F416379

General Info

Members Datasets Scaffolds Average Seq Length
345 210 690 87

Family's Representative Sequence

Representative Sequence 3300013296|Ga0157374_10246943|Ga0157374_102469433
Length 90
Sequence MKIMALAHSKVTSQGQISVPSGVRRKLGIGPGSVLEWDEDGDKIVVRRSGRFSSEDIHRALFPRKVAKTKTLEEMKEGIRRRARERYARR

Samples

Sample ID Description Type Environment
1 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
2 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
3 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
13 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
14 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
15 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
16 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
17 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
18 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
19 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
20 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
21 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
22 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
23 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
24 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
25 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
26 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
27 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
28 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
29 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
30 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
31 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
32 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
33 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
34 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
35 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
36 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
37 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
38 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
39 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
40 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
41 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
42 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
43 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
44 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
45 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
46 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
47 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
48 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
49 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
50 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
51 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
52 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
54 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
55 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
56 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
58 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
59 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
60 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
61 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
62 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
63 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
64 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
65 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
66 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
67 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
68 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
69 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
70 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
71 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
72 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
73 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
74 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
75 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
76 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
77 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
118 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
119 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
120 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
121 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
122 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
123 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
124 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
125 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
126 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
127 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
128 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
129 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
130 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
131 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
132 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
133 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
134 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
135 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
136 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
137 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
138 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
139 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
140 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
141 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
142 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
143 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
144 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
145 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
146 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
147 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
148 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
149 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
150 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
151 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
152 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
153 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
154 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
155 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
156 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
157 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
158 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
159 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
160 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
161 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
162 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
163 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
164 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
165 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
166 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
167 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
168 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
169 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
170 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
171 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
172 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
173 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
174 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
175 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
176 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
177 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
178 3300049518 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control Metagenome Rhizosphere
179 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
180 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
181 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
182 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
183 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
184 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
185 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
186 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
187 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
188 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
189 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
190 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
191 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
192 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
193 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
194 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
195 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
