261
163 Ga0207661_10030413 3300025944 Bacteria 4159
164 Ga0207661_10080009 3300025944 Bacteria 2695
165 Ga0207661_10546799 3300025944 Bacteria 1061
166 Ga0207679_10353832 3300025945 Bacteria 1281
167 Ga0207667_10107175 3300025949 Bacteria 2882
168 Ga0207667_10192920 3300025949 Bacteria 2090
169 Ga0207667_10312123 3300025949 Bacteria 1606
170 Ga0207667_10479981 3300025949 Bacteria 1262
171 Ga0207639_10563327 3300026041 Unclassified 1047
172 Ga0207639_10754025 3300026041 Bacteria 905
173 Ga0207702_10252702 3300026078 Bacteria 1656
174 Ga0207702_10280819 3300026078 Bacteria 1574
175 Ga0207674_10126934 3300026116 Bacteria 2516
176 Ga0207674_10137257 3300026116 Bacteria 2406
177 Ga0207683_10425085 3300026121 Bacteria 1224
178 Ga0207683_10553806 3300026121 Bacteria 1063
179 Ga0207698_10546933 3300026142 Bacteria 1134
180 Ga0268266_10390314 3300028379 Bacteria 1314
181 Ga0373943_0000813 3300035170 Bacteria 13694
182 Ga0373924_0139887 3300035410 Bacteria 1056
183 Ga0373931_0358502 3300035691 Bacteria 914
184 Ga0373933_0048202 3300035724 Bacteria 2536
185 Ga0373937_0179742 3300036401 Bacteria 1986
186 Ga0373937_0326227 3300036401 Unclassified 1453
187 Ga0373937_0923097 3300036401 Bacteria 822
188 Ga0395898_0005936 3300037466 Bacteria 13117
189 Ga0395905_0325926 3300037471 Bacteria 1426
190 Ga0436364_1119850 3300037853 Bacteria 2230
191 Ga0395901_0001626 3300038443 Bacteria 23226
192 Ga0395901_0260539 3300038443 Bacteria 1805
193 Ga0436365_0498163 3300039437 Bacteria 3347
194 Ga0436365_0715499 3300039437 Bacteria 1856
195 Ga0436365_1067784 3300039437 Bacteria 15484
196 Ga0436360_0877230 3300039438 Bacteria 2890
197 Ga0466969_0003408 3300044656 Bacteria 8455
198 Ga0466972_0057267 3300044658 Bacteria 1872
199 Ga0466965_0312124 3300044683 Bacteria 855
200 Ga0466965_0487007 3300044683 Bacteria 690
201 Ga0466966_0035214 3300044684 Bacteria 3236
202 Ga0466961_0035899 3300044693 Bacteria 3182
203 Ga0466963_0002026 3300044694 Bacteria 11135
204 Ga0466963_0010088 3300044694 Bacteria 5711
205 Ga0466963_0040672 3300044694 Bacteria 3047
206 Ga0466963_0061838 3300044694 Bacteria 2504
207 Ga0466963_0132222 3300044694 Bacteria 1724
208 Ga0466963_0177711 3300044694 Bacteria 1485
209 Ga0466963_0190534 3300044694 Unclassified 1432
210 Ga0466963_0208749 3300044694 Unclassified 1366
211 Ga0466963_0250254 3300044694 Bacteria 1243
212 Ga0466964_0014504 3300044706 Bacteria 2997
213 Ga0466964_0101625 3300044706 Bacteria 1268
214 Ga0466971_0003820 3300044719 Bacteria 6448
215 Ga0466968_0004132 3300044735 Bacteria 5408
216 Ga0466968_0007515 3300044735 Bacteria 4147
217 Ga0466968_0008446 3300044735 Bacteria 3945
218 Ga0466968_0110866 3300044735 Bacteria 1234
219 Ga0466970_0006066 3300044765 Bacteria 6026
220 Ga0466970_0201682 3300044765 Bacteria 1107
221 Ga0466957_0016844 3300044842 Bacteria 4276
222 Ga0466957_0026707 3300044842 Bacteria 3427
223 Ga0466957_0046110 3300044842 Bacteria 2645
224 Ga0466957_0059518 3300044842 Bacteria 2341
225 Ga0466957_0104383 3300044842 Bacteria 1790
226 Ga0466957_0113537 3300044842 Bacteria 1720
