F416374
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 345 | 234 | 298 | 262 |
Family's Representative Sequence
| Representative Sequence | 3300013102|Ga0157371_10000079|Ga0157371_1000007935 |
| Length | 250 |
| Sequence | LDLPLRTVTVTRYILPLREGGSLPALAEADDDFKYVLKFRGAGHGVKALISELIGGKVSQVLGFRIPELVFANLSEDFGRSEADEEIQDLLKNSCGLNLALHYLSGAKLSSEIVWLDAFLTNIDRTFRNTNMLMWHQELWLIDNGASLYFHHNWDNWEKNAVSPFVMIKDHVLLPQASELDDVNSKFKAILTDEVLREIVELIPEDWLQWNDTDLNPTEIKEVYYQFLILRRDHSDNFLNEAKNARAKVI |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886012 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 | Metagenome | Rhizosphere |
| 2 | 2519899754 | Flavobacterium sp. F52 | Isolate | Rhizosphere |
| 3 | 2522125168 | Dyadobacter beijingensis DSM 21582 | Isolate | Rhizosphere |
| 4 | 2643221600 | Flavobacterium sp. Root186 | Isolate | Unclassified |
| 5 | 2643221667 | Flavobacterium sp. Root420 | Isolate | Unclassified |
| 6 | 2643221716 | Flavobacterium sp. Root901 | Isolate | Unclassified |
| 7 | 2643221725 | Flavobacterium sp. Root935 | Isolate | Unclassified |
| 8 | 2721755487 | Sphingobacterium sp. B29 | Isolate | Rhizosphere |
| 9 | 2738541278 | Niastella sp. CF465 | Isolate | Unclassified |
| 10 | 2738541279 | Flavobacterium sp. GV069 | Isolate | Unclassified |
| 11 | 2738541284 | Pedobacter sp. YR016 | Isolate | Unclassified |
| 12 | 2738541285 | Flavobacterium sp. GV030 | Isolate | Unclassified |
| 13 | 2738543007 | Flavobacterium sp. GV063 | Isolate | Unclassified |
| 14 | 2739367656 | Pedobacter sp. CF523 | Isolate | Unclassified |
| 15 | 2739367857 | Flavobacterium sp. GV029 | Isolate | Unclassified |
| 16 | 2739367858 | Flavobacterium sp. GV028 | Isolate | Unclassified |
| 17 | 2739367866 | Hymenobacter sp. YR204 | Isolate | Unclassified |
| 18 | 2802428842 | Flavobacterium sp. S87F.05.LMB.W.Kidney.N | Isolate | Unclassified |
| 19 | 2816332280 | Flavobacterium johnsoniae GSE09 | Isolate | Unclassified |
| 20 | 2818991442 | Chitinophaga pinensis 1204 | Isolate | Unclassified |
| 21 | 2818991460 | Chitinophaga polysaccharea 1209 | Isolate | Unclassified |
| 22 | 2821136567 | Chitinophaga sancti 1232 | Isolate | Unclassified |
| 23 | 2842903701 | Olivibacter sp. R-72191 | Isolate | Unclassified |
| 24 | 2857613821 | Flavobacterium sp. R-72247 | Isolate | Unclassified |
| 25 | 2857618242 | Flavobacterium sp. R-74482 | Isolate | Unclassified |
| 26 | 2881359912 | Flavobacterium ustbae T13 | Isolate | Rhizosphere |
| 27 | 2884791551 | Chitinophaga oryzae 1310 | Isolate | Unclassified |
| 28 | 2890804823 | Fluviicola sp. SGL-29 | Isolate | Rhizosphere |
| 29 | 2896109856 | Chitinophaga sp. SYP-B3965 | Isolate | Rhizosphere |
| 30 | 2896317667 | Sphingobacterium sp. SGR-19 | Isolate | Rhizosphere |
| 31 | 2898713307 | Sphingobacterium sp. SGG-5 | Isolate | Rhizosphere |
| 32 | 2903895155 | Flavobacterium sp. HBTb2-11-1 | Isolate | Rhizosphere |
| 33 | 2904419702 | Flavobacterium sp. 1355 | Isolate | Rhizosphere |
| 34 | 2904467357 | Chitinophaga sancti 3198 | Isolate | Unclassified |
| 35 | 2904555929 | Flavobacterium sp. 1750 | Isolate | Rhizosphere |
| 36 | 2919191525 | Flavobacterium sp. 2755 | Isolate | Rhizosphere |
| 37 | 2919437846 | Mucilaginibacter pocheonensis 3262 | Isolate | Rhizosphere |
| 38 | 2929150217 | Flavobacterium sp. R-74510 Hybrid assembly | Isolate | Unclassified |
| 39 | 2929154850 | Filimonas sp. R-72421 Hybrid assembly | Isolate | Unclassified |
| 40 | 2929177148 | Chitinophaga sp. R-72269 Hybrid assembly | Isolate | Unclassified |
| 41 | 2945977869 | Chitinophaga sp. W2I13 | Isolate | Rhizosphere |
| 42 | 2946013367 | Chitinophaga sp. W3I9 | Isolate | Rhizosphere |
| 43 | 2958458903 | Flavobacterium anhuiense RCM74 | Isolate | Rhizosphere |
| 44 | 2965320100 | Flavobacterium agri MAH-1 | Isolate | Rhizosphere |
| 45 | 2977232053 | Mucilaginibacter terrae SORGH_AS 422 | Isolate | Unclassified |
| 46 | 2977268062 | Flavobacterium sp. SORGH_AS 622 | Isolate | Unclassified |
| 47 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 48 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 49 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 50 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 51 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 52 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 53 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 54 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 55 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 56 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 57 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 58 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 59 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 60 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 61 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 62 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 63 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 64 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 65 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 66 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 70 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 71 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 73 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 74 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 75 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 76 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 77 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 78 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 79 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 82 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 83 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 101 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 102 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 103 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 105 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 106 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 107 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 108 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 109 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 110 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 111 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 112 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 113 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 114 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 115 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 116 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 131 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 132 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 133 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 134 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 135 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 136 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 137 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 138 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 