196 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
197 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
198 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
199 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
200 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
201 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
202 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
203 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
204 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
205 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
206 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
207 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
208 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
209 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
210 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.71
Metatranscriptomes 0.29
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.87
Nodule 0
Rhizoplane 1.45
Rhizosphere 97.1
Stem 0
Stem Tuber 0
Unclassified 37.97

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157374_10246943 3300013296 Bacteria 1756
2 Ga0065707_10333993 3300005295 Bacteria 945
3 Ga0070670_100280721 3300005331 Bacteria 1454
4 Ga0068869_100928508 3300005334 Bacteria 754
5 Ga0070666_11406490 3300005335 Unclassified 521
6 Ga0068868_101646215 3300005338 Bacteria 604
7 Ga0070689_100402953 3300005340 Bacteria 1157
8 Ga0070689_100715413 3300005340 Bacteria 875
9 Ga0070687_100461584 3300005343 Bacteria 847
10 Ga0070668_101146217 3300005347 Unclassified 703
11 Ga0070669_100022347 3300005353 Unclassified 4522
12 Ga0070669_100481013 3300005353 Bacteria 1027
13 Ga0070669_100654783 3300005353 Bacteria 884
14 Ga0070675_100391153 3300005354 Bacteria 1239
15 Ga0070673_100029129 3300005364 Bacteria 4115
16 Ga0070673_100126788 3300005364 Unclassified 2137
17 Ga0070688_100522829 3300005365 Unclassified 898
18 Ga0070667_100154288 3300005367 Bacteria 2019
19 Ga0070667_101492331 3300005367 Bacteria 635
20 Ga0070667_101618935 3300005367 Bacteria 609
21 Ga0070709_10588947 3300005434 Bacteria 855
22 Ga0070710_10934062 3300005437 Unclassified 628
23 Ga0070701_10011249 3300005438 Bacteria 3993
24 Ga0070711_101213098 3300005439 Unclassified 653
25 Ga0070705_101058732 3300005440 Unclassified 661
26 Ga0070700_101225748 3300005441 Bacteria 627
27 Ga0070694_100660143 3300005444 Bacteria 847
28 Ga0070708_101425018 3300005445 Unclassified 646
29 Ga0070678_100326214 3300005456 Unclassified 1312
30 Ga0068867_100723507 3300005459 Unclassified 880
31 Ga0070706_101469192 3300005467 Unclassified 623
32 Ga0070698_101152186 3300005471 Bacteria 724
33 Ga0070679_100913190 3300005530 Bacteria 822
34 Ga0070684_100418473 3300005535 Bacteria 1237
35 Ga0070697_100331897 3300005536 Bacteria 1311
36 Ga0070672_100359936 3300005543 Bacteria 1242
37 Ga0070686_100587780 3300005544 Bacteria 876
38 Ga0070686_100900725 3300005544 Unclassified 719
39 Ga0070704_100230655 3300005549 Bacteria 1510
40 Ga0068855_100195292 3300005563 Bacteria 2280
41 Ga0070664_100052804 3300005564 Bacteria 3443
42 Ga0070664_101198954 3300005564 Unclassified 716
43 Ga0068857_102090794 3300005577 Unclassified 556
44 Ga0068856_100051441 3300005614 Bacteria 4061
45 Ga0068856_100351809 3300005614 Bacteria 1492
46 Ga0068859_100051394 3300005617 Bacteria 4142
47 Ga0068859_100060329 3300005617 Bacteria 3822
48 Ga0068859_100532810 3300005617 Bacteria 1269
49 Ga0068859_102604832 3300005617 Unclassified 556
50 Ga0068864_100886840 3300005618 Bacteria 880
51 Ga0068861_101452602 3300005719 Unclassified 671
52 Ga0068861_101461460 3300005719 Unclassified 669
53 Ga0068870_10188660 3300005840 Bacteria 1242
54 Ga0068863_100633441 3300005841 Bacteria 1060
55 Ga0068858_100046709 3300005842 Unclassified 4013
56 Ga0068858_100139007 3300005842 Unclassified 2280
57 Ga0068858_100144790 3300005842 Bacteria 2231
58 Ga0068860_100323965 3300005843 Unclassified 1513
59 Ga0068860_100363269 3300005843 Bacteria 1427
60 Ga0068860_100539534 3300005843 Bacteria 1168
61 Ga0068862_100121081 3300005844 Unclassified 2306
62 Ga0097621_100026842 3300006237 Bacteria 4523
63 Ga0068871_100072918 3300006358 Bacteria 2829
64 Ga0068871_100078514 3300006358 Unclassified 2730
65 Ga0068871_100095822 3300006358 Bacteria 2478
66 Ga0068871_100227119 3300006358 Bacteria 1619