227 Ga0466959_0023616 3300045049 Bacteria 4551
228 Ga0466959_0030126 3300045049 Bacteria 4018
229 Ga0466959_0045281 3300045049 Bacteria 3240
230 Ga0466959_0503472 3300045049 Bacteria 818
231 Ga0466958_0007722 3300045836 Bacteria 5934
232 Ga0466958_0017077 3300045836 Bacteria 4189
233 Ga0466958_0054712 3300045836 Bacteria 2420
234 Ga0466958_0055626 3300045836 Bacteria 2401
235 Ga0466958_0081052 3300045836 Bacteria 1997
236 Ga0466958_0118993 3300045836 Bacteria 1652
237 Ga0466967_0023050 3300045976 Bacteria 5095
238 Ga0466967_0063760 3300045976 Bacteria 3275
239 Ga0466967_0080521 3300045976 Bacteria 2939
240 Ga0466967_0107049 3300045976 Bacteria 2564
241 Ga0466967_0130823 3300045976 Bacteria 2329
242 Ga0466967_0132120 3300045976 Bacteria 2318
243 Ga0466967_0153727 3300045976 Bacteria 2153
244 Ga0466967_0188349 3300045976 Bacteria 1949
245 Ga0466967_0271084 3300045976 Bacteria 1626
246 Ga0466967_0452405 3300045976 Bacteria 1255
247 Ga0466967_0796025 3300045976 Bacteria 938
248 Ga0466967_0896813 3300045976 Bacteria 882
249 Ga0495592_0155572 3300046454 Bacteria 1577
250 Ga0495629_0012079 3300046459 Bacteria 6260
251 Ga0495629_0021140 3300046459 Bacteria 4644
252 Ga0495641_0190932 3300046461 Unclassified 918
253 Ga0495651_0165733 3300046462 Bacteria 1578
254 Ga0495580_0696060 3300046472 Unclassified 665
255 Ga0495582_0059431 3300046473 Bacteria 2109
256 Ga0495664_0133115 3300046477 Bacteria 1506
257 Ga0495594_0340292 3300046499 Bacteria 854
258 Ga0495607_0295645 3300046501 Bacteria 764
259 Ga0495608_0013436 3300046511 Bacteria 5678
260 Ga0495618_0256695 3300046514 Bacteria 1095
261 Ga0495618_0532995 3300046514 Bacteria 705
262 Ga0495628_0032870 3300046516 Bacteria 4184
263 Ga0495628_0110071 3300046516 Unclassified 2119
264 Ga0495628_0681115 3300046516 Bacteria 728
265 Ga0495630_0032508 3300046517 Bacteria 3888
266 Ga0495630_0408900 3300046517 Bacteria 1040
267 Ga0495652_0096105 3300046529 Unclassified 2413
268 Ga0495652_0312830 3300046529 Unclassified 1137
269 Ga0495640_0070882 3300046533 Bacteria 2340
270 Ga0495586_0276834 3300046535 Bacteria 960
271 Ga0495587_0038827 3300046536 Bacteria 2852
272 Ga0495645_0140082 3300046543 Bacteria 1688
273 Ga0495667_0114280 3300046559 Bacteria 1744
274 Ga0495634_0119812 3300046642 Bacteria 1686
275 Ga0495611_0149956 3300046648 Bacteria 1089
276 Ga0495635_0056709 3300046663 Bacteria 2696
277 Ga0495657_0032513 3300046675 Bacteria 3639
278 Ga0495599_0064303 3300046678 Bacteria 2292
279 Ga0495599_0294612 3300046678 Bacteria 980
280 Ga0495623_0048767 3300046679 Bacteria 2685
281 Ga0495623_0123176 3300046679 Bacteria 1559
282 Ga0495646_0148816 3300046680 Bacteria 1304
283 Ga0495647_0318764 3300046681 Bacteria 703
284 Ga0495624_0133339 3300046690 Unclassified 1523
285 Ga0495624_0227765 3300046690 Viruses 1129
286 Ga0495600_0170845 3300046809 Bacteria 1403
287 Ga0495604_0059748 3300047317 Bacteria 2921
288 Ga0495674_0024946 3300047319 Bacteria 5488
289 Ga0495680_0060891 3300047322 Bacteria 2906
290 Ga0495593_0292981 3300047673 Bacteria 814
291 Ga0495602_0032497 3300048088 Bacteria 4911