139 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 140 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 141 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 142 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 143 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 144 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 145 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 146 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 147 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 148 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 149 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 150 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 151 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 152 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 153 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 154 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 155 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 156 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 157 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 158 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 159 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 160 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 161 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 162 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 163 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 164 | 3300044672 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E | Metagenome | Unclassified |
| 165 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 166 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 167 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 168 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 169 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 170 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 171 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 172 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 173 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 187 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 188 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 189 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 190 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 191 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 192 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 193 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 194 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 196 | 3300049671 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought | Metagenome | Rhizosphere |
| 197 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 198 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 199 | 3300049763 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control | Metagenome | Rhizosphere |
| 200 | 3300049766 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought | Metagenome | Rhizosphere |
| 201 | 3300049776 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought | Metagenome | Rhizosphere |
| 202 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 203 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 204 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 205 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 206 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 207 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 208 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 209 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 210 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 211 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 212 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 213 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 214 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 215 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 216 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 217 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 218 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 219 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 220 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 221 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 222 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 223 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 224 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 225 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 226 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 227 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 228 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 229 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 230 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 231 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 232 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 233 | 8054307821 | Flavobacterium soyae SCIV07 | Isolate | Rhizosphere |
| 234 | 8055419101 | Flavobacterium tyrosinilyticum KCTC 42726 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 86.38 |
| Metatranscriptomes | 0 |
| Isolates | 13.62 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 19.42 |
| Nodule | 0.87 |
| Rhizoplane | 0.29 |
| Rhizosphere | 63.77 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 15.65 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | MBSR1b_contig_13626306 | 2162886012 | Bacteria | 1000 |
| 2 | JGI24739J22299_10000636 | 3300001989 | Bacteria | 12631 |
| 3 | JGI25162J39368_1000130 | 3300002737 | Bacteria | 83005 |
| 4 | JGI25162J39368_1001217 | 3300002737 | Bacteria | 14957 |
| 5 | JGI25165J46597_1001194 | 3300003214 | Bacteria | 15755 |
| 6 | JGI25153J46596_10008465 | 3300003215 | Bacteria | 4911 |
| 7 | rootH1_10118026 | 3300003316 | Bacteria | 4874 |
| 8 | rootH2_10084384 | 3300003320 | Bacteria | 6885 |
| 9 | rootL2_10045912 | 3300003322 | Bacteria | 5820 |
| 10 | rootL2_10081941 | 3300003322 | Bacteria | 3676 |
| 11 | rootH1_10006330 | 3300003323 | Bacteria | 70891 |
| 12 | rootH1_10008848 | 3300003323 | Bacteria | 6906 |
| 13 | rootH1_10017729 | 3300003323 | Bacteria | 5543 |
| 14 | rootH1_10039624 | 3300003323 | Bacteria | 15166 |
| 15 | rootH1_10041830 | 3300003323 | Bacteria | 3707 |
| 16 | JGI25160J50197_1000764 | 3300003354 | Bacteria | 17348 |
| 17 | Ga0055535_1002449 | 3300003761 | Bacteria | 6480 |
| 18 | Ga0055542_1003495 | 3300003762 | Bacteria | 4224 |
| 19 | Ga0055530_10001184 | 3300003791 | Bacteria | 20151 |
| 20 | Ga0055531_10000263 | 3300003794 | Bacteria | 55230 |
| 21 | Ga0055531_10037998 | 3300003794 | Bacteria | 1453 |
| 22 | Ga0055543_1006911 | 3300004625 | Bacteria | 2683 |
| 23 | Ga0065165_1000130 | 3300005262 | Bacteria | 128998 |
| 24 | Ga0065165_1000172 | 3300005262 | Bacteria | 114850 |
| 25 | Ga0065714_10007993 | 3300005288 | Bacteria | 3449 |
| 26 | Ga0065714_10076123 | 3300005288 | Bacteria | 2826 |
| 27 | Ga0065714_10099602 | 3300005288 | Bacteria | 1683 |
| 28 | Ga0065704_10075654 | 3300005289 | Bacteria | 5462 |