67 Ga0075428_101856278 3300006844 Bacteria 627
68 Ga0075431_100014504 3300006847 Bacteria 7972
69 Ga0075431_101880290 3300006847 Bacteria 554
70 Ga0075433_10652943 3300006852 Bacteria 922
71 Ga0075433_10804225 3300006852 Unclassified 821
72 Ga0068865_101043630 3300006881 Unclassified 718
73 Ga0068865_102044377 3300006881 Bacteria 520
74 Ga0075436_100356802 3300006914 Bacteria 1054
75 Ga0097620_100051394 3300006931 Bacteria 4142
76 Ga0097620_100060328 3300006931 Bacteria 3822
77 Ga0097620_100532794 3300006931 Bacteria 1269
78 Ga0097620_102605941 3300006931 Unclassified 556
79 Ga0075435_101561274 3300007076 Unclassified 579
80 Ga0099794_10052874 3300007265 Unclassified 1958
81 Ga0105240_10340913 3300009093 Unclassified 1702
82 Ga0105240_11315450 3300009093 Unclassified 762
83 Ga0105240_12389671 3300009093 Unclassified 547
84 Ga0111539_10240016 3300009094 Unclassified 2110
85 Ga0105245_10037222 3300009098 Bacteria 4326
86 Ga0105245_10048810 3300009098 Unclassified 3788
87 Ga0105245_10496486 3300009098 Unclassified 1236
88 Ga0105245_10570093 3300009098 Bacteria 1156
89 Ga0105245_10851607 3300009098 Bacteria 952
90 Ga0105245_11547322 3300009098 Unclassified 714
91 Ga0105247_10461931 3300009101 Bacteria 917
92 Ga0114129_11615455 3300009147 Unclassified 793
93 Ga0114129_13497596 3300009147 Unclassified 502
94 Ga0105243_10232266 3300009148 Unclassified 1637
95 Ga0105243_10339319 3300009148 Bacteria 1376
96 Ga0105241_10180132 3300009174 Bacteria 1752
97 Ga0105241_10350787 3300009174 Bacteria 1281
98 Ga0105241_10436614 3300009174 Unclassified 1155
99 Ga0105241_11547026 3300009174 Unclassified 640
100 Ga0105241_12356328 3300009174 Unclassified 531
101 Ga0105242_10092170 3300009176 Unclassified 2552
102 Ga0105242_10519033 3300009176 Bacteria 1136
103 Ga0105242_13074781 3300009176 Bacteria 517
104 Ga0105248_10025057 3300009177 Bacteria 6631
105 Ga0105248_10283883 3300009177 Unclassified 1864
106 Ga0105248_10285026 3300009177 Unclassified 1860
107 Ga0105237_12155166 3300009545 Bacteria 567
108 Ga0105237_12378601 3300009545 Unclassified 540
109 Ga0105238_10027921 3300009551 Bacteria 5751
110 Ga0105238_10476695 3300009551 Unclassified 1247
111 Ga0105249_10002469 3300009553 Bacteria 16028
112 Ga0105249_10339271 3300009553 Bacteria 1519
113 Ga0105249_11101497 3300009553 Bacteria 864
114 Ga0105239_10015885 3300010375 Bacteria 8334
115 Ga0105239_11261568 3300010375 Unclassified 852
116 Ga0105239_12114379 3300010375 Bacteria 654
117 Ga0105246_10046251 3300011119 Unclassified 2968
118 Ga0105246_10183480 3300011119 Bacteria 1613
119 Ga0105246_11632977 3300011119 Unclassified 610
120 Ga0157374_10225359 3300013296 Bacteria 1841
121 Ga0157374_10399037 3300013296 Unclassified 1372
122 Ga0157374_10428865 3300013296 Unclassified 1322
123 Ga0157378_10092300 3300013297 Bacteria 2754
124 Ga0157378_10649819 3300013297 Unclassified 1070
125 Ga0157378_11712406 3300013297 Bacteria 676
126 Ga0157378_12083151 3300013297 Bacteria 618
127 Ga0163162_10183756 3300013306 Unclassified 2217
128 Ga0163162_10379405 3300013306 Bacteria 1547
129 Ga0163162_11514481 3300013306 Unclassified 764
130 Ga0163162_11719628 3300013306 Bacteria 716
131 Ga0157372_10707602 3300013307 Bacteria 1172
132 Ga0157372_11282775 3300013307 Unclassified 845
133 Ga0157375_10100964 3300013308 Bacteria 2967
134 Ga0157375_10141302 3300013308 Bacteria 2535
135 Ga0157375_11013878 3300013308 Unclassified 969
136 Ga0163163_10032211 3300014325 Bacteria 5063
137 Ga0163163_13147141 3300014325 Unclassified 515
138 Ga0157380_10194018 3300014326 Bacteria 1796
139 Ga0157380_10939770 3300014326 Unclassified 894
140 Ga0157380_12517734 3300014326 Unclassified 580
141 Ga0157379_10028387 3300014968 Bacteria 4977
142 Ga0157379_11105664 3300014968 Bacteria 759
143 Ga0157376_10203957 3300014969 Unclassified 1821
144 Ga0157376_10526347 3300014969 Bacteria 1166
145 Ga0157376_11029795 3300014969 Bacteria 847
146 Ga0157376_11437643 3300014969 Unclassified 722
147 Ga0207680_10023627 3300025903 Bacteria 3360
148 Ga0207680_11319599 3300025903 Unclassified 513
149 Ga0207643_10284411 3300025908 Bacteria 1026
150 Ga0207654_10406377 3300025911 Bacteria 948
151 Ga0207654_10880545 3300025911 Bacteria 649
152 Ga0207707_10076835 3300025912 Bacteria 2914
153 Ga0207707_10291163 3300025912 Bacteria 1413
154 Ga0207707_10902276 3300025912 Unclassified 730