292 Ga0496100_0074762 3300048903 Bacteria 2271
293 Ga0496100_0821414 3300048903 Unclassified 729
294 Ga0496101_0045079 3300048904 Bacteria 3157
295 Ga0496101_0162314 3300048904 Bacteria 1714
296 Ga0496102_0014363 3300048905 Bacteria 6879
297 Ga0496103_0030216 3300048906 Bacteria 3296
298 Ga0496104_0082565 3300048907 Bacteria 3064
299 Ga0496104_0202938 3300048907 Bacteria 1894
300 Ga0496104_0619943 3300048907 Unclassified 991
301 Ga0496105_0011313 3300048908 Bacteria 7046
302 Ga0496105_0032718 3300048908 Bacteria 4269
303 Ga0496105_0046118 3300048908 Bacteria 3597
304 Ga0496106_0005920 3300048909 Bacteria 9040
305 Ga0496107_0044130 3300048910 Bacteria 3204
306 Ga0496107_0305722 3300048910 Unclassified 1184
307 Ga0496107_0317154 3300048910 Bacteria 1160
308 Ga0496108_0104178 3300048911 Bacteria 2421
309 Ga0496108_0649113 3300048911 Bacteria 917
310 Ga0496109_0014655 3300048912 Bacteria 6821
311 Ga0496109_0101168 3300048912 Unclassified 2674
312 Ga0496110_0052832 3300048913 Bacteria 3570
313 Ga0496110_0064302 3300048913 Bacteria 3242
314 Ga0496111_0045295 3300048914 Bacteria 3165
315 Ga0496112_0008431 3300048915 Bacteria 9230
316 Ga0496112_0122891 3300048915 Bacteria 2566
317 Ga0496113_0029957 3300048916 Bacteria 3935
318 Ga0496113_0062081 3300048916 Bacteria 2821
319 Ga0496113_0251734 3300048916 Bacteria 1410
320 Ga0496114_0007467 3300048917 Bacteria 8643
321 Ga0496114_0181088 3300048917 Bacteria 1840
322 Ga0496115_0368757 3300048918 Bacteria 1169
323 Ga0496115_0582110 3300048918 Bacteria 891
324 Ga0496115_0777440 3300048918 Unclassified 747
325 Ga0496115_0882394 3300048918 Unclassified 691
326 Ga0501067_0020546 3300049583 Bacteria 3654
327 Ga0501069_0017354 3300049585 Bacteria 3872
328 Ga0501069_0046131 3300049585 Bacteria 2416
329 Ga0501081_0627369 3300049743 Bacteria 805
330 nmdc:mga0n895_294034_c1 3300050512 Unclassified 1647
331 nmdc:mga0n895_30550_c1 3300050512 Bacteria 5151
332 nmdc:mga0rr50_123271_c1 3300050513 Bacteria 2066
333 nmdc:mga0rr50_404590_c1 3300050513 Unclassified 1153
334 nmdc:mga0a205_78360_c1 3300050515 Bacteria 3192
335 Ga0495601_0008713 3300053077 Bacteria 5987
336 Ga0495601_0089996 3300053077 Bacteria 1974
337 Ga0495601_0533241 3300053077 Bacteria 756
338 Ga0495612_0105286 3300053078 Bacteria 1204
339 Ga0495655_0175344 3300053083 Bacteria 688
340 Ga0495595_0001728 3300053084 Bacteria 8542
341 Ga0495619_0008692 3300053085 Bacteria 6423
342 Ga0495619_0178563 3300053085 Bacteria 1469
343 Ga0466962_0001252 3300061719 Bacteria 11717
344 Ga0466962_0046681 3300061719 Bacteria 2070
345 Ga0530510_0021312 3300061734 Bacteria 4611
346 Ga0157372_10051784
347 rootH1_10182417
348 Ga0070658_10118843
349 Ga0070658_10210414
350 Ga0070683_100037771
351 Ga0070680_100016517
352 Ga0070680_100101482
353 Ga0070680_100116700
354 Ga0070680_100242128
355 Ga0070682_100031764
356 Ga0070682_100227887
357 Ga0070660_100003437
358 Ga0070660_100026810
359 Ga0070661_100050998
360 Ga0070659_100009158
361 Ga0070659_100019202
362 Ga0070659_100066925
363 Ga0070714_100037632
364 Ga0070714_100047842