| 29 | Ga0065704_10096190 | 3300005289 | Bacteria | 2453 |
| 30 | Ga0065715_10153147 | 3300005293 | Bacteria | 1706 |
| 31 | Ga0070680_100153696 | 3300005336 | Bacteria | 1932 |
| 32 | Ga0070660_100146980 | 3300005339 | Bacteria | 1894 |
| 33 | Ga0070674_100135401 | 3300005356 | Bacteria | 1842 |
| 34 | Ga0070673_100186515 | 3300005364 | Bacteria | 1779 |
| 35 | Ga0068867_100267419 | 3300005459 | Bacteria | 1396 |
| 36 | Ga0068853_100029888 | 3300005539 | Bacteria | 4597 |
| 37 | Ga0068853_100140462 | 3300005539 | Bacteria | 2168 |
| 38 | Ga0070672_100185176 | 3300005543 | Bacteria | 1736 |
| 39 | Ga0068855_100000054 | 3300005563 | Bacteria | 139322 |
| 40 | Ga0068855_100000856 | 3300005563 | Bacteria | 37762 |
| 41 | Ga0068855_100692908 | 3300005563 | Bacteria | 1091 |
| 42 | Ga0068857_100193014 | 3300005577 | Bacteria | 1855 |
| 43 | Ga0068857_100239019 | 3300005577 | Bacteria | 1662 |
| 44 | Ga0068859_100001409 | 3300005617 | Bacteria | 24411 |
| 45 | Ga0068851_10018829 | 3300005834 | Bacteria | 3331 |
| 46 | Ga0068863_100132038 | 3300005841 | Bacteria | 2384 |
| 47 | Ga0068863_100491081 | 3300005841 | Bacteria | 1208 |
| 48 | Ga0081540_1022056 | 3300005983 | Bacteria | 3768 |
| 49 | Ga0075366_10000123 | 3300006195 | Bacteria | 32043 |
| 50 | Ga0075366_10033456 | 3300006195 | Bacteria | 3028 |
| 51 | Ga0075366_10112270 | 3300006195 | Bacteria | 1640 |
| 52 | Ga0097621_100275295 | 3300006237 | Bacteria | 1480 |
| 53 | Ga0097620_100001409 | 3300006931 | Bacteria | 24411 |
| 54 | Ga0099824_1007266 | 3300006942 | Bacteria | 14782 |
| 55 | Ga0099826_10030207 | 3300006948 | Bacteria | 3940 |
| 56 | Ga0105244_10000003 | 3300009036 | Bacteria | 494610 |
| 57 | Ga0105240_10538720 | 3300009093 | Bacteria | 1293 |
| 58 | Ga0105240_10922626 | 3300009093 | Bacteria | 938 |
| 59 | Ga0111539_10110864 | 3300009094 | Bacteria | 3220 |
| 60 | Ga0114129_10010785 | 3300009147 | Bacteria | 13022 |
| 61 | Ga0105237_10005011 | 3300009545 | Bacteria | 15079 |
| 62 | Ga0105237_10019971 | 3300009545 | Bacteria | 6917 |
| 63 | Ga0105237_10030489 | 3300009545 | Bacteria | 5477 |
| 64 | Ga0105237_10251005 | 3300009545 | Bacteria | 1771 |
| 65 | Ga0105249_10494711 | 3300009553 | Bacteria | 1267 |
| 66 | Ga0105239_10000690 | 3300010375 | Bacteria | 48107 |
| 67 | Ga0105239_10003864 | 3300010375 | Bacteria | 18176 |
| 68 | Ga0105239_10029606 | 3300010375 | Bacteria | 6020 |
| 69 | Ga0105239_10188342 | 3300010375 | Bacteria | 2310 |
| 70 | Ga0157373_10000188 | 3300013100 | Bacteria | 50875 |
| 71 | Ga0157373_10000560 | 3300013100 | Bacteria | 29152 |
| 72 | Ga0157373_10218522 | 3300013100 | Bacteria | 1344 |
| 73 | Ga0157373_10491833 | 3300013100 | Bacteria | 886 |
| 74 | Ga0157371_10000079 | 3300013102 | Bacteria | 152295 |
| 75 | Ga0157371_10001546 | 3300013102 | Bacteria | 23668 |
| 76 | Ga0157371_10022026 | 3300013102 | Bacteria | 4676 |
| 77 | Ga0157371_10032458 | 3300013102 | Bacteria | 3757 |
| 78 | Ga0157371_10076593 | 3300013102 | Bacteria | 2369 |
| 79 | Ga0157370_10000060 | 3300013104 | Bacteria | 116178 |
| 80 | Ga0157370_10003737 | 3300013104 | Bacteria | 17794 |
| 81 | Ga0157370_10129819 | 3300013104 | Bacteria | 2351 |
| 82 | Ga0157370_10316085 | 3300013104 | Bacteria | 1441 |
| 83 | Ga0157370_10528546 | 3300013104 | Bacteria | 1082 |
| 84 | Ga0157369_10000766 | 3300013105 | Bacteria | 41505 |
| 85 | Ga0157369_10081103 | 3300013105 | Bacteria | 3473 |
| 86 | Ga0163162_10056004 | 3300013306 | Bacteria | 3971 |
| 87 | Ga0157372_10000458 | 3300013307 | Bacteria | 44772 |
| 88 | Ga0157372_10009152 | 3300013307 | Bacteria | 10520 |
| 89 | Ga0157372_10097563 | 3300013307 | Unclassified | 3352 |
| 90 | Ga0157372_10325881 | 3300013307 | Bacteria | 1788 |
| 91 | Ga0157372_10330433 | 3300013307 | Bacteria | 1775 |
| 92 | Ga0157372_10636781 | 3300013307 | Bacteria | 1242 |
| 93 | Ga0157375_10013896 | 3300013308 | Bacteria | 7178 |
| 94 | Ga0157375_10085227 | 3300013308 | Bacteria | 3209 |
| 95 | Ga0163163_10321737 | 3300014325 | Bacteria | 1600 |
| 96 | Ga0157380_10008496 | 3300014326 | Bacteria | 7336 |
| 97 | Ga0157380_10044606 | 3300014326 | Bacteria | 3476 |
| 98 | Ga0157376_10068838 | 3300014969 | Bacteria | 2999 |
| 99 | Ga0182006_1003023 | 3300015261 | Bacteria | 8852 |
| 100 | Ga0182006_1018310 | 3300015261 | Bacteria | 2961 |
| 101 | Ga0182006_1028214 | 3300015261 | Bacteria | 2284 |
| 102 | Ga0182006_1029315 | 3300015261 | Bacteria | 2230 |
| 103 | Ga0182006_1064257 | 3300015261 | Bacteria | 1376 |
| 104 | Ga0182007_10004282 | 3300015262 | Bacteria | 6506 |
| 105 | Ga0182005_1000179 | 3300015265 | Bacteria | 43636 |
| 106 | Ga0163161_10000131 | 3300017792 | Bacteria | 70473 |
| 107 | Ga0163161_10000224 | 3300017792 | Bacteria | 51786 |
| 108 | Ga0163161_10001043 | 3300017792 | Bacteria | 21096 |
| 109 | Ga0163161_10070229 | 3300017792 | Bacteria | 2561 |
| 110 | Ga0209436_107532 | 3300025208 | Bacteria | 2261 |
| 111 | Ga0207427_100137 | 3300025231 | Bacteria | 88182 |
| 112 | Ga0209437_100089 | 3300025233 | Bacteria | 250476 |
| 113 | Ga0209437_100112 | 3300025233 | Bacteria | 214292 |
| 114 | Ga0209258_100193 | 3300025242 | Bacteria | 124682 |
| 115 | Ga0209148_1000167 | 3300025254 | Bacteria | 135407 |
| 116 | Ga0209233_1000126 | 3300025261 | Bacteria | 214298 |
| 117 | Ga0209130_1010994 | 3300025284 | Bacteria | 2449 |
| 118 | Ga0209676_1001696 | 3300025292 | Bacteria | 19052 |
| 119 | Ga0209758_1005024 | 3300025297 | Bacteria | 10537 |
| 120 | Ga0209050_1000453 | 3300025298 | Bacteria | 73731 |
| 121 | Ga0209050_1002589 | 3300025298 | Bacteria | 14993 |
| 122 | Ga0207426_1000034 | 3300025302 | Bacteria | 454016 |
| 123 | Ga0207426_1002680 | 3300025302 | Bacteria | 10899 |
| 124 | Ga0209257_1000025 | 3300025304 | Bacteria | 724838 |
| 125 | Ga0209257_1004280 | 3300025304 | Bacteria | 11250 |
| 126 | Ga0207655_1000010 | 3300025728 | Bacteria | 649325 |
| 127 | Ga0207682_10013033 | 3300025893 | Bacteria | 3242 |
| 128 | Ga0207671_10002069 | 3300025914 | Bacteria | 21951 |
| 129 | Ga0207671_10020551 | 3300025914 | Bacteria | 5025 |
| 130 | Ga0207652_10009213 | 3300025921 | Bacteria | 7942 |
| 131 | Ga0207659_10134631 | 3300025926 | Bacteria | 1911 |
| 132 | Ga0207691_10098967 | 3300025940 | Bacteria | 2605 |
| 133 | Ga0207689_10381524 | 3300025942 | Bacteria | 1173 |
| 134 | Ga0207667_10000023 | 3300025949 | Bacteria | 362527 |
| 135 | Ga0207667_10006360 | 3300025949 | Bacteria | 14316 |
| 136 | Ga0207651_10116940 | 3300025960 | Bacteria | 2014 |
| 137 | Ga0207640_10277067 | 3300025981 | Bacteria | 1315 |
| 138 | Ga0207639_10047981 | 3300026041 | Bacteria | 3230 |
| 139 | Ga0207641_10449438 | 3300026088 | Bacteria | 1245 |
| 140 | Ga0207648_10124709 | 3300026089 | Bacteria | 2265 |
| 141 | Ga0207674_10123763 | 3300026116 | Bacteria | 2552 |
| 142 | Ga0207674_10235558 | 3300026116 | Bacteria | 1778 |
| 143 | Ga0209489_120518 | 3300027361 | Bacteria | 1879 |
| 144 | Ga0207428_10202225 | 3300027907 | Bacteria | 1494 |
| 145 | Ga0307515_10000235 | 3300028794 | Bacteria | 136714 |
| 146 | Ga0307515_10000280 | 3300028794 | Bacteria | 125330 |