155 Ga0207695_10209424 3300025913 Unclassified 1861
156 Ga0207695_10845635 3300025913 Unclassified 795
157 Ga0207663_10836733 3300025916 Bacteria 734
158 Ga0207660_10058995 3300025917 Unclassified 2753
159 Ga0207662_10571652 3300025918 Bacteria 784
160 Ga0207657_10708062 3300025919 Bacteria 782
161 Ga0207652_10070706 3300025921 Bacteria 3031
162 Ga0207652_10669658 3300025921 Bacteria 927
163 Ga0207652_11723959 3300025921 Unclassified 531
164 Ga0207681_10522384 3300025923 Unclassified 974
165 Ga0207694_10020746 3300025924 Bacteria 4974
166 Ga0207694_10280079 3300025924 Bacteria 1369
167 Ga0207650_10214315 3300025925 Bacteria 1547
168 Ga0207659_10142274 3300025926 Bacteria 1863
169 Ga0207687_10158575 3300025927 Bacteria 1734
170 Ga0207687_10387024 3300025927 Unclassified 1147
171 Ga0207700_10862133 3300025928 Bacteria 810
172 Ga0207686_11494667 3300025934 Unclassified 557
173 Ga0207670_10311882 3300025936 Bacteria 1235
174 Ga0207670_10686078 3300025936 Bacteria 847
175 Ga0207670_11056840 3300025936 Bacteria 684
176 Ga0207704_10602549 3300025938 Bacteria 899
177 Ga0207691_10526256 3300025940 Unclassified 1003
178 Ga0207711_10053860 3300025941 Bacteria 3451
179 Ga0207711_10172570 3300025941 Unclassified 1963
180 Ga0207689_10131815 3300025942 Bacteria 2057
181 Ga0207689_10716503 3300025942 Bacteria 844
182 Ga0207661_10366216 3300025944 Bacteria 1303
183 Ga0207679_10148270 3300025945 Unclassified 1906
184 Ga0207667_10083190 3300025949 Bacteria 3314
185 Ga0207651_10062119 3300025960 Bacteria 2602
186 Ga0207712_10286329 3300025961 Bacteria 1347
187 Ga0207668_11128965 3300025972 Unclassified 703
188 Ga0207668_11282972 3300025972 Bacteria 659
189 Ga0207658_11533518 3300025986 Bacteria 609
190 Ga0207677_10196518 3300026023 Unclassified 1600
191 Ga0207703_10019428 3300026035 Bacteria 5309
192 Ga0207702_10538883 3300026078 Unclassified 1141
193 Ga0207702_10888612 3300026078 Unclassified 883
194 Ga0207702_11351301 3300026078 Unclassified 706
195 Ga0207702_11880829 3300026078 Unclassified 590
196 Ga0207641_11384461 3300026088 Bacteria 704
197 Ga0207641_12363833 3300026088 Unclassified 531
198 Ga0207676_11017816 3300026095 Bacteria 817
199 Ga0207674_10002275 3300026116 Bacteria 24344
200 Ga0207674_11002571 3300026116 Unclassified 804
201 Ga0207675_100113837 3300026118 Bacteria 2554
202 Ga0207675_101809215 3300026118 Bacteria 630
203 Ga0207675_102211922 3300026118 Unclassified 565
204 Ga0207698_11591427 3300026142 Unclassified 669
205 Ga0209588_1004935 3300027671 Unclassified 3792
206 Ga0268265_10024083 3300028380 Bacteria 4301
207 Ga0268264_10284332 3300028381 Unclassified 1551
208 Ga0268264_10446683 3300028381 Bacteria 1252
209 Ga0265760_10046706 3300031090 Unclassified 1299
210 Ga0265331_10225291 3300031250 Unclassified 842
211 Ga0265331_10409629 3300031250 Unclassified 608
212 Ga0265316_10026690 3300031344 Bacteria 4798
213 Ga0265316_10088425 3300031344 Bacteria 2365
214 Ga0265316_10257074 3300031344 Unclassified 1281
215 Ga0265316_10722589 3300031344 Unclassified 701
216 Ga0265314_10204723 3300031711 Bacteria 1163
217 Ga0265314_10667741 3300031711 Unclassified 529
218 Ga0307413_10441012 3300031824 Unclassified 1031
219 Ga0307409_100240362 3300031995 Bacteria 1648
220 Ga0307416_100195847 3300032002 Bacteria 1911
221 Ga0307416_103026755 3300032002 Unclassified 562
222 Ga0307414_10544857 3300032004 Bacteria 1033
223 Ga0307411_10574761 3300032005 Bacteria 965
224 Ga0307415_100206894 3300032126 Bacteria 1562
225 Ga0373934_0043442 3300035086 Unclassified 1776
226 Ga0373934_0122083 3300035086 Bacteria 1060
227 Ga0373944_0320213 3300035089 Bacteria 585
228 Ga0373923_0073080 3300035111 Unclassified 1476
229 Ga0373923_0102589 3300035111 Bacteria 1263
230 Ga0373945_0302759 3300035116 Unclassified 685
231 Ga0373954_0006941 3300035118 Bacteria 4942
232 Ga0373954_0017640 3300035118 Unclassified 3208
233 Ga0373955_0008185 3300035172 Bacteria 4843
234 Ga0373955_0105998 3300035172 Bacteria 1620
235 Ga0373924_0504527 3300035410 Unclassified 544
236 Ga0373935_0580341 3300035692 Bacteria 819
237 Ga0373927_0004202 3300035695 Bacteria 10116
238 Ga0373933_0179839 3300035724 Bacteria 1349
239 Ga0373937_0026491 3300036401 Bacteria 5240
240 Ga0373937_0655619 3300036401 Unclassified 995
241 Ga0373925_0141800 3300037068 Unclassified 1881
242 Ga0373925_0276531 3300037068 Unclassified 1352