365 Ga0070714_100063921
366 Ga0070714_100204800
367 Ga0070714_100648996
368 Ga0070714_100852551
369 Ga0070713_100002241
370 Ga0070713_100050180
371 Ga0070713_100140360
372 Ga0070710_10001575
373 Ga0070710_10040612
374 Ga0070710_10171646
375 Ga0070701_10744867
376 Ga0070711_100011517
377 Ga0070711_100018713
378 Ga0070711_100173650
379 Ga0070678_100113271
380 Ga0070678_100264373
381 Ga0070681_10004494
382 Ga0070681_10019008
383 Ga0070681_10107361
384 Ga0070681_10139049
385 Ga0070681_10204960
386 Ga0070707_100000328
387 Ga0070698_100304335
388 Ga0070679_100010734
389 Ga0070679_100015624
390 Ga0070679_100068844
391 Ga0070679_100182974
392 Ga0070679_100268195
393 Ga0070679_100303395
394 Ga0070679_100587192
395 Ga0070679_100641074
396 Ga0070684_100016906
397 Ga0070684_100261667
398 Ga0070684_100510595
399 Ga0068853_100200362
400 Ga0068853_100396089
401 Ga0070693_100212934
402 Ga0068855_100073583
403 Ga0068855_100092428
404 Ga0068855_100108056
405 Ga0068855_100138950
406 Ga0068855_100144211
407 Ga0070664_100112040
408 Ga0070664_100600186
409 Ga0068857_100166772
410 Ga0068856_100067083
411 Ga0068856_100707520
412 Ga0070702_100117750
413 Ga0068852_100613493
414 Ga0068852_100650431
415 Ga0068864_100192756
416 Ga0070717_10005916
417 Ga0070717_10012964
418 Ga0070717_10234157
419 Ga0070717_10483907
420 Ga0070715_10000547
421 Ga0070716_100012239
422 Ga0070712_100055434
423 Ga0070712_100240575
424 Ga0070712_100581279
425 Ga0075434_100011904
426 Ga0075434_100329838
427 Ga0075435_100006915
428 Ga0075435_100463650
429 Ga0105251_10291882
430 Ga0111539_10444558
431 Ga0105245_10056221
432 Ga0105245_10126005
433 Ga0105245_10477851
434 Ga0105241_10951090
435 Ga0105248_10355778
436 Ga0105237_10060992
437 Ga0105237_10199645
438 Ga0105238_10041072
439 Ga0105238_10169840
440 Ga0105239_10592422
441 Ga0157370_10020332
442 Ga0157370_10166329
443 Ga0157369_10107063
444 Ga0157369_10109776
445 Ga0157369_10152210
446 Ga0157369_11100030
447 Ga0157374_10032819
448 Ga0157374_10654795
449 Ga0157372_10106265
450 Ga0157372_11029713
451 Ga0157375_10590024
452 Ga0182008_10451059
453 Ga0157379_10633578
454 Ga0157376_10018483
455 Ga0206356_10433064
456 Ga0206356_10906755
457 Ga0206353_11432200
458 Ga0213876_10103605
459 Ga0213871_10029514
460 Ga0207692_10019244
461 Ga0207692_10035492
462 Ga0207685_10002625
463 Ga0207699_10008096
464 Ga0207699_10008517
465 Ga0207705_10156845
466 Ga0207707_10025310
467 Ga0207707_10155329
468 Ga0207707_10309307
469 Ga0207671_10236440
470 Ga0207693_10002991
471 Ga0207693_10008709
472 Ga0207693_10050096
473 Ga0207693_10346640
474 Ga0207663_10013346
475 Ga0207663_10034272
476 Ga0207663_10324284
477 Ga0207663_10368607
478 Ga0207660_10034064
479 Ga0207660_10042250
480 Ga0207660_10139437
481 Ga0207657_10002359
482 Ga0207657_10007689
483 Ga0207657_10059670
484 Ga0207657_10195188
485 Ga0207649_10015515
486 Ga0207652_10016738
487 Ga0207652_10037677
488 Ga0207652_10079436
489 Ga0207652_10086206
490 Ga0207652_10087670
491 Ga0207652_10554778
492 Ga0207646_10000835
493 Ga0207646_10325831
494 Ga0207694_10027310
495 Ga0207694_10241585