| 147 | Ga0307515_10065516 | 3300028794 | Bacteria | 5053 |
| 148 | Ga0265338_10028990 | 3300028800 | Bacteria | 5503 |
| 149 | Ga0265324_10017982 | 3300029957 | Bacteria | 2566 |
| 150 | Ga0307511_10000046 | 3300030521 | Bacteria | 100284 |
| 151 | Ga0316177_1120096 | 3300030731 | Bacteria | 6208 |
| 152 | Ga0316183_1007327 | 3300030742 | Bacteria | 68568 |
| 153 | Ga0316181_1260720 | 3300030744 | Bacteria | 8588 |
| 154 | Ga0265332_10047907 | 3300031238 | Bacteria | 1839 |
| 155 | Ga0265327_10000006 | 3300031251 | Bacteria | 693716 |
| 156 | Ga0265327_10000024 | 3300031251 | Bacteria | 382499 |
| 157 | Ga0307513_10023549 | 3300031456 | Bacteria | 7191 |
| 158 | Ga0307408_100000340 | 3300031548 | Bacteria | 44104 |
| 159 | Ga0307408_100002675 | 3300031548 | Bacteria | 12361 |
| 160 | Ga0307408_100006072 | 3300031548 | Bacteria | 8035 |
| 161 | Ga0307405_10000707 | 3300031731 | Bacteria | 12941 |
| 162 | Ga0307405_10008317 | 3300031731 | Bacteria | 5249 |
| 163 | Ga0307405_10107179 | 3300031731 | Bacteria | 1886 |
| 164 | Ga0307413_10000026 | 3300031824 | Bacteria | 39845 |
| 165 | Ga0307413_10017657 | 3300031824 | Bacteria | 3722 |
| 166 | Ga0307410_10000072 | 3300031852 | Bacteria | 35421 |
| 167 | Ga0307406_10000041 | 3300031901 | Bacteria | 74278 |
| 168 | Ga0307412_10000067 | 3300031911 | Bacteria | 115549 |
| 169 | Ga0307412_10123288 | 3300031911 | Bacteria | 1870 |
| 170 | Ga0307412_10334118 | 3300031911 | Bacteria | 1210 |
| 171 | Ga0307416_100004525 | 3300032002 | Bacteria | 8394 |
| 172 | Ga0307416_100095260 | 3300032002 | Bacteria | 2570 |
| 173 | Ga0307414_10000001 | 3300032004 | Bacteria | 1352954 |
| 174 | Ga0307414_10000141 | 3300032004 | Bacteria | 49583 |
| 175 | Ga0307414_10008314 | 3300032004 | Bacteria | 5878 |
| 176 | Ga0307414_10029090 | 3300032004 | Bacteria | 3592 |
| 177 | Ga0307414_10056025 | 3300032004 | Unclassified | 2763 |
| 178 | Ga0307414_10078817 | 3300032004 | Bacteria | 2402 |
| 179 | Ga0307414_10130442 | 3300032004 | Bacteria | 1950 |
| 180 | Ga0307414_10286221 | 3300032004 | Bacteria | 1387 |
| 181 | Ga0307414_10423299 | 3300032004 | Bacteria | 1162 |
| 182 | Ga0307411_10000005 | 3300032005 | Bacteria | 391311 |
| 183 | Ga0307411_10063307 | 3300032005 | Bacteria | 2471 |
| 184 | Ga0307411_10081288 | 3300032005 | Bacteria | 2231 |
| 185 | Ga0307507_10000217 | 3300033179 | Bacteria | 109884 |
| 186 | Ga0307507_10281296 | 3300033179 | Unclassified | 1040 |
| 187 | Ga0395900_0654681 | 3300037418 | Bacteria | 987 |
| 188 | Ga0436365_0806230 | 3300039437 | Bacteria | 1472 |
| 189 | Ga0439436_0057091 | 3300041404 | Bacteria | 1095 |
| 190 | Ga0439447_012730 | 3300041407 | Bacteria | 2407 |
| 191 | Ga0439466_0006443 | 3300041411 | Bacteria | 4463 |
| 192 | Ga0439433_0025171 | 3300041999 | Bacteria | 1343 |
| 193 | Ga0439445_0057622 | 3300042004 | Bacteria | 1058 |
| 194 | Ga0439449_0057261 | 3300042007 | Bacteria | 1439 |
| 195 | Ga0450898_031224 | 3300042134 | Bacteria | 979 |
| 196 | Ga0450898_036795 | 3300042134 | Bacteria | 915 |
| 197 | Ga0451577_0279966 | 3300042876 | Bacteria | 1511 |
| 198 | Ga0466969_0000745 | 3300044656 | Bacteria | 17612 |
| 199 | Ga0466972_0000035 | 3300044658 | Bacteria | 147516 |
| 200 | Ga0466972_0000108 | 3300044658 | Bacteria | 71610 |
| 201 | Ga0466972_0018596 | 3300044658 | Bacteria | 3476 |
| 202 | Ga0466982_0010864 | 3300044672 | Bacteria | 4754 |
| 203 | Ga0466965_0114398 | 3300044683 | Bacteria | 1389 |
| 204 | Ga0466966_0000186 | 3300044684 | Bacteria | 41305 |
| 205 | Ga0466961_0063158 | 3300044693 | Bacteria | 2353 |
| 206 | Ga0466964_0008517 | 3300044706 | Bacteria | 3856 |
| 207 | Ga0466970_0013485 | 3300044765 | Bacteria | 4190 |
| 208 | Ga0466970_0062455 | 3300044765 | Bacteria | 1997 |
| 209 | Ga0466960_0076580 | 3300044901 | Bacteria | 1676 |
| 210 | Ga0466959_0000025 | 3300045049 | Bacteria | 120128 |
| 211 | Ga0466959_0004768 | 3300045049 | Bacteria | 9142 |
| 212 | Ga0466958_0141455 | 3300045836 | Bacteria | 1515 |
| 213 | Ga0495638_0033523 | 3300046460 | Bacteria | 3285 |
| 214 | Ga0495585_0010518 | 3300046492 | Bacteria | 5503 |
| 215 | Ga0495606_0048560 | 3300046507 | Bacteria | 2790 |
| 216 | Ga0495606_0106261 | 3300046507 | Bacteria | 1700 |
| 217 | Ga0495606_0133822 | 3300046507 | Bacteria | 1471 |
| 218 | Ga0495616_0001308 | 3300046513 | Bacteria | 17412 |
| 219 | Ga0495648_0001413 | 3300046524 | Bacteria | 23465 |
| 220 | Ga0495652_0292120 | 3300046529 | Bacteria | 1189 |
| 221 | Ga0495609_0031496 | 3300046538 | Bacteria | 2410 |
| 222 | Ga0495622_0024277 | 3300046557 | Bacteria | 2831 |
| 223 | Ga0495633_0000029 | 3300046558 | Bacteria | 200381 |
| 224 | Ga0495633_0002039 | 3300046558 | Bacteria | 14573 |
| 225 | Ga0495668_0000012 | 3300046616 | Bacteria | 458817 |
| 226 | Ga0495668_0000268 | 3300046616 | Bacteria | 73486 |
| 227 | Ga0495625_0000817 | 3300046660 | Bacteria | 42929 |
| 228 | Ga0495625_0003937 | 3300046660 | Bacteria | 14273 |
| 229 | Ga0495625_0023123 | 3300046660 | Bacteria | 4751 |
| 230 | Ga0495625_0046940 | 3300046660 | Bacteria | 3115 |
| 231 | Ga0495625_0062622 | 3300046660 | Bacteria | 2629 |
| 232 | Ga0495649_0180635 | 3300046694 | Bacteria | 1101 |
| 233 | Ga0495686_0000443 | 3300047472 | Bacteria | 62754 |
| 234 | Ga0496115_0013641 | 3300048918 | Bacteria | 6149 |
| 235 | Ga0496116_0000041 | 3300048919 | Bacteria | 343299 |
| 236 | Ga0496118_0087346 | 3300048921 | Bacteria | 2163 |
| 237 | Ga0496120_0192238 | 3300048923 | Bacteria | 994 |
| 238 | Ga0496121_0000028 | 3300048924 | Bacteria | 439193 |
| 239 | Ga0496124_0008556 | 3300048927 | Bacteria | 10681 |
| 240 | Ga0496125_0000026 | 3300048928 | Bacteria | 397380 |
| 241 | Ga0496126_0009414 | 3300048929 | Bacteria | 10372 |
| 242 | Ga0496126_0016794 | 3300048929 | Bacteria | 7307 |
| 243 | Ga0495678_047530 | 3300049459 | Bacteria | 1679 |
| 244 | Ga0501070_0116637 | 3300049586 | Bacteria | 2205 |
| 245 | Ga0501070_0499229 | 3300049586 | Bacteria | 978 |
| 246 | Ga0501238_018059 | 3300049671 | Bacteria | 985 |
| 247 | Ga0501249_000033 | 3300049679 | Bacteria | 73096 |
| 248 | Ga0501249_004865 | 3300049679 | Bacteria | 2737 |
| 249 | Ga0501249_005801 | 3300049679 | Bacteria | 2524 |
| 250 | Ga0501241_000647 | 3300049758 | Bacteria | 7478 |
| 251 | Ga0501241_007231 | 3300049758 | Bacteria | 2034 |
| 252 | Ga0501266_000007 | 3300049763 | Bacteria | 291751 |
| 253 | Ga0501269_015207 | 3300049766 | Bacteria | 946 |
| 254 | Ga0501280_002038 | 3300049776 | Bacteria | 3503 |
| 255 | Ga0501280_002700 | 3300049776 | Bacteria | 2883 |
| 256 | Ga0501035_0068849 | 3300049822 | Bacteria | 3138 |
| 257 | Ga0501035_0245667 | 3300049822 | Bacteria | 1521 |
| 258 | Ga0501044_0006481 | 3300049823 | Bacteria | 12930 |
| 259 | nmdc:mga0k408_171_c1 | 3300050493 | Bacteria | 34186 |
| 260 | nmdc:mga05p37_3328_c1 | 3300050507 | Bacteria | 12935 |
| 261 | nmdc:mga08y16_23048_c1 | 3300050511 | Bacteria | 6573 |
| 262 | nmdc:mga0rr50_187543_c1 | 3300050513 | Bacteria | 1693 |
| 263 | Ga0500578_0012042 | 3300053086 | Bacteria | 5586 |
| 264 | Ga0500644_0000081 | 3300053088 | Bacteria | 58662 |