243 Ga0373925_0569362 3300037068 Bacteria 932
244 Ga0373925_0756849 3300037068 Unclassified 801
245 Ga0436364_0244766 3300037853 Bacteria 1262
246 Ga0436360_0746252 3300039438 Unclassified 681
247 Ga0436361_0791283 3300039447 Unclassified 573
248 Ga0436363_1472041 3300039450 Bacteria 670
249 Ga0439459_0164013 3300042438 Unclassified 588
250 Ga0453683_0426381 3300044673 Unclassified 856
251 Ga0451576_0030641 3300045051 Bacteria 5747
252 Ga0451576_1934922 3300045051 Unclassified 608
253 Ga0495651_0170599 3300046462 Bacteria 1550
254 Ga0495580_0011558 3300046472 Bacteria 6829
255 Ga0495580_0011682 3300046472 Bacteria 6790
256 Ga0495580_0062776 3300046472 Unclassified 2606
257 Ga0495582_0062536 3300046473 Bacteria 2056
258 Ga0495639_0198852 3300046475 Bacteria 980
259 Ga0495639_0711223 3300046475 Bacteria 519
260 Ga0495639_0727941 3300046475 Bacteria 513
261 Ga0495662_0093454 3300046476 Bacteria 1468
262 Ga0495664_0420245 3300046477 Bacteria 802
263 Ga0495664_0453171 3300046477 Bacteria 768
264 Ga0495664_0607585 3300046477 Unclassified 650
265 Ga0495608_0416572 3300046511 Bacteria 820
266 Ga0495620_0001403 3300046515 Bacteria 14470
267 Ga0495628_1086347 3300046516 Unclassified 547
268 Ga0495630_0265191 3300046517 Unclassified 1312
269 Ga0495652_0265593 3300046529 Unclassified 1264
270 Ga0495665_0116419 3300046531 Bacteria 1400
271 Ga0495586_0059173 3300046535 Unclassified 2082
272 Ga0495587_0109662 3300046536 Bacteria 1586
273 Ga0495587_0292941 3300046536 Bacteria 911
274 Ga0495587_0366387 3300046536 Bacteria 802
275 Ga0495598_0436124 3300046537 Bacteria 517
276 Ga0495645_0288954 3300046543 Bacteria 1076
277 Ga0495645_0406208 3300046543 Bacteria 867
278 Ga0495667_0973222 3300046559 Unclassified 518
279 Ga0495634_0031435 3300046642 Bacteria 3657
280 Ga0495635_0421004 3300046663 Bacteria 885
281 Ga0495599_0002284 3300046678 Bacteria 11157
282 Ga0495647_0518269 3300046681 Bacteria 556
283 Ga0495658_0022630 3300046683 Bacteria 3326
284 Ga0495658_0268752 3300046683 Bacteria 1074
285 Ga0495581_0186832 3300047315 Bacteria 1212
286 Ga0495604_0409411 3300047317 Bacteria 892
287 Ga0495674_0198142 3300047319 Bacteria 1667
288 Ga0495674_1257029 3300047319 Bacteria 557
289 Ga0495675_0062490 3300047444 Bacteria 2358
290 Ga0495675_0199256 3300047444 Unclassified 1219
291 Ga0495675_0336860 3300047444 Unclassified 890
292 Ga0495675_0614258 3300047444 Unclassified 615
293 Ga0495675_0733860 3300047444 Unclassified 551
294 Ga0495602_0244750 3300048088 Bacteria 1340
295 Ga0496104_0520247 3300048907 Bacteria 1101
296 Ga0496107_0263406 3300048910 Bacteria 1283
297 Ga0496114_0014360 3300048917 Bacteria 6353
298 Ga0496115_0309174 3300048918 Bacteria 1294
299 Ga0496115_0398475 3300048918 Unclassified 1117
300 Ga0501291_037918 3300049514 Bacteria 837
301 Ga0501295_055696 3300049518 Bacteria 856
302 Ga0501036_1156765 3300049572 Unclassified 631
303 Ga0501036_1621518 3300049572 Bacteria 522
304 Ga0501038_1067270 3300049574 Unclassified 591
305 Ga0501039_0502660 3300049575 Bacteria 952
306 Ga0501039_0787499 3300049575 Bacteria 742
307 Ga0501042_0292742 3300049578 Bacteria 1176
308 Ga0501042_0347794 3300049578 Bacteria 1072
309 Ga0501048_0959152 3300049582 Bacteria 615
310 Ga0501048_1047801 3300049582 Unclassified 587
311 Ga0501070_0604217 3300049586 Unclassified 874
312 Ga0501071_0017217 3300049587 Bacteria 4982
313 Ga0501071_0483785 3300049587 Bacteria 949
314 Ga0501072_0188060 3300049588 Bacteria 1647
315 Ga0501074_0532359 3300049590 Bacteria 832
316 Ga0501075_0302152 3300049591 Bacteria 1219
317 Ga0501075_1496526 3300049591 Unclassified 511
318 Ga0501076_0836566 3300049592 Bacteria 759
319 Ga0501077_0132570 3300049593 Bacteria 1580
320 Ga0501238_065741 3300049671 Bacteria 559
321 Ga0501239_025303 3300049672 Bacteria 752
322 Ga0501225_0276604 3300049705 Bacteria 561
323 Ga0501079_0456646 3300049741 Bacteria 1003
324 Ga0501080_1446357 3300049742 Bacteria 585
325 Ga0501081_0241942 3300049743 Bacteria 1316
326 Ga0501081_1289808 3300049743 Unclassified 554
327 Ga0501265_022953 3300049762 Unclassified 855
328 Ga0501035_1199024 3300049822 Unclassified 589
329 Ga0501045_0678971 3300049824 Unclassified 760
330 Ga0501045_1108334 3300049824 Bacteria 579
331 nmdc:mga06r32_4710_c1 3300050510 Bacteria 12264
332 nmdc:mga08y16_400482_c1 3300050511 Unclassified 1405