496 Ga0207687_10507848
497 Ga0207700_10068410
498 Ga0207664_10001898
499 Ga0207664_10048590
500 Ga0207664_10071978
501 Ga0207664_10307364
502 Ga0207690_10007676
503 Ga0207690_10080255
504 Ga0207690_10124954
505 Ga0207690_10195921
506 Ga0207665_10000336
507 Ga0207711_10409295
508 Ga0207661_10030413
509 Ga0207661_10080009
510 Ga0207661_10546799
511 Ga0207679_10353832
512 Ga0207667_10107175
513 Ga0207667_10192920
514 Ga0207667_10312123
515 Ga0207667_10479981
516 Ga0207639_10563327
517 Ga0207639_10754025
518 Ga0207702_10252702
519 Ga0207702_10280819
520 Ga0207674_10126934
521 Ga0207674_10137257
522 Ga0207683_10425085
523 Ga0207683_10553806
524 Ga0207698_10546933
525 Ga0268266_10390314
526 Ga0373943_0000813
527 Ga0373924_0139887
528 Ga0373931_0358502
529 Ga0373933_0048202
530 Ga0373937_0179742
531 Ga0373937_0326227
532 Ga0373937_0923097
533 Ga0395898_0005936
534 Ga0395905_0325926
535 Ga0436364_1119850
536 Ga0395901_0001626
537 Ga0395901_0260539
538 Ga0436365_0498163
539 Ga0436365_0715499
540 Ga0436365_1067784
541 Ga0436360_0877230
542 Ga0466969_0003408
543 Ga0466972_0057267
544 Ga0466965_0312124
545 Ga0466965_0487007
546 Ga0466966_0035214
547 Ga0466961_0035899
548 Ga0466963_0002026
549 Ga0466963_0010088
550 Ga0466963_0040672
551 Ga0466963_0061838
552 Ga0466963_0132222
553 Ga0466963_0177711
554 Ga0466963_0190534
555 Ga0466963_0208749
556 Ga0466963_0250254
557 Ga0466964_0014504
558 Ga0466964_0101625
559 Ga0466971_0003820
560 Ga0466968_0004132
561 Ga0466968_0007515
562 Ga0466968_0008446
563 Ga0466968_0110866
564 Ga0466970_0006066
565 Ga0466970_0201682
566 Ga0466957_0016844
567 Ga0466957_0026707
568 Ga0466957_0046110
569 Ga0466957_0059518
570 Ga0466957_0104383
571 Ga0466957_0113537
572 Ga0466959_0023616
573 Ga0466959_0030126
574 Ga0466959_0045281
575 Ga0466959_0503472
576 Ga0466958_0007722
577 Ga0466958_0017077
578 Ga0466958_0054712
579 Ga0466958_0055626
580 Ga0466958_0081052
581 Ga0466958_0118993
582 Ga0466967_0023050
583 Ga0466967_0063760
584 Ga0466967_0080521
585 Ga0466967_0107049
586 Ga0466967_0130823
587 Ga0466967_0132120
588 Ga0466967_0153727
589 Ga0466967_0188349
590 Ga0466967_0271084
591 Ga0466967_0452405
592 Ga0466967_0796025
593 Ga0466967_0896813
594 Ga0495592_0155572
595 Ga0495629_0012079
596 Ga0495629_0021140
597 Ga0495641_0190932
598 Ga0495651_0165733
599 Ga0495580_0696060
600 Ga0495582_0059431
601 Ga0495664_0133115
602 Ga0495594_0340292
603 Ga0495607_0295645
604 Ga0495608_0013436
605 Ga0495618_0256695
606 Ga0495618_0532995
607 Ga0495628_0032870
608 Ga0495628_0110071
609 Ga0495628_0681115
610 Ga0495630_0032508
611 Ga0495630_0408900
612 Ga0495652_0096105
613 Ga0495652_0312830
614 Ga0495640_0070882
615 Ga0495586_0276834
616 Ga0495587_0038827
617 Ga0495645_0140082
618 Ga0495667_0114280
619 Ga0495634_0119812
620 Ga0495611_0149956
621 Ga0495635_0056709
622 Ga0495657_0032513
623 Ga0495599_0064303
624 Ga0495599_0294612
625 Ga0495623_0048767
626 Ga0495623_0123176
627 Ga0495646_0148816
628 Ga0495647_0318764
629 Ga0495624_0133339
630 Ga0495624_0227765
631 Ga0495600_0170845
632 Ga0495604_0059748