| 265 | Ga0500646_0031140 | 3300053090 | Bacteria | 1467 |
| 266 | Ga0500646_0079924 | 3300053090 | Bacteria | 996 |
| 267 | Ga0500583_0023090 | 3300053092 | Bacteria | 2617 |
| 268 | Ga0500583_0026904 | 3300053092 | Bacteria | 2477 |
| 269 | Ga0500651_0000484 | 3300053093 | Bacteria | 20745 |
| 270 | Ga0500651_0055396 | 3300053093 | Bacteria | 2484 |
| 271 | Ga0500641_0000006 | 3300053096 | Bacteria | 223991 |
| 272 | Ga0500556_0126440 | 3300053104 | Bacteria | 1000 |
| 273 | Ga0500607_076168 | 3300053121 | Bacteria | 1721 |
| 274 | Ga0500608_015488 | 3300053122 | Bacteria | 3427 |
| 275 | Ga0500614_014682 | 3300053123 | Bacteria | 1738 |
| 276 | Ga0500618_000037 | 3300053125 | Bacteria | 117320 |
| 277 | Ga0500652_005836 | 3300053131 | Bacteria | 3914 |
| 278 | Ga0500658_0000008 | 3300053134 | Bacteria | 273324 |
| 279 | Ga0500559_0039553 | 3300053136 | Bacteria | 2052 |
| 280 | Ga0500559_0151799 | 3300053136 | Bacteria | 1087 |
| 281 | Ga0500559_0170137 | 3300053136 | Bacteria | 1025 |
| 282 | Ga0500559_0197899 | 3300053136 | Bacteria | 947 |
| 283 | Ga0500564_172027 | 3300053138 | Bacteria | 909 |
| 284 | Ga0500573_0140910 | 3300053140 | Bacteria | 1328 |
| 285 | Ga0500577_0005295 | 3300053142 | Bacteria | 3466 |
| 286 | Ga0500616_0014422 | 3300053153 | Bacteria | 4540 |
| 287 | Ga0500622_0001604 | 3300053156 | Bacteria | 17772 |
| 288 | Ga0500622_0001788 | 3300053156 | Bacteria | 16416 |
| 289 | Ga0500622_0001873 | 3300053156 | Bacteria | 15887 |
| 290 | Ga0500622_0005657 | 3300053156 | Bacteria | 7441 |
| 291 | Ga0500624_003679 | 3300053157 | Bacteria | 2010 |
| 292 | Ga0500633_0007578 | 3300053160 | Bacteria | 2743 |
| 293 | Ga0500634_0036261 | 3300053161 | Bacteria | 2685 |
| 294 | Ga0500634_0037918 | 3300053161 | Bacteria | 2621 |
| 295 | Ga0500636_0023305 | 3300053177 | Bacteria | 3661 |
| 296 | Ga0500645_027635 | 3300053730 | Bacteria | 1720 |
| 297 | Ga0466962_0033400 | 3300061719 | Bacteria | 2461 |
| 298 | Ga0466962_0197336 | 3300061719 | Bacteria | 983 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005289 | Ga0065704_10096190 | Ga0065704_100961901 | 241 |
| 2 | 3300010375 | Ga0105239_10188342 | Ga0105239_101883421 | 242 |
| 3 | 3300005288 | Ga0065714_10099602 | Ga0065714_100996022 | 243 |
| 4 | 3300031824 | Ga0307413_10000026 | Ga0307413_100000265 | 243 |
| 5 | 3300032005 | Ga0307411_10000005 | Ga0307411_10000005115 | 243 |
| 6 | 3300053134 | Ga0500658_0000008 | Ga0500658_0000008_5146_5925 | 243 |
| 7 | 3300032004 | Ga0307414_10078817 | Ga0307414_100788172 | 244 |
| 8 | iso_pu_bacteria | 2643221600 | 2644011655 | 244 |
| 9 | 3300046660 | Ga0495625_0062622 | Ga0495625_0062622_1859_2596 | 245 |
| 10 | 3300053136 | Ga0500559_0197899 | Ga0500559_0197899_11_790 | 245 |
| 11 | 3300032004 | Ga0307414_10286221 | Ga0307414_102862212 | 246 |
| 12 | 3300049586 | Ga0501070_0499229 | Ga0501070_0499229_22_762 | 246 |
| 13 | 3300049679 | Ga0501249_005801 | Ga0501249_005801_635_1414 | 246 |
| 14 | 3300049763 | Ga0501266_000007 | Ga0501266_000007_112866_113645 | 246 |
| 15 | 3300053136 | Ga0500559_0170137 | Ga0500559_0170137_274_1014 | 246 |
| 16 | 3300053157 | Ga0500624_003679 | Ga0500624_003679_1241_1981 | 246 |
| 17 | 3300013102 | Ga0157371_10000079 | Ga0157371_1000007935 | 248 |
| 18 | 3300013104 | Ga0157370_10000060 | Ga0157370_1000006086 | 248 |
| 19 | 3300015261 | Ga0182006_1003023 | Ga0182006_10030235 | 248 |
| 20 | 3300028800 | Ga0265338_10028990 | Ga0265338_100289902 | 249 |
| 21 | 3300039437 | Ga0436365_0806230 | Ga0436365_0806230_83_835 | 249 |
| 22 | 3300046557 | Ga0495622_0024277 | Ga0495622_0024277_1005_1754 | 249 |
| 23 | 3300049766 | Ga0501269_015207 | Ga0501269_015207_101_883 | 249 |
| 24 | 3300049823 | Ga0501044_0006481 | Ga0501044_0006481_18_767 | 249 |
| 25 | 3300053140 | Ga0500573_0140910 | Ga0500573_0140910_438_1220 | 249 |
| 26 | 3300031548 | Ga0307408_100000340 | Ga0307408_1000003407 | 251 |
| 27 | 3300031731 | Ga0307405_10000707 | Ga0307405_100007079 | 251 |
| 28 | 3300042876 | Ga0451577_0279966 | Ga0451577_0279966_145_909 | 253 |
| 29 | 3300046660 | Ga0495625_0023123 | Ga0495625_0023123_3964_4725 | 253 |
| 30 | iso_pu_bacteria | 2519899754 | 2520878579 | 255 |
| 31 | iso_pu_bacteria | 2739367857 | 2740000611 | 255 |
| 32 | iso_pu_bacteria | 2739367858 | 2740005427 | 255 |
| 33 | iso_pu_bacteria | 2816332280 | 2817415612 | 255 |
| 34 | iso_pu_bacteria | 2857618242 | 2857619258 | 255 |
| 35 | iso_pu_bacteria | 2903895155 | 2903898422 | 255 |
| 36 | iso_pu_bacteria | 2958458903 | 2958463461 | 255 |
| 37 | iso_pu_bacteria | 2965320100 | 2965320486 | 255 |
| 38 | iso_pu_bacteria | 8055419101 | 8055421301 | 255 |
| 39 | iso_pu_bacteria | 2643221667 | 2644370038 | 256 |
| 40 | iso_pu_bacteria | 2643221716 | 2644642114 | 256 |
| 41 | iso_pu_bacteria | 2643221725 | 2644685456 | 256 |
| 42 | iso_pu_bacteria | 2738541279 | 2738736439 | 256 |
| 43 | iso_pu_bacteria | 2738541285 | 2738768882 | 256 |
| 44 | iso_pu_bacteria | 2738543007 | 2739218021 | 256 |
| 45 | iso_pu_bacteria | 2802428842 | 2802653512 | 256 |
| 46 | iso_pu_bacteria | 2857613821 | 2857614383 | 256 |
| 47 | iso_pu_bacteria | 2881359912 | 2881362442 | 256 |
| 48 | iso_pu_bacteria | 2904419702 | 2904423219 | 256 |
| 49 | iso_pu_bacteria | 2904555929 | 2904556454 | 256 |
| 50 | iso_pu_bacteria | 2919191525 | 2919193160 | 256 |
| 51 | iso_pu_bacteria | 2929150217 | 2929152880 | 256 |
| 52 | iso_pu_bacteria | 2977268062 | 2977269546 | 256 |
| 53 | iso_pu_bacteria | 8054307821 | 8054308627 | 256 |
| 54 | iso_pu_bacteria | 2522125168 | 2522551826 | 257 |
| 55 | iso_pu_bacteria | 2890804823 | 2890807217 | 257 |
| 56 | 3300013102 | Ga0157371_10076593 | Ga0157371_100765932 | 258 |
| 57 | 3300032005 | Ga0307411_10063307 | Ga0307411_100633072 | 258 |
| 58 | 3300006942 | Ga0099824_1007266 | Ga0099824_10072662 | 259 |
| 59 | 3300006948 | Ga0099826_10030207 | Ga0099826_100302073 | 259 |
| 60 | 3300014326 | Ga0157380_10008496 | Ga0157380_100084964 | 259 |
| 61 | 3300014326 | Ga0157380_10044606 | Ga0157380_100446063 | 259 |
| 62 | 3300015261 | Ga0182006_1028214 | Ga0182006_10282141 | 259 |
| 63 | 3300015261 | Ga0182006_1029315 | Ga0182006_10293151 | 259 |
| 64 | 3300025942 | Ga0207689_10381524 | Ga0207689_103815242 | 259 |
| 65 | 3300027361 | Ga0209489_120518 | Ga0209489_1205181 | 259 |
| 66 | 3300031911 | Ga0307412_10123288 | Ga0307412_101232882 | 259 |
| 67 | 3300032002 | Ga0307416_100004525 | Ga0307416_1000045254 | 259 |
| 68 | 3300041407 | Ga0439447_012730 | Ga0439447_012730_72_851 | 259 |
| 69 | 3300048921 | Ga0496118_0087346 | Ga0496118_0087346_1216_1995 | 259 |
| 70 | 3300049679 | Ga0501249_004865 | Ga0501249_004865_444_1223 | 259 |
| 71 | iso_pu_bacteria | 2739367656 | 2739617990 | 259 |
| 72 | iso_pu_bacteria | 2842903701 | 2842905559 | 259 |
| 73 | 3300005293 | Ga0065715_10153147 | Ga0065715_101531472 | 260 |
| 74 | 3300009036 | Ga0105244_10000003 | Ga0105244_1000000334 | 260 |
| 75 | 3300009094 | Ga0111539_10110864 | Ga0111539_101108643 | 260 |
| 76 | 3300013102 | Ga0157371_10022026 | Ga0157371_100220261 | 260 |