333 nmdc:mga08x19_241698_c1 3300050514 Bacteria 1245
334 nmdc:mga0a205_602824_c1 3300050515 Unclassified 951
335 Ga0495595_0461437 3300053084 Bacteria 646
336 Ga0495619_0223921 3300053085 Bacteria 1303
337 Ga0495619_0383897 3300053085 Bacteria 971
338 Ga0495619_0934370 3300053085 Bacteria 582
339 Ga0500555_000700 3300053103 Bacteria 12657
340 Ga0500555_129722 3300053103 Bacteria 626
341 Ga0500645_000678 3300053730 Bacteria 21271
342 Ga0501084_0270409 3300054114 Bacteria 1435
343 Ga0501082_1536427 3300060353 Unclassified 581
344 Ga0530510_0289245 3300061734 Bacteria 1225
345 Ga0530510_1561468 3300061734 Bacteria 507
346 Ga0157374_10246943
347 Ga0065707_10333993
348 Ga0070670_100280721
349 Ga0068869_100928508
350 Ga0070666_11406490
351 Ga0068868_101646215
352 Ga0070689_100402953
353 Ga0070689_100715413
354 Ga0070687_100461584
355 Ga0070668_101146217
356 Ga0070669_100022347
357 Ga0070669_100481013
358 Ga0070669_100654783
359 Ga0070675_100391153
360 Ga0070673_100029129
361 Ga0070673_100126788
362 Ga0070688_100522829
363 Ga0070667_100154288
364 Ga0070667_101492331
365 Ga0070667_101618935
366 Ga0070709_10588947
367 Ga0070710_10934062
368 Ga0070701_10011249
369 Ga0070711_101213098
370 Ga0070705_101058732
371 Ga0070700_101225748
372 Ga0070694_100660143
373 Ga0070708_101425018
374 Ga0070678_100326214
375 Ga0068867_100723507
376 Ga0070706_101469192
377 Ga0070698_101152186
378 Ga0070679_100913190
379 Ga0070684_100418473
380 Ga0070697_100331897
381 Ga0070672_100359936
382 Ga0070686_100587780
383 Ga0070686_100900725
384 Ga0070704_100230655
385 Ga0068855_100195292
386 Ga0070664_100052804
387 Ga0070664_101198954
388 Ga0068857_102090794
389 Ga0068856_100051441
390 Ga0068856_100351809
391 Ga0068859_100051394
392 Ga0068859_100060329
393 Ga0068859_100532810
394 Ga0068859_102604832
395 Ga0068864_100886840
396 Ga0068861_101452602
397 Ga0068861_101461460
398 Ga0068870_10188660
399 Ga0068863_100633441
400 Ga0068858_100046709
401 Ga0068858_100139007
402 Ga0068858_100144790
403 Ga0068860_100323965
404 Ga0068860_100363269
405 Ga0068860_100539534
406 Ga0068862_100121081
407 Ga0097621_100026842
408 Ga0068871_100072918
409 Ga0068871_100078514
410 Ga0068871_100095822
411 Ga0068871_100227119
412 Ga0075428_101856278
413 Ga0075431_100014504
414 Ga0075431_101880290
415 Ga0075433_10652943
416 Ga0075433_10804225
417 Ga0068865_101043630
418 Ga0068865_102044377
419 Ga0075436_100356802
420 Ga0097620_100051394
421 Ga0097620_100060328
422 Ga0097620_100532794
423 Ga0097620_102605941
424 Ga0075435_101561274
425 Ga0099794_10052874
426 Ga0105240_10340913
427 Ga0105240_11315450
428 Ga0105240_12389671
429 Ga0111539_10240016
430 Ga0105245_10037222
431 Ga0105245_10048810
432 Ga0105245_10496486
433 Ga0105245_10570093
434 Ga0105245_10851607
435 Ga0105245_11547322
436 Ga0105247_10461931
437 Ga0114129_11615455
438 Ga0114129_13497596
439 Ga0105243_10232266
440 Ga0105243_10339319
441 Ga0105241_10180132
442 Ga0105241_10350787
443 Ga0105241_10436614
444 Ga0105241_11547026
445 Ga0105241_12356328
446 Ga0105242_10092170
447 Ga0105242_10519033
448 Ga0105242_13074781
449 Ga0105248_10025057
450 Ga0105248_10283883
451 Ga0105248_10285026
452 Ga0105237_12155166
453 Ga0105237_12378601
454 Ga0105238_10027921
455 Ga0105238_10476695
456 Ga0105249_10002469
457 Ga0105249_10339271
458 Ga0105249_11101497
459 Ga0105239_10015885
460 Ga0105239_11261568
461 Ga0105239_12114379
462 Ga0105246_10046251
463 Ga0105246_10183480
464 Ga0105246_11632977
465 Ga0157374_10225359
466 Ga0157374_10399037
467 Ga0157374_10428865
468 Ga0157378_10092300
469 Ga0157378_10649819
470 Ga0157378_11712406
471 Ga0157378_12083151
472 Ga0163162_10183756
473 Ga0163162_10379405
474 Ga0163162_11514481
475 Ga0163162_11719628
476 Ga0157372_10707602
477 Ga0157372_11282775
478 Ga0157375_10100964
479 Ga0157375_10141302
480 Ga0157375_11013878
481 Ga0163163_10032211
482 Ga0163163_13147141
483 Ga0157380_10194018
484 Ga0157380_10939770
485 Ga0157380_12517734
486 Ga0157379_10028387
487 Ga0157379_11105664
488 Ga0157376_10203957
489 Ga0157376_10526347
490 Ga0157376_11029795
491 Ga0157376_11437643
492 Ga0207680_10023627
493 Ga0207680_11319599
494 Ga0207643_10284411
495 Ga0207654_10406377
496 Ga0207654_10880545
497 Ga0207707_10076835
498 Ga0207707_10291163
499 Ga0207707_10902276
500 Ga0207695_10209424
501 Ga0207695_10845635
502 Ga0207663_10836733
503 Ga0207660_10058995
504 Ga0207662_10571652