633 Ga0495674_0024946
634 Ga0495680_0060891
635 Ga0495593_0292981
636 Ga0495602_0032497
637 Ga0496100_0074762
638 Ga0496100_0821414
639 Ga0496101_0045079
640 Ga0496101_0162314
641 Ga0496102_0014363
642 Ga0496103_0030216
643 Ga0496104_0082565
644 Ga0496104_0202938
645 Ga0496104_0619943
646 Ga0496105_0011313
647 Ga0496105_0032718
648 Ga0496105_0046118
649 Ga0496106_0005920
650 Ga0496107_0044130
651 Ga0496107_0305722
652 Ga0496107_0317154
653 Ga0496108_0104178
654 Ga0496108_0649113
655 Ga0496109_0014655
656 Ga0496109_0101168
657 Ga0496110_0052832
658 Ga0496110_0064302
659 Ga0496111_0045295
660 Ga0496112_0008431
661 Ga0496112_0122891
662 Ga0496113_0029957
663 Ga0496113_0062081
664 Ga0496113_0251734
665 Ga0496114_0007467
666 Ga0496114_0181088
667 Ga0496115_0368757
668 Ga0496115_0582110
669 Ga0496115_0777440
670 Ga0496115_0882394
671 Ga0501067_0020546
672 Ga0501069_0017354
673 Ga0501069_0046131
674 Ga0501081_0627369
675 nmdc:mga0n895_294034_c1
676 nmdc:mga0n895_30550_c1
677 nmdc:mga0rr50_123271_c1
678 nmdc:mga0rr50_404590_c1
679 nmdc:mga0a205_78360_c1
680 Ga0495601_0008713
681 Ga0495601_0089996
682 Ga0495601_0533241
683 Ga0495612_0105286
684 Ga0495655_0175344
685 Ga0495595_0001728
686 Ga0495619_0008692
687 Ga0495619_0178563
688 Ga0466962_0001252
689 Ga0466962_0046681
690 Ga0530510_0021312

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
2dfu-assembly1.cif.gz_A crystal structure of the 2-hydroxyhepta-2,4-diene-1,7-dioate isomerase from thermus thermophilus hb8 0.7558 131 160
2dfu-assembly2.cif.gz_C crystal structure of the 2-hydroxyhepta-2,4-diene-1,7-dioate isomerase from thermus thermophilus hb8 0.7526 131 160
2dfu-assembly2.cif.gz_D crystal structure of the 2-hydroxyhepta-2,4-diene-1,7-dioate isomerase from thermus thermophilus hb8 0.7302 131 160
6jvv-assembly1.cif.gz_B crystal structure of maleylpyruvate hydrolase from sphingobium.sp syk-6 0.7115 131 149
6jvw-assembly1.cif.gz_B crystal structure of maleylpyruvate hydrolase from sphingobium sp. syk-6 in complex with manganese (ii) ion and pyruvate 0.7059 131 149
ID Description Score Start End Superfamily
af_C0M4B0_278_410_2.110.10.10 Mainly Beta;4 Propeller;Hemopexin;Hemopexin-like domain 0.7567 136 160 2.110.10.10
af_F1Q5D8_106_273_2.110.10.10 Mainly Beta;4 Propeller;Hemopexin;Hemopexin-like domain 0.718 132 160 2.110.10.10
af_Q1EG33_893_1009_3.30.70.2630 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.7164 131 160 3.30.70.2630
af_P57748_287_482_2.110.10.10 Mainly Beta;4 Propeller;Hemopexin;Hemopexin-like domain 0.7113 129 160 2.110.10.10
af_E7F3C3_298_490_2.110.10.10 Mainly Beta;4 Propeller;Hemopexin;Hemopexin-like domain 0.7059 128 161 2.110.10.10
ID Description Score Start End GO Terms
AF-A0A7W0JKN3-F1-model_v4 Uncharacterized protein 0.9272 44 195
AF-A0A538LLU7-F1-model_v4 Ada DNA repair metal-binding domain-containing protein 0.9261 42 162
AF-A0A2U3LUR2-F1-model_v4 Uncharacterized protein 0.926 78 186
AF-A0A2V6Z2E1-F1-model_v4 Uncharacterized protein 0.9208 67 186
AF-A0A7V8WTH3-F1-model_v4 Uncharacterized protein 0.913 127 198

Map