| 77 | 3300013104 | Ga0157370_10003737 | Ga0157370_1000373712 | 260 |
| 78 | 3300013104 | Ga0157370_10316085 | Ga0157370_103160852 | 260 |
| 79 | 3300013105 | Ga0157369_10000766 | Ga0157369_1000076637 | 260 |
| 80 | 3300013307 | Ga0157372_10325881 | Ga0157372_103258812 | 260 |
| 81 | 3300013308 | Ga0157375_10085227 | Ga0157375_100852274 | 260 |
| 82 | 3300015261 | Ga0182006_1064257 | Ga0182006_10642572 | 260 |
| 83 | 3300017792 | Ga0163161_10000131 | Ga0163161_100001315 | 260 |
| 84 | 3300025728 | Ga0207655_1000010 | Ga0207655_1000010515 | 260 |
| 85 | 3300027907 | Ga0207428_10202225 | Ga0207428_102022251 | 260 |
| 86 | 3300031548 | Ga0307408_100006072 | Ga0307408_1000060723 | 260 |
| 87 | 3300031731 | Ga0307405_10008317 | Ga0307405_100083173 | 260 |
| 88 | 3300031852 | Ga0307410_10000072 | Ga0307410_100000724 | 260 |
| 89 | 3300031901 | Ga0307406_10000041 | Ga0307406_1000004124 | 260 |
| 90 | 3300031911 | Ga0307412_10334118 | Ga0307412_103341182 | 260 |
| 91 | 3300032004 | Ga0307414_10000001 | Ga0307414_10000001520 | 260 |
| 92 | 3300032004 | Ga0307414_10130442 | Ga0307414_101304422 | 260 |
| 93 | 3300032005 | Ga0307411_10081288 | Ga0307411_100812882 | 260 |
| 94 | 3300041411 | Ga0439466_0006443 | Ga0439466_0006443_2632_3414 | 260 |
| 95 | 3300048919 | Ga0496116_0000041 | Ga0496116_0000041_137264_138046 | 260 |
| 96 | 3300048927 | Ga0496124_0008556 | Ga0496124_0008556_7135_7917 | 260 |
| 97 | 3300048928 | Ga0496125_0000026 | Ga0496125_0000026_294357_295139 | 260 |
| 98 | 3300048929 | Ga0496126_0016794 | Ga0496126_0016794_1875_2657 | 260 |
| 99 | 3300049671 | Ga0501238_018059 | Ga0501238_018059_121_903 | 260 |
| 100 | 3300049679 | Ga0501249_000033 | Ga0501249_000033_58882_59664 | 260 |
| 101 | 3300049776 | Ga0501280_002038 | Ga0501280_002038_1658_2440 | 260 |
| 102 | 3300050511 | nmdc:mga08y16_23048_c1 | nmdc:mga08y16_23048_c1_981_1763 | 260 |
| 103 | 3300053090 | Ga0500646_0031140 | Ga0500646_0031140_611_1393 | 260 |
| 104 | 3300053096 | Ga0500641_0000006 | Ga0500641_0000006_80154_80936 | 260 |
| 105 | iso_pu_bacteria | 2818991442 | 2819572727 | 260 |
| 106 | iso_pu_bacteria | 2821136567 | 2821139868 | 260 |
| 107 | iso_pu_bacteria | 2904467357 | 2904473820 | 260 |
| 108 | 3300005262 | Ga0065165_1000130 | Ga0065165_100013013 | 261 |
| 109 | 3300009545 | Ga0105237_10019971 | Ga0105237_100199715 | 261 |
| 110 | 3300013100 | Ga0157373_10491833 | Ga0157373_104918331 | 261 |
| 111 | 3300025292 | Ga0209676_1001696 | Ga0209676_10016962 | 261 |
| 112 | 3300031251 | Ga0265327_10000006 | Ga0265327_1000000643 | 261 |
| 113 | 3300045836 | Ga0466958_0141455 | Ga0466958_0141455_710_1495 | 261 |
| 114 | 3300061719 | Ga0466962_0033400 | Ga0466962_0033400_1121_1906 | 261 |
| 115 | iso_pu_bacteria | 2721755487 | 2722726677 | 261 |
| 116 | iso_pu_bacteria | 2738541278 | 2738730294 | 261 |
| 117 | iso_pu_bacteria | 2738541284 | 2738761071 | 261 |
| 118 | iso_pu_bacteria | 2739367866 | 2740032981 | 261 |
| 119 | iso_pu_bacteria | 2896109856 | 2896115435 | 261 |
| 120 | iso_pu_bacteria | 2896317667 | 2896318823 | 261 |
| 121 | iso_pu_bacteria | 2898713307 | 2898715944 | 261 |
| 122 | iso_pu_bacteria | 2919437846 | 2919438361 | 261 |
| 123 | iso_pu_bacteria | 2929154850 | 2929155623 | 261 |
| 124 | iso_pu_bacteria | 2977232053 | 2977233706 | 261 |
| 125 | 3300005983 | Ga0081540_1022056 | Ga0081540_10220563 | 262 |
| 126 | 3300031824 | Ga0307413_10017657 | Ga0307413_100176575 | 262 |
| 127 | 3300032004 | Ga0307414_10029090 | Ga0307414_100290903 | 262 |
| 128 | 3300046460 | Ga0495638_0033523 | Ga0495638_0033523_2193_2981 | 262 |
| 129 | 3300046524 | Ga0495648_0001413 | Ga0495648_0001413_10901_11689 | 262 |
| 130 | 3300053090 | Ga0500646_0079924 | Ga0500646_0079924_46_834 | 262 |
| 131 | 3300053092 | Ga0500583_0023090 | Ga0500583_0023090_1196_1984 | 262 |
| 132 | 3300053136 | Ga0500559_0039553 | Ga0500559_0039553_1153_1941 | 262 |
| 133 | 3300053156 | Ga0500622_0005657 | Ga0500622_0005657_1744_2532 | 262 |
| 134 | iso_pu_bacteria | 2818991460 | 2819681275 | 262 |
| 135 | iso_pu_bacteria | 2929177148 | 2929179269 | 262 |
| 136 | iso_pu_bacteria | 2945977869 | 2945981673 | 262 |
| 137 | iso_pu_bacteria | 2946013367 | 2946018924 | 262 |
| 138 | 3300009093 | Ga0105240_10922626 | Ga0105240_109226261 | 263 |
| 139 | 3300009553 | Ga0105249_10494711 | Ga0105249_104947112 | 263 |
| 140 | 3300013104 | Ga0157370_10129819 | Ga0157370_101298191 | 263 |
| 141 | 3300013306 | Ga0163162_10056004 | Ga0163162_100560043 | 263 |
| 142 | 3300013308 | Ga0157375_10013896 | Ga0157375_100138962 | 263 |
| 143 | 3300014325 | Ga0163163_10321737 | Ga0163163_103217372 | 263 |
| 144 | 3300014969 | Ga0157376_10068838 | Ga0157376_100688382 | 263 |
| 145 | 3300017792 | Ga0163161_10000224 | Ga0163161_1000022418 | 263 |
| 146 | 3300025893 | Ga0207682_10013033 | Ga0207682_100130335 | 263 |
| 147 | 3300025921 | Ga0207652_10009213 | Ga0207652_100092135 | 263 |
| 148 | 3300025926 | Ga0207659_10134631 | Ga0207659_101346312 | 263 |
| 149 | 3300030731 | Ga0316177_1120096 | Ga0316177_11200966 | 263 |
| 150 | 3300030742 | Ga0316183_1007327 | Ga0316183_100732755 | 263 |
| 151 | 3300030744 | Ga0316181_1260720 | Ga0316181_12607207 | 263 |
| 152 | 3300033179 | Ga0307507_10281296 | Ga0307507_102812962 | 263 |
| 153 | 3300044672 | Ga0466982_0010864 | Ga0466982_0010864_2482_3273 | 263 |
| 154 | 3300053156 | Ga0500622_0001604 | Ga0500622_0001604_9531_10322 | 263 |
| 155 | iso_pu_bacteria | 2884791551 | 2884792242 | 263 |
| 156 | 3300002737 | JGI25162J39368_1001217 | JGI25162J39368_10012172 | 264 |
| 157 | 3300003214 | JGI25165J46597_1001194 | JGI25165J46597_100119415 | 264 |
| 158 | 3300003316 | rootH1_10118026 | rootH1_101180263 | 264 |
| 159 | 3300003322 | rootL2_10081941 | rootL2_100819412 | 264 |
| 160 | 3300003323 | rootH1_10008848 | rootH1_100088487 | 264 |
| 161 | 3300003323 | rootH1_10039624 | rootH1_100396247 | 264 |
| 162 | 3300005539 | Ga0068853_100140462 | Ga0068853_1001404621 | 264 |
| 163 | 3300005841 | Ga0068863_100491081 | Ga0068863_1004910811 | 264 |
| 164 | 3300006195 | Ga0075366_10000123 | Ga0075366_1000012313 | 264 |
| 165 | 3300009545 | Ga0105237_10005011 | Ga0105237_100050116 | 264 |
| 166 | 3300015265 | Ga0182005_1000179 | Ga0182005_100017928 | 264 |
| 167 | 3300025208 | Ga0209436_107532 | Ga0209436_1075322 | 264 |
| 168 | 3300025231 | Ga0207427_100137 | Ga0207427_10013731 | 264 |
| 169 | 3300025233 | Ga0209437_100112 | Ga0209437_10011289 | 264 |
| 170 | 3300025261 | Ga0209233_1000126 | Ga0209233_100012692 | 264 |
| 171 | 3300025298 | Ga0209050_1002589 | Ga0209050_10025895 | 264 |
| 172 | 3300025914 | Ga0207671_10020551 | Ga0207671_100205513 | 264 |
| 173 | 3300026088 | Ga0207641_10449438 | Ga0207641_104494381 | 264 |
| 174 | 3300028794 | Ga0307515_10000235 | Ga0307515_1000023524 | 264 |
| 175 | 3300028794 | Ga0307515_10000280 | Ga0307515_1000028015 | 264 |
| 176 | 3300028794 | Ga0307515_10065516 | Ga0307515_100655162 | 264 |
| 177 | 3300031456 | Ga0307513_10023549 | Ga0307513_100235494 | 264 |
| 178 | 3300031548 | Ga0307408_100002675 | Ga0307408_1000026753 | 264 |