505 Ga0207657_10708062
506 Ga0207652_10070706
507 Ga0207652_10669658
508 Ga0207652_11723959
509 Ga0207681_10522384
510 Ga0207694_10020746
511 Ga0207694_10280079
512 Ga0207650_10214315
513 Ga0207659_10142274
514 Ga0207687_10158575
515 Ga0207687_10387024
516 Ga0207700_10862133
517 Ga0207686_11494667
518 Ga0207670_10311882
519 Ga0207670_10686078
520 Ga0207670_11056840
521 Ga0207704_10602549
522 Ga0207691_10526256
523 Ga0207711_10053860
524 Ga0207711_10172570
525 Ga0207689_10131815
526 Ga0207689_10716503
527 Ga0207661_10366216
528 Ga0207679_10148270
529 Ga0207667_10083190
530 Ga0207651_10062119
531 Ga0207712_10286329
532 Ga0207668_11128965
533 Ga0207668_11282972
534 Ga0207658_11533518
535 Ga0207677_10196518
536 Ga0207703_10019428
537 Ga0207702_10538883
538 Ga0207702_10888612
539 Ga0207702_11351301
540 Ga0207702_11880829
541 Ga0207641_11384461
542 Ga0207641_12363833
543 Ga0207676_11017816
544 Ga0207674_10002275
545 Ga0207674_11002571
546 Ga0207675_100113837
547 Ga0207675_101809215
548 Ga0207675_102211922
549 Ga0207698_11591427
550 Ga0209588_1004935
551 Ga0268265_10024083
552 Ga0268264_10284332
553 Ga0268264_10446683
554 Ga0265760_10046706
555 Ga0265331_10225291
556 Ga0265331_10409629
557 Ga0265316_10026690
558 Ga0265316_10088425
559 Ga0265316_10257074
560 Ga0265316_10722589
561 Ga0265314_10204723
562 Ga0265314_10667741
563 Ga0307413_10441012
564 Ga0307409_100240362
565 Ga0307416_100195847
566 Ga0307416_103026755
567 Ga0307414_10544857
568 Ga0307411_10574761
569 Ga0307415_100206894
570 Ga0373934_0043442
571 Ga0373934_0122083
572 Ga0373944_0320213
573 Ga0373923_0073080
574 Ga0373923_0102589
575 Ga0373945_0302759
576 Ga0373954_0006941
577 Ga0373954_0017640
578 Ga0373955_0008185
579 Ga0373955_0105998
580 Ga0373924_0504527
581 Ga0373935_0580341
582 Ga0373927_0004202
583 Ga0373933_0179839
584 Ga0373937_0026491
585 Ga0373937_0655619
586 Ga0373925_0141800
587 Ga0373925_0276531
588 Ga0373925_0569362
589 Ga0373925_0756849
590 Ga0436364_0244766
591 Ga0436360_0746252
592 Ga0436361_0791283
593 Ga0436363_1472041
594 Ga0439459_0164013
595 Ga0453683_0426381
596 Ga0451576_0030641
597 Ga0451576_1934922
598 Ga0495651_0170599
599 Ga0495580_0011558
600 Ga0495580_0011682
601 Ga0495580_0062776
602 Ga0495582_0062536
603 Ga0495639_0198852
604 Ga0495639_0711223
605 Ga0495639_0727941
606 Ga0495662_0093454
607 Ga0495664_0420245
608 Ga0495664_0453171
609 Ga0495664_0607585
610 Ga0495608_0416572
611 Ga0495620_0001403
612 Ga0495628_1086347
613 Ga0495630_0265191
614 Ga0495652_0265593
615 Ga0495665_0116419
616 Ga0495586_0059173
617 Ga0495587_0109662
618 Ga0495587_0292941
619 Ga0495587_0366387
620 Ga0495598_0436124
621 Ga0495645_0288954
622 Ga0495645_0406208
623 Ga0495667_0973222
624 Ga0495634_0031435
625 Ga0495635_0421004
626 Ga0495599_0002284
627 Ga0495647_0518269
628 Ga0495658_0022630
629 Ga0495658_0268752
630 Ga0495581_0186832
631 Ga0495604_0409411
632 Ga0495674_0198142
633 Ga0495674_1257029
634 Ga0495675_0062490
635 Ga0495675_0199256
636 Ga0495675_0336860
637 Ga0495675_0614258
638 Ga0495675_0733860
639 Ga0495602_0244750
640 Ga0496104_0520247
641 Ga0496107_0263406
642 Ga0496114_0014360
643 Ga0496115_0309174
644 Ga0496115_0398475
645 Ga0501291_037918
646 Ga0501295_055696
647 Ga0501036_1156765
648 Ga0501036_1621518
649 Ga0501038_1067270
650 Ga0501039_0502660
651 Ga0501039_0787499
652 Ga0501042_0292742
653 Ga0501042_0347794
654 Ga0501048_0959152
655 Ga0501048_1047801
656 Ga0501070_0604217
657 Ga0501071_0017217
658 Ga0501071_0483785
659 Ga0501072_0188060
660 Ga0501074_0532359
661 Ga0501075_0302152
662 Ga0501075_1496526
663 Ga0501076_0836566
664 Ga0501077_0132570
665 Ga0501238_065741
666 Ga0501239_025303
667 Ga0501225_0276604
668 Ga0501079_0456646
669 Ga0501080_1446357
670 Ga0501081_0241942
671 Ga0501081_1289808
672 Ga0501265_022953
673 Ga0501035_1199024
674 Ga0501045_0678971
675 Ga0501045_1108334
676 nmdc:mga06r32_4710_c1
677 nmdc:mga08y16_400482_c1
678 nmdc:mga08x19_241698_c1
679 nmdc:mga0a205_602824_c1
680 Ga0495595_0461437
681 Ga0495619_0223921
682 Ga0495619_0383897
683 Ga0495619_0934370
684 Ga0500555_000700
685 Ga0500555_129722
686 Ga0500645_000678
687 Ga0501084_0270409
688 Ga0501082_1536427
689 Ga0530510_0289245
690 Ga0530510_1561468

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04014

MazE_antitoxin

Antidote-toxin recognition MazE, bacterial antitoxin

9

53

0.94

Map