| 179 | 3300031731 | Ga0307405_10107179 | Ga0307405_101071792 | 264 |
| 180 | 3300032002 | Ga0307416_100095260 | Ga0307416_1000952602 | 264 |
| 181 | 3300033179 | Ga0307507_10000217 | Ga0307507_1000021756 | 264 |
| 182 | 3300042004 | Ga0439445_0057622 | Ga0439445_0057622_189_983 | 264 |
| 183 | 3300042134 | Ga0450898_036795 | Ga0450898_036795_98_892 | 264 |
| 184 | 3300044658 | Ga0466972_0000108 | Ga0466972_0000108_28629_29423 | 264 |
| 185 | 3300044658 | Ga0466972_0018596 | Ga0466972_0018596_2560_3354 | 264 |
| 186 | 3300046492 | Ga0495585_0010518 | Ga0495585_0010518_356_1150 | 264 |
| 187 | 3300046507 | Ga0495606_0048560 | Ga0495606_0048560_929_1723 | 264 |
| 188 | 3300046529 | Ga0495652_0292120 | Ga0495652_0292120_332_1126 | 264 |
| 189 | 3300046538 | Ga0495609_0031496 | Ga0495609_0031496_132_926 | 264 |
| 190 | 3300046558 | Ga0495633_0000029 | Ga0495633_0000029_127890_128684 | 264 |
| 191 | 3300046558 | Ga0495633_0002039 | Ga0495633_0002039_11130_11924 | 264 |
| 192 | 3300046616 | Ga0495668_0000012 | Ga0495668_0000012_449620_450414 | 264 |
| 193 | 3300046660 | Ga0495625_0000817 | Ga0495625_0000817_8252_9046 | 264 |
| 194 | 3300046660 | Ga0495625_0003937 | Ga0495625_0003937_9007_9801 | 264 |
| 195 | 3300046660 | Ga0495625_0046940 | Ga0495625_0046940_582_1376 | 264 |
| 196 | 3300048924 | Ga0496121_0000028 | Ga0496121_0000028_32407_33246 | 264 |
| 197 | 3300049776 | Ga0501280_002700 | Ga0501280_002700_1926_2726 | 264 |
| 198 | 3300049822 | Ga0501035_0068849 | Ga0501035_0068849_2263_3057 | 264 |
| 199 | 3300050493 | nmdc:mga0k408_171_c1 | nmdc:mga0k408_171_c1_10886_11680 | 264 |
| 200 | 3300053086 | Ga0500578_0012042 | Ga0500578_0012042_2827_3621 | 264 |
| 201 | 3300053093 | Ga0500651_0055396 | Ga0500651_0055396_936_1730 | 264 |
| 202 | 3300053122 | Ga0500608_015488 | Ga0500608_015488_1433_2227 | 264 |
| 203 | 3300053123 | Ga0500614_014682 | Ga0500614_014682_569_1363 | 264 |
| 204 | 3300053125 | Ga0500618_000037 | Ga0500618_000037_115893_116795 | 264 |
| 205 | 3300053156 | Ga0500622_0001873 | Ga0500622_0001873_7015_7809 | 264 |
| 206 | 3300053177 | Ga0500636_0023305 | Ga0500636_0023305_1694_2488 | 264 |
| 207 | 3300053730 | Ga0500645_027635 | Ga0500645_027635_156_950 | 264 |
| 208 | 2162886012 | MBSR1b_contig_13626306 | MBSR1b_0849.00001940 | 265 |
| 209 | 3300001989 | JGI24739J22299_10000636 | JGI24739J22299_100006365 | 265 |
| 210 | 3300002737 | JGI25162J39368_1000130 | JGI25162J39368_100013039 | 265 |
| 211 | 3300003215 | JGI25153J46596_10008465 | JGI25153J46596_100084652 | 265 |
| 212 | 3300003320 | rootH2_10084384 | rootH2_100843843 | 265 |
| 213 | 3300003322 | rootL2_10045912 | rootL2_100459125 | 265 |
| 214 | 3300003323 | rootH1_10006330 | rootH1_1000633017 | 265 |
| 215 | 3300003323 | rootH1_10017729 | rootH1_100177292 | 265 |
| 216 | 3300003323 | rootH1_10041830 | rootH1_100418303 | 265 |
| 217 | 3300003354 | JGI25160J50197_1000764 | JGI25160J50197_10007647 | 265 |
| 218 | 3300003761 | Ga0055535_1002449 | Ga0055535_10024493 | 265 |
| 219 | 3300003762 | Ga0055542_1003495 | Ga0055542_10034951 | 265 |
| 220 | 3300003791 | Ga0055530_10001184 | Ga0055530_100011846 | 265 |
| 221 | 3300003794 | Ga0055531_10000263 | Ga0055531_1000026333 | 265 |
| 222 | 3300003794 | Ga0055531_10037998 | Ga0055531_100379982 | 265 |
| 223 | 3300004625 | Ga0055543_1006911 | Ga0055543_10069112 | 265 |
| 224 | 3300005262 | Ga0065165_1000172 | Ga0065165_10001728 | 265 |
| 225 | 3300005288 | Ga0065714_10007993 | Ga0065714_100079933 | 265 |
| 226 | 3300005288 | Ga0065714_10076123 | Ga0065714_100761232 | 265 |
| 227 | 3300005289 | Ga0065704_10075654 | Ga0065704_100756543 | 265 |
| 228 | 3300005336 | Ga0070680_100153696 | Ga0070680_1001536963 | 265 |
| 229 | 3300005339 | Ga0070660_100146980 | Ga0070660_1001469802 | 265 |
| 230 | 3300005356 | Ga0070674_100135401 | Ga0070674_1001354012 | 265 |
| 231 | 3300005364 | Ga0070673_100186515 | Ga0070673_1001865152 | 265 |
| 232 | 3300005459 | Ga0068867_100267419 | Ga0068867_1002674192 | 265 |
| 233 | 3300005539 | Ga0068853_100029888 | Ga0068853_1000298883 | 265 |
| 234 | 3300005543 | Ga0070672_100185176 | Ga0070672_1001851761 | 265 |
| 235 | 3300005563 | Ga0068855_100000054 | Ga0068855_10000005470 | 265 |
| 236 | 3300005563 | Ga0068855_100000856 | Ga0068855_10000085612 | 265 |
| 237 | 3300005563 | Ga0068855_100692908 | Ga0068855_1006929081 | 265 |
| 238 | 3300005577 | Ga0068857_100193014 | Ga0068857_1001930143 | 265 |
| 239 | 3300005577 | Ga0068857_100239019 | Ga0068857_1002390192 | 265 |
| 240 | 3300005617 | Ga0068859_100001409 | Ga0068859_10000140919 | 265 |
| 241 | 3300005834 | Ga0068851_10018829 | Ga0068851_100188292 | 265 |
| 242 | 3300005841 | Ga0068863_100132038 | Ga0068863_1001320383 | 265 |
| 243 | 3300006195 | Ga0075366_10033456 | Ga0075366_100334561 | 265 |
| 244 | 3300006195 | Ga0075366_10112270 | Ga0075366_101122702 | 265 |
| 245 | 3300006237 | Ga0097621_100275295 | Ga0097621_1002752952 | 265 |
| 246 | 3300006931 | Ga0097620_100001409 | Ga0097620_10000140919 | 265 |
| 247 | 3300009093 | Ga0105240_10538720 | Ga0105240_105387201 | 265 |
| 248 | 3300009147 | Ga0114129_10010785 | Ga0114129_1001078514 | 265 |
| 249 | 3300009545 | Ga0105237_10030489 | Ga0105237_100304891 | 265 |
| 250 | 3300009545 | Ga0105237_10251005 | Ga0105237_102510051 | 265 |
| 251 | 3300010375 | Ga0105239_10000690 | Ga0105239_1000069037 | 265 |
| 252 | 3300010375 | Ga0105239_10003864 | Ga0105239_100038645 | 265 |
| 253 | 3300010375 | Ga0105239_10029606 | Ga0105239_100296062 | 265 |
| 254 | 3300013100 | Ga0157373_10000188 | Ga0157373_1000018817 | 265 |
| 255 | 3300013100 | Ga0157373_10000560 | Ga0157373_1000056012 | 265 |
| 256 | 3300013100 | Ga0157373_10218522 | Ga0157373_102185222 | 265 |
| 257 | 3300013102 | Ga0157371_10001546 | Ga0157371_1000154611 | 265 |
| 258 | 3300013102 | Ga0157371_10032458 | Ga0157371_100324583 | 265 |
| 259 | 3300013104 | Ga0157370_10528546 | Ga0157370_105285461 | 265 |
| 260 | 3300013105 | Ga0157369_10081103 | Ga0157369_100811033 | 265 |
| 261 | 3300013307 | Ga0157372_10000458 | Ga0157372_1000045813 | 265 |
| 262 | 3300013307 | Ga0157372_10009152 | Ga0157372_100091529 | 265 |
| 263 | 3300013307 | Ga0157372_10097563 | Ga0157372_100975632 | 265 |
| 264 | 3300013307 | Ga0157372_10330433 | Ga0157372_103304332 | 265 |
| 265 | 3300013307 | Ga0157372_10636781 | Ga0157372_106367811 | 265 |
| 266 | 3300015261 | Ga0182006_1018310 | Ga0182006_10183102 | 265 |
| 267 | 3300015262 | Ga0182007_10004282 | Ga0182007_100042826 | 265 |
| 268 | 3300017792 | Ga0163161_10001043 | Ga0163161_100010437 | 265 |
| 269 | 3300017792 | Ga0163161_10070229 | Ga0163161_100702292 | 265 |
| 270 | 3300025233 | Ga0209437_100089 | Ga0209437_10008938 | 265 |
| 271 | 3300025242 | Ga0209258_100193 | Ga0209258_10019353 | 265 |
| 272 | 3300025254 | Ga0209148_1000167 | Ga0209148_100016763 | 265 |
| 273 | 3300025284 | Ga0209130_1010994 | Ga0209130_10109943 | 265 |
| 274 | 3300025297 | Ga0209758_1005024 | Ga0209758_10050246 | 265 |
| 275 | 3300025298 | Ga0209050_1000453 | Ga0209050_10004538 | 265 |
| 276 | 3300025302 | Ga0207426_1000034 | Ga0207426_100003442 | 265 |
| 277 | 3300025302 | Ga0207426_1002680 | Ga0207426_10026802 | 265 |
| 278 | 3300025304 | Ga0209257_1000025 | Ga0209257_1000025267 | 265 |
| 279 | 3300025304 | Ga0209257_1004280 | Ga0209257_10042802 | 265 |
| 280 | 3300025914 | Ga0207671_10002069 | Ga0207671_1000206912 | 265 |
| 281 | 3300025940 | Ga0207691_10098967 | Ga0207691_100989675 | 265 |
| 282 | 3300025949 | Ga0207667_10000023 | Ga0207667_10000023241 | 265 |
| 283 | 3300025949 | Ga0207667_10006360 | Ga0207667_1000636010 | 265 |
| 284 | 3300025960 | Ga0207651_10116940 | Ga0207651_101169403 | 265 |
| 285 | 3300025981 | Ga0207640_10277067 | Ga0207640_102770672 | 265 |
| 286 | 3300026041 | Ga0207639_10047981 | Ga0207639_100479814 | 265 |
| 287 | 3300026089 | Ga0207648_10124709 | Ga0207648_101247093 | 265 |
| 288 | 3300026116 | Ga0207674_10123763 | Ga0207674_101237633 | 265 |
| 289 | 3300026116 | Ga0207674_10235558 | Ga0207674_102355582 | 265 |
| 290 | 3300029957 | Ga0265324_10017982 | Ga0265324_100179821 | 265 |
| 291 | 3300030521 | Ga0307511_10000046 | Ga0307511_1000004667 | 265 |
| 292 | 3300031238 | Ga0265332_10047907 | Ga0265332_100479071 | 265 |
| 293 | 3300031251 | Ga0265327_10000024 | Ga0265327_10000024275 | 265 |
| 294 | 3300031911 | Ga0307412_10000067 | Ga0307412_1000006711 | 265 |
| 295 | 3300032004 | Ga0307414_10000141 | Ga0307414_1000014139 | 265 |
| 296 | 3300032004 | Ga0307414_10008314 | Ga0307414_100083148 | 265 |
| 297 | 3300032004 | Ga0307414_10056025 | Ga0307414_100560253 | 265 |
| 298 | 3300032004 | Ga0307414_10423299 | Ga0307414_104232991 | 265 |
| 299 | 3300037418 | Ga0395900_0654681 | Ga0395900_0654681_141_944 | 265 |
| 300 | 3300041404 | Ga0439436_0057091 | Ga0439436_0057091_92_892 | 265 |
| 301 | 3300041999 | Ga0439433_0025171 | Ga0439433_0025171_88_888 | 265 |
| 302 | 3300042007 | Ga0439449_0057261 | Ga0439449_0057261_132_929 | 265 |
| 303 | 3300042134 | Ga0450898_031224 | Ga0450898_031224_29_826 | 265 |
| 304 | 3300044656 | Ga0466969_0000745 | Ga0466969_0000745_8090_8887 | 265 |
| 305 | 3300044658 | Ga0466972_0000035 | Ga0466972_0000035_78366_79163 | 265 |
| 306 | 3300044683 | Ga0466965_0114398 | Ga0466965_0114398_47_859 | 265 |
| 307 | 3300044684 | Ga0466966_0000186 | Ga0466966_0000186_26695_27492 | 265 |
| 308 | 3300044693 | Ga0466961_0063158 | Ga0466961_0063158_414_1211 | 265 |
| 309 | 3300044706 | Ga0466964_0008517 | Ga0466964_0008517_2262_3059 | 265 |
| 310 | 3300044765 | Ga0466970_0013485 | Ga0466970_0013485_2673_3470 | 265 |
| 311 | 3300044765 | Ga0466970_0062455 | Ga0466970_0062455_909_1706 | 265 |
| 312 | 3300044901 | Ga0466960_0076580 | Ga0466960_0076580_864_1661 | 265 |
| 313 | 3300045049 | Ga0466959_0000025 | Ga0466959_0000025_77431_78228 | 265 |
| 314 | 3300045049 | Ga0466959_0004768 | Ga0466959_0004768_8056_8868 | 265 |
| 315 | 3300046507 | Ga0495606_0106261 | Ga0495606_0106261_234_1046 | 265 |
| 316 | 3300046507 | Ga0495606_0133822 | Ga0495606_0133822_116_913 | 265 |
| 317 | 3300046513 | Ga0495616_0001308 | Ga0495616_0001308_10393_11190 | 265 |
| 318 | 3300046616 | Ga0495668_0000268 | Ga0495668_0000268_67799_68596 | 265 |
| 319 | 3300046694 | Ga0495649_0180635 | Ga0495649_0180635_231_1028 | 265 |
| 320 | 3300047472 | Ga0495686_0000443 | Ga0495686_0000443_59981_60778 | 265 |
| 321 | 3300048918 | Ga0496115_0013641 | Ga0496115_0013641_1147_1944 | 265 |
| 322 | 3300048923 | Ga0496120_0192238 | Ga0496120_0192238_144_941 | 265 |
| 323 | 3300048929 | Ga0496126_0009414 | Ga0496126_0009414_5206_6003 | 265 |
| 324 | 3300049459 | Ga0495678_047530 | Ga0495678_047530_701_1498 | 265 |
| 325 | 3300049586 | Ga0501070_0116637 | Ga0501070_0116637_874_1671 | 265 |
| 326 | 3300049758 | Ga0501241_000647 | Ga0501241_000647_1217_2014 | 265 |
| 327 | 3300049758 | Ga0501241_007231 | Ga0501241_007231_425_1222 | 265 |
| 328 | 3300049822 | Ga0501035_0245667 | Ga0501035_0245667_306_1106 | 265 |
| 329 | 3300050507 | nmdc:mga05p37_3328_c1 | nmdc:mga05p37_3328_c1_10736_11533 | 265 |
| 330 | 3300050513 | nmdc:mga0rr50_187543_c1 | nmdc:mga0rr50_187543_c1_723_1520 | 265 |
| 331 | 3300053088 | Ga0500644_0000081 | Ga0500644_0000081_5306_6103 | 265 |
| 332 | 3300053092 | Ga0500583_0026904 | Ga0500583_0026904_819_1616 | 265 |
| 333 | 3300053093 | Ga0500651_0000484 | Ga0500651_0000484_16394_17191 | 265 |
| 334 | 3300053104 | Ga0500556_0126440 | Ga0500556_0126440_76_876 | 265 |
| 335 | 3300053121 | Ga0500607_076168 | Ga0500607_076168_95_892 | 265 |
| 336 | 3300053131 | Ga0500652_005836 | Ga0500652_005836_1749_2546 | 265 |
| 337 | 3300053136 | Ga0500559_0151799 | Ga0500559_0151799_235_1032 | 265 |
| 338 | 3300053138 | Ga0500564_172027 | Ga0500564_172027_17_814 | 265 |
| 339 | 3300053142 | Ga0500577_0005295 | Ga0500577_0005295_2658_3455 | 265 |
| 340 | 3300053153 | Ga0500616_0014422 | Ga0500616_0014422_1502_2299 | 265 |
| 341 | 3300053156 | Ga0500622_0001788 | Ga0500622_0001788_12581_13378 | 265 |
| 342 | 3300053160 | Ga0500633_0007578 | Ga0500633_0007578_61_858 | 265 |
| 343 | 3300053161 | Ga0500634_0036261 | Ga0500634_0036261_437_1234 | 265 |
| 344 | 3300053161 | Ga0500634_0037918 | Ga0500634_0037918_1404_2201 | 265 |
| 345 | 3300061719 | Ga0466962_0197336 | Ga0466962_0197336_174_971 | 265 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3akj-assembly1.cif.gz_A | crystal structure of a helicobacter pylori proinflammatory kinase ctka | 0.6161 | 27 | 259 |
| 3akk-assembly2.cif.gz_D | crystal structure of a helicobacter pylori proinflammatory kinase ctka | 0.596 | 8 | 265 |
| 3akl-assembly2.cif.gz_D | crystal structure of a helicobacter pylori proinflammatory kinase ctka | 0.5933 | 10 | 259 |
| 3akk-assembly1.cif.gz_A | crystal structure of a helicobacter pylori proinflammatory kinase ctka | 0.5909 | 9 | 264 |
| 3akl-assembly1.cif.gz_B | crystal structure of a helicobacter pylori proinflammatory kinase ctka | 0.5844 | 7 | 259 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P0C0K3_17_108_3.30.200.70 | Alpha Beta;2-Layer Sandwich;Phosphorylase Kinase; domain 1; | 0.7398 | 11 | 42 | 3.30.200.70 |
| af_Q2G2A7_273_342_2.40.50.140 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins | 0.7259 | 15 | 41 | 2.40.50.140 |
| 1zylA01 | Alpha Beta;2-Layer Sandwich;Phosphorylase Kinase; domain 1; | 0.6843 | 13 | 42 | 3.30.200.70 |
| 3oyyA03 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins | 0.6517 | 11 | 41 | 2.40.50.140 |
| af_K7M0I8_269_382_3.30.200.20 | Alpha Beta;2-Layer Sandwich;Phosphorylase Kinase; domain 1;Phosphorylase Kinase; domain 1 | 0.5508 | 15 | 105 | 3.30.200.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1I1JRJ8-F1-model_v4 | HipA-like kinase domain-containing protein | 0.992 | 7 | 265 |
|
| AF-A0A2P8E5Z8-F1-model_v4 | HipA-like kinase domain-containing protein | 0.9897 | 7 | 265 |
|
| AF-A0A1M6GFS8-F1-model_v4 | HipA-like kinase domain-containing protein | 0.9868 | 7 | 265 |
|
| AF-A0A4Q3T132-F1-model_v4 | Aminotransferase class I and II | 0.9861 | 7 | 101 |
GO:0008483
|
| AF-A0A7W0WFH2-F1-model_v4 | Aminotransferase class I and II | 0.9855 | 8 | 164 |
GO:0008483
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar