F416374

General Info

Members Datasets Scaffolds Average Seq Length
345 234 298 262

Family's Representative Sequence

Representative Sequence 3300013102|Ga0157371_10000079|Ga0157371_1000007935
Length 250
Sequence LDLPLRTVTVTRYILPLREGGSLPALAEADDDFKYVLKFRGAGHGVKALISELIGGKVSQVLGFRIPELVFANLSEDFGRSEADEEIQDLLKNSCGLNLALHYLSGAKLSSEIVWLDAFLTNIDRTFRNTNMLMWHQELWLIDNGASLYFHHNWDNWEKNAVSPFVMIKDHVLLPQASELDDVNSKFKAILTDEVLREIVELIPEDWLQWNDTDLNPTEIKEVYYQFLILRRDHSDNFLNEAKNARAKVI

Samples

Sample ID Description Type Environment
1 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
2 2519899754 Flavobacterium sp. F52 Isolate Rhizosphere
3 2522125168 Dyadobacter beijingensis DSM 21582 Isolate Rhizosphere
4 2643221600 Flavobacterium sp. Root186 Isolate Unclassified
5 2643221667 Flavobacterium sp. Root420 Isolate Unclassified
6 2643221716 Flavobacterium sp. Root901 Isolate Unclassified
7 2643221725 Flavobacterium sp. Root935 Isolate Unclassified
8 2721755487 Sphingobacterium sp. B29 Isolate Rhizosphere
9 2738541278 Niastella sp. CF465 Isolate Unclassified
10 2738541279 Flavobacterium sp. GV069 Isolate Unclassified
11 2738541284 Pedobacter sp. YR016 Isolate Unclassified
12 2738541285 Flavobacterium sp. GV030 Isolate Unclassified
13 2738543007 Flavobacterium sp. GV063 Isolate Unclassified
14 2739367656 Pedobacter sp. CF523 Isolate Unclassified
15 2739367857 Flavobacterium sp. GV029 Isolate Unclassified
16 2739367858 Flavobacterium sp. GV028 Isolate Unclassified
17 2739367866 Hymenobacter sp. YR204 Isolate Unclassified
18 2802428842 Flavobacterium sp. S87F.05.LMB.W.Kidney.N Isolate Unclassified
19 2816332280 Flavobacterium johnsoniae GSE09 Isolate Unclassified
20 2818991442 Chitinophaga pinensis 1204 Isolate Unclassified
21 2818991460 Chitinophaga polysaccharea 1209 Isolate Unclassified
22 2821136567 Chitinophaga sancti 1232 Isolate Unclassified
23 2842903701 Olivibacter sp. R-72191 Isolate Unclassified
24 2857613821 Flavobacterium sp. R-72247 Isolate Unclassified
25 2857618242 Flavobacterium sp. R-74482 Isolate Unclassified
26 2881359912 Flavobacterium ustbae T13 Isolate Rhizosphere
27 2884791551 Chitinophaga oryzae 1310 Isolate Unclassified
28 2890804823 Fluviicola sp. SGL-29 Isolate Rhizosphere
29 2896109856 Chitinophaga sp. SYP-B3965 Isolate Rhizosphere
30 2896317667 Sphingobacterium sp. SGR-19 Isolate Rhizosphere
31 2898713307 Sphingobacterium sp. SGG-5 Isolate Rhizosphere
32 2903895155 Flavobacterium sp. HBTb2-11-1 Isolate Rhizosphere
33 2904419702 Flavobacterium sp. 1355 Isolate Rhizosphere
34 2904467357 Chitinophaga sancti 3198 Isolate Unclassified
35 2904555929 Flavobacterium sp. 1750 Isolate Rhizosphere
36 2919191525 Flavobacterium sp. 2755 Isolate Rhizosphere
37 2919437846 Mucilaginibacter pocheonensis 3262 Isolate Rhizosphere
38 2929150217 Flavobacterium sp. R-74510 Hybrid assembly Isolate Unclassified
39 2929154850 Filimonas sp. R-72421 Hybrid assembly Isolate Unclassified
40 2929177148 Chitinophaga sp. R-72269 Hybrid assembly Isolate Unclassified
41 2945977869 Chitinophaga sp. W2I13 Isolate Rhizosphere
42 2946013367 Chitinophaga sp. W3I9 Isolate Rhizosphere
43 2958458903 Flavobacterium anhuiense RCM74 Isolate Rhizosphere
44 2965320100 Flavobacterium agri MAH-1 Isolate Rhizosphere
45 2977232053 Mucilaginibacter terrae SORGH_AS 422 Isolate Unclassified
46 2977268062 Flavobacterium sp. SORGH_AS 622 Isolate Unclassified
47 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
48 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
49 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
50 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
51 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
52 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
53 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
54 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
55 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
56 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
57 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
58 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
59 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
60 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
61 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
62 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
63 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
64 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
65 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
66 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
67 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
68 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
69 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
70 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
71 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
72 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
73 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
74 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
75 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
76 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
77 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
78 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
79 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
80 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
81 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
82 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
83 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
84 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
85 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
86 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
87 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
88 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
89 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
90 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
91 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
92 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
93 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
94 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
95 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
96 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
97 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
98 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
99 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
100 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
101 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
102 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
103 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
104 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
105 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
106 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
107 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
108 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
109 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
110 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
111 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
112 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
113 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
114 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
115 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
116 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
131 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
132 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
133 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
134 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
135 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
136 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
137 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
138 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
139 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
140 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
141 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
142 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
143 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
144 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
145 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
146 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
147 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
148 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
149 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
150 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
151 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
152 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
153 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
154 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
155 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
156 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
157 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
158 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
159 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
160 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
161 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
162 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
163 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
164 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
165 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
166 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
167 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
168 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
169 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
170 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
171 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
172 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
173 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
174 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
175 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
176 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
177 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
178 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
179 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
180 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
181 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
182 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
183 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
184 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
185 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
186 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
187 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
188 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
189 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
190 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
191 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
192 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
193 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
194 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
195 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
196 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
197 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
198 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
199 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
200 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
201 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
202 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
203 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
204 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
205 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
206 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
207 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
208 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
209 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
210 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
211 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
212 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
213 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
214 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
215 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
216 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
217 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
218 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
219 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
220 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
221 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
222 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
223 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
224 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
225 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
226 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
227 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
228 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
229 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
230 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
231 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
232 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
233 8054307821 Flavobacterium soyae SCIV07 Isolate Rhizosphere
234 8055419101 Flavobacterium tyrosinilyticum KCTC 42726 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 86.38
Metatranscriptomes 0
Isolates 13.62

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 19.42
Nodule 0.87
Rhizoplane 0.29
Rhizosphere 63.77
Stem 0
Stem Tuber 0
Unclassified 15.65

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MBSR1b_contig_13626306 2162886012 Bacteria 1000
2 JGI24739J22299_10000636 3300001989 Bacteria 12631
3 JGI25162J39368_1000130 3300002737 Bacteria 83005
4 JGI25162J39368_1001217 3300002737 Bacteria 14957
5 JGI25165J46597_1001194 3300003214 Bacteria 15755
6 JGI25153J46596_10008465 3300003215 Bacteria 4911
7 rootH1_10118026 3300003316 Bacteria 4874
8 rootH2_10084384 3300003320 Bacteria 6885
9 rootL2_10045912 3300003322 Bacteria 5820
10 rootL2_10081941 3300003322 Bacteria 3676
11 rootH1_10006330 3300003323 Bacteria 70891
12 rootH1_10008848 3300003323 Bacteria 6906
13 rootH1_10017729 3300003323 Bacteria 5543
14 rootH1_10039624 3300003323 Bacteria 15166
15 rootH1_10041830 3300003323 Bacteria 3707
16 JGI25160J50197_1000764 3300003354 Bacteria 17348
17 Ga0055535_1002449 3300003761 Bacteria 6480
18 Ga0055542_1003495 3300003762 Bacteria 4224
19 Ga0055530_10001184 3300003791 Bacteria 20151
20 Ga0055531_10000263 3300003794 Bacteria 55230
21 Ga0055531_10037998 3300003794 Bacteria 1453
22 Ga0055543_1006911 3300004625 Bacteria 2683
23 Ga0065165_1000130 3300005262 Bacteria 128998
24 Ga0065165_1000172 3300005262 Bacteria 114850
25 Ga0065714_10007993 3300005288 Bacteria 3449
26 Ga0065714_10076123 3300005288 Bacteria 2826
27 Ga0065714_10099602 3300005288 Bacteria 1683
28 Ga0065704_10075654 3300005289 Bacteria 5462
29 Ga0065704_10096190 3300005289 Bacteria 2453
30 Ga0065715_10153147 3300005293 Bacteria 1706
31 Ga0070680_100153696 3300005336 Bacteria 1932
32 Ga0070660_100146980 3300005339 Bacteria 1894
33 Ga0070674_100135401 3300005356 Bacteria 1842
34 Ga0070673_100186515 3300005364 Bacteria 1779
35 Ga0068867_100267419 3300005459 Bacteria 1396
36 Ga0068853_100029888 3300005539 Bacteria 4597
37 Ga0068853_100140462 3300005539 Bacteria 2168
38 Ga0070672_100185176 3300005543 Bacteria 1736
39 Ga0068855_100000054 3300005563 Bacteria 139322
40 Ga0068855_100000856 3300005563 Bacteria 37762
41 Ga0068855_100692908 3300005563 Bacteria 1091
42 Ga0068857_100193014 3300005577 Bacteria 1855
43 Ga0068857_100239019 3300005577 Bacteria 1662
44 Ga0068859_100001409 3300005617 Bacteria 24411
45 Ga0068851_10018829 3300005834 Bacteria 3331
46 Ga0068863_100132038 3300005841 Bacteria 2384
47 Ga0068863_100491081 3300005841 Bacteria 1208
48 Ga0081540_1022056 3300005983 Bacteria 3768
49 Ga0075366_10000123 3300006195 Bacteria 32043
50 Ga0075366_10033456 3300006195 Bacteria 3028
51 Ga0075366_10112270 3300006195 Bacteria 1640
52 Ga0097621_100275295 3300006237 Bacteria 1480
53 Ga0097620_100001409 3300006931 Bacteria 24411
54 Ga0099824_1007266 3300006942 Bacteria 14782
55 Ga0099826_10030207 3300006948 Bacteria 3940
56 Ga0105244_10000003 3300009036 Bacteria 494610
57 Ga0105240_10538720 3300009093 Bacteria 1293
58 Ga0105240_10922626 3300009093 Bacteria 938
59 Ga0111539_10110864 3300009094 Bacteria 3220
60 Ga0114129_10010785 3300009147 Bacteria 13022
61 Ga0105237_10005011 3300009545 Bacteria 15079
62 Ga0105237_10019971 3300009545 Bacteria 6917
63 Ga0105237_10030489 3300009545 Bacteria 5477
64 Ga0105237_10251005 3300009545 Bacteria 1771
65 Ga0105249_10494711 3300009553 Bacteria 1267
66 Ga0105239_10000690 3300010375 Bacteria 48107
67 Ga0105239_10003864 3300010375 Bacteria 18176
68 Ga0105239_10029606 3300010375 Bacteria 6020
69 Ga0105239_10188342 3300010375 Bacteria 2310
70 Ga0157373_10000188 3300013100 Bacteria 50875
71 Ga0157373_10000560 3300013100 Bacteria 29152
72 Ga0157373_10218522 3300013100 Bacteria 1344
73 Ga0157373_10491833 3300013100 Bacteria 886
74 Ga0157371_10000079 3300013102 Bacteria 152295
75 Ga0157371_10001546 3300013102 Bacteria 23668
76 Ga0157371_10022026 3300013102 Bacteria 4676
77 Ga0157371_10032458 3300013102 Bacteria 3757
78 Ga0157371_10076593 3300013102 Bacteria 2369
79 Ga0157370_10000060 3300013104 Bacteria 116178
80 Ga0157370_10003737 3300013104 Bacteria 17794
81 Ga0157370_10129819 3300013104 Bacteria 2351
82 Ga0157370_10316085 3300013104 Bacteria 1441
83 Ga0157370_10528546 3300013104 Bacteria 1082
84 Ga0157369_10000766 3300013105 Bacteria 41505
85 Ga0157369_10081103 3300013105 Bacteria 3473
86 Ga0163162_10056004 3300013306 Bacteria 3971
87 Ga0157372_10000458 3300013307 Bacteria 44772
88 Ga0157372_10009152 3300013307 Bacteria 10520
89 Ga0157372_10097563 3300013307 Unclassified 3352
90 Ga0157372_10325881 3300013307 Bacteria 1788
91 Ga0157372_10330433 3300013307 Bacteria 1775
92 Ga0157372_10636781 3300013307 Bacteria 1242
93 Ga0157375_10013896 3300013308 Bacteria 7178
94 Ga0157375_10085227 3300013308 Bacteria 3209
95 Ga0163163_10321737 3300014325 Bacteria 1600
96 Ga0157380_10008496 3300014326 Bacteria 7336
97 Ga0157380_10044606 3300014326 Bacteria 3476
98 Ga0157376_10068838 3300014969 Bacteria 2999
99 Ga0182006_1003023 3300015261 Bacteria 8852
100 Ga0182006_1018310 3300015261 Bacteria 2961
101 Ga0182006_1028214 3300015261 Bacteria 2284
102 Ga0182006_1029315 3300015261 Bacteria 2230
103 Ga0182006_1064257 3300015261 Bacteria 1376
104 Ga0182007_10004282 3300015262 Bacteria 6506
105 Ga0182005_1000179 3300015265 Bacteria 43636
106 Ga0163161_10000131 3300017792 Bacteria 70473
107 Ga0163161_10000224 3300017792 Bacteria 51786
108 Ga0163161_10001043 3300017792 Bacteria 21096
109 Ga0163161_10070229 3300017792 Bacteria 2561
110 Ga0209436_107532 3300025208 Bacteria 2261
111 Ga0207427_100137 3300025231 Bacteria 88182
112 Ga0209437_100089 3300025233 Bacteria 250476
113 Ga0209437_100112 3300025233 Bacteria 214292
114 Ga0209258_100193 3300025242 Bacteria 124682
115 Ga0209148_1000167 3300025254 Bacteria 135407
116 Ga0209233_1000126 3300025261 Bacteria 214298
117 Ga0209130_1010994 3300025284 Bacteria 2449
118 Ga0209676_1001696 3300025292 Bacteria 19052
119 Ga0209758_1005024 3300025297 Bacteria 10537
120 Ga0209050_1000453 3300025298 Bacteria 73731
121 Ga0209050_1002589 3300025298 Bacteria 14993
122 Ga0207426_1000034 3300025302 Bacteria 454016
123 Ga0207426_1002680 3300025302 Bacteria 10899
124 Ga0209257_1000025 3300025304 Bacteria 724838
125 Ga0209257_1004280 3300025304 Bacteria 11250
126 Ga0207655_1000010 3300025728 Bacteria 649325
127 Ga0207682_10013033 3300025893 Bacteria 3242
128 Ga0207671_10002069 3300025914 Bacteria 21951
129 Ga0207671_10020551 3300025914 Bacteria 5025
130 Ga0207652_10009213 3300025921 Bacteria 7942
131 Ga0207659_10134631 3300025926 Bacteria 1911
132 Ga0207691_10098967 3300025940 Bacteria 2605
133 Ga0207689_10381524 3300025942 Bacteria 1173
134 Ga0207667_10000023 3300025949 Bacteria 362527
135 Ga0207667_10006360 3300025949 Bacteria 14316
136 Ga0207651_10116940 3300025960 Bacteria 2014
137 Ga0207640_10277067 3300025981 Bacteria 1315
138 Ga0207639_10047981 3300026041 Bacteria 3230
139 Ga0207641_10449438 3300026088 Bacteria 1245
140 Ga0207648_10124709 3300026089 Bacteria 2265
141 Ga0207674_10123763 3300026116 Bacteria 2552
142 Ga0207674_10235558 3300026116 Bacteria 1778
143 Ga0209489_120518 3300027361 Bacteria 1879
144 Ga0207428_10202225 3300027907 Bacteria 1494
145 Ga0307515_10000235 3300028794 Bacteria 136714
146 Ga0307515_10000280 3300028794 Bacteria 125330
147 Ga0307515_10065516 3300028794 Bacteria 5053
148 Ga0265338_10028990 3300028800 Bacteria 5503
149 Ga0265324_10017982 3300029957 Bacteria 2566
150 Ga0307511_10000046 3300030521 Bacteria 100284
151 Ga0316177_1120096 3300030731 Bacteria 6208
152 Ga0316183_1007327 3300030742 Bacteria 68568
153 Ga0316181_1260720 3300030744 Bacteria 8588
154 Ga0265332_10047907 3300031238 Bacteria 1839
155 Ga0265327_10000006 3300031251 Bacteria 693716
156 Ga0265327_10000024 3300031251 Bacteria 382499
157 Ga0307513_10023549 3300031456 Bacteria 7191
158 Ga0307408_100000340 3300031548 Bacteria 44104
159 Ga0307408_100002675 3300031548 Bacteria 12361
160 Ga0307408_100006072 3300031548 Bacteria 8035
161 Ga0307405_10000707 3300031731 Bacteria 12941
162 Ga0307405_10008317 3300031731 Bacteria 5249
163 Ga0307405_10107179 3300031731 Bacteria 1886
164 Ga0307413_10000026 3300031824 Bacteria 39845
165 Ga0307413_10017657 3300031824 Bacteria 3722
166 Ga0307410_10000072 3300031852 Bacteria 35421
167 Ga0307406_10000041 3300031901 Bacteria 74278
168 Ga0307412_10000067 3300031911 Bacteria 115549
169 Ga0307412_10123288 3300031911 Bacteria 1870
170 Ga0307412_10334118 3300031911 Bacteria 1210
171 Ga0307416_100004525 3300032002 Bacteria 8394
172 Ga0307416_100095260 3300032002 Bacteria 2570
173 Ga0307414_10000001 3300032004 Bacteria 1352954
174 Ga0307414_10000141 3300032004 Bacteria 49583
175 Ga0307414_10008314 3300032004 Bacteria 5878
176 Ga0307414_10029090 3300032004 Bacteria 3592
177 Ga0307414_10056025 3300032004 Unclassified 2763
178 Ga0307414_10078817 3300032004 Bacteria 2402
179 Ga0307414_10130442 3300032004 Bacteria 1950
180 Ga0307414_10286221 3300032004 Bacteria 1387
181 Ga0307414_10423299 3300032004 Bacteria 1162
182 Ga0307411_10000005 3300032005 Bacteria 391311
183 Ga0307411_10063307 3300032005 Bacteria 2471
184 Ga0307411_10081288 3300032005 Bacteria 2231
185 Ga0307507_10000217 3300033179 Bacteria 109884
186 Ga0307507_10281296 3300033179 Unclassified 1040
187 Ga0395900_0654681 3300037418 Bacteria 987
188 Ga0436365_0806230 3300039437 Bacteria 1472
189 Ga0439436_0057091 3300041404 Bacteria 1095
190 Ga0439447_012730 3300041407 Bacteria 2407
191 Ga0439466_0006443 3300041411 Bacteria 4463
192 Ga0439433_0025171 3300041999 Bacteria 1343
193 Ga0439445_0057622 3300042004 Bacteria 1058
194 Ga0439449_0057261 3300042007 Bacteria 1439
195 Ga0450898_031224 3300042134 Bacteria 979
196 Ga0450898_036795 3300042134 Bacteria 915
197 Ga0451577_0279966 3300042876 Bacteria 1511
198 Ga0466969_0000745 3300044656 Bacteria 17612
199 Ga0466972_0000035 3300044658 Bacteria 147516
200 Ga0466972_0000108 3300044658 Bacteria 71610
201 Ga0466972_0018596 3300044658 Bacteria 3476
202 Ga0466982_0010864 3300044672 Bacteria 4754
203 Ga0466965_0114398 3300044683 Bacteria 1389
204 Ga0466966_0000186 3300044684 Bacteria 41305
205 Ga0466961_0063158 3300044693 Bacteria 2353
206 Ga0466964_0008517 3300044706 Bacteria 3856
207 Ga0466970_0013485 3300044765 Bacteria 4190
208 Ga0466970_0062455 3300044765 Bacteria 1997
209 Ga0466960_0076580 3300044901 Bacteria 1676
210 Ga0466959_0000025 3300045049 Bacteria 120128
211 Ga0466959_0004768 3300045049 Bacteria 9142
212 Ga0466958_0141455 3300045836 Bacteria 1515
213 Ga0495638_0033523 3300046460 Bacteria 3285
214 Ga0495585_0010518 3300046492 Bacteria 5503
215 Ga0495606_0048560 3300046507 Bacteria 2790
216 Ga0495606_0106261 3300046507 Bacteria 1700
217 Ga0495606_0133822 3300046507 Bacteria 1471
218 Ga0495616_0001308 3300046513 Bacteria 17412
219 Ga0495648_0001413 3300046524 Bacteria 23465
220 Ga0495652_0292120 3300046529 Bacteria 1189
221 Ga0495609_0031496 3300046538 Bacteria 2410
222 Ga0495622_0024277 3300046557 Bacteria 2831
223 Ga0495633_0000029 3300046558 Bacteria 200381
224 Ga0495633_0002039 3300046558 Bacteria 14573
225 Ga0495668_0000012 3300046616 Bacteria 458817
226 Ga0495668_0000268 3300046616 Bacteria 73486
227 Ga0495625_0000817 3300046660 Bacteria 42929
228 Ga0495625_0003937 3300046660 Bacteria 14273
229 Ga0495625_0023123 3300046660 Bacteria 4751
230 Ga0495625_0046940 3300046660 Bacteria 3115
231 Ga0495625_0062622 3300046660 Bacteria 2629
232 Ga0495649_0180635 3300046694 Bacteria 1101
233 Ga0495686_0000443 3300047472 Bacteria 62754
234 Ga0496115_0013641 3300048918 Bacteria 6149
235 Ga0496116_0000041 3300048919 Bacteria 343299
236 Ga0496118_0087346 3300048921 Bacteria 2163
237 Ga0496120_0192238 3300048923 Bacteria 994
238 Ga0496121_0000028 3300048924 Bacteria 439193
239 Ga0496124_0008556 3300048927 Bacteria 10681
240 Ga0496125_0000026 3300048928 Bacteria 397380
241 Ga0496126_0009414 3300048929 Bacteria 10372
242 Ga0496126_0016794 3300048929 Bacteria 7307
243 Ga0495678_047530 3300049459 Bacteria 1679
244 Ga0501070_0116637 3300049586 Bacteria 2205
245 Ga0501070_0499229 3300049586 Bacteria 978
246 Ga0501238_018059 3300049671 Bacteria 985
247 Ga0501249_000033 3300049679 Bacteria 73096
248 Ga0501249_004865 3300049679 Bacteria 2737
249 Ga0501249_005801 3300049679 Bacteria 2524
250 Ga0501241_000647 3300049758 Bacteria 7478
251 Ga0501241_007231 3300049758 Bacteria 2034
252 Ga0501266_000007 3300049763 Bacteria 291751
253 Ga0501269_015207 3300049766 Bacteria 946
254 Ga0501280_002038 3300049776 Bacteria 3503
255 Ga0501280_002700 3300049776 Bacteria 2883
256 Ga0501035_0068849 3300049822 Bacteria 3138
257 Ga0501035_0245667 3300049822 Bacteria 1521
258 Ga0501044_0006481 3300049823 Bacteria 12930
259 nmdc:mga0k408_171_c1 3300050493 Bacteria 34186
260 nmdc:mga05p37_3328_c1 3300050507 Bacteria 12935
261 nmdc:mga08y16_23048_c1 3300050511 Bacteria 6573
262 nmdc:mga0rr50_187543_c1 3300050513 Bacteria 1693
263 Ga0500578_0012042 3300053086 Bacteria 5586
264 Ga0500644_0000081 3300053088 Bacteria 58662
265 Ga0500646_0031140 3300053090 Bacteria 1467
266 Ga0500646_0079924 3300053090 Bacteria 996
267 Ga0500583_0023090 3300053092 Bacteria 2617
268 Ga0500583_0026904 3300053092 Bacteria 2477
269 Ga0500651_0000484 3300053093 Bacteria 20745
270 Ga0500651_0055396 3300053093 Bacteria 2484
271 Ga0500641_0000006 3300053096 Bacteria 223991
272 Ga0500556_0126440 3300053104 Bacteria 1000
273 Ga0500607_076168 3300053121 Bacteria 1721
274 Ga0500608_015488 3300053122 Bacteria 3427
275 Ga0500614_014682 3300053123 Bacteria 1738
276 Ga0500618_000037 3300053125 Bacteria 117320
277 Ga0500652_005836 3300053131 Bacteria 3914
278 Ga0500658_0000008 3300053134 Bacteria 273324
279 Ga0500559_0039553 3300053136 Bacteria 2052
280 Ga0500559_0151799 3300053136 Bacteria 1087
281 Ga0500559_0170137 3300053136 Bacteria 1025
282 Ga0500559_0197899 3300053136 Bacteria 947
283 Ga0500564_172027 3300053138 Bacteria 909
284 Ga0500573_0140910 3300053140 Bacteria 1328
285 Ga0500577_0005295 3300053142 Bacteria 3466
286 Ga0500616_0014422 3300053153 Bacteria 4540
287 Ga0500622_0001604 3300053156 Bacteria 17772
288 Ga0500622_0001788 3300053156 Bacteria 16416
289 Ga0500622_0001873 3300053156 Bacteria 15887
290 Ga0500622_0005657 3300053156 Bacteria 7441
291 Ga0500624_003679 3300053157 Bacteria 2010
292 Ga0500633_0007578 3300053160 Bacteria 2743
293 Ga0500634_0036261 3300053161 Bacteria 2685
294 Ga0500634_0037918 3300053161 Bacteria 2621
295 Ga0500636_0023305 3300053177 Bacteria 3661
296 Ga0500645_027635 3300053730 Bacteria 1720
297 Ga0466962_0033400 3300061719 Bacteria 2461
298 Ga0466962_0197336 3300061719 Bacteria 983

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005289 Ga0065704_10096190 Ga0065704_100961901 241
2 3300010375 Ga0105239_10188342 Ga0105239_101883421 242
3 3300005288 Ga0065714_10099602 Ga0065714_100996022 243
4 3300031824 Ga0307413_10000026 Ga0307413_100000265 243
5 3300032005 Ga0307411_10000005 Ga0307411_10000005115 243
6 3300053134 Ga0500658_0000008 Ga0500658_0000008_5146_5925 243
7 3300032004 Ga0307414_10078817 Ga0307414_100788172 244
8 iso_pu_bacteria 2643221600 2644011655 244
9 3300046660 Ga0495625_0062622 Ga0495625_0062622_1859_2596 245
10 3300053136 Ga0500559_0197899 Ga0500559_0197899_11_790 245
11 3300032004 Ga0307414_10286221 Ga0307414_102862212 246
12 3300049586 Ga0501070_0499229 Ga0501070_0499229_22_762 246
13 3300049679 Ga0501249_005801 Ga0501249_005801_635_1414 246
14 3300049763 Ga0501266_000007 Ga0501266_000007_112866_113645 246
15 3300053136 Ga0500559_0170137 Ga0500559_0170137_274_1014 246
16 3300053157 Ga0500624_003679 Ga0500624_003679_1241_1981 246
17 3300013102 Ga0157371_10000079 Ga0157371_1000007935 248
18 3300013104 Ga0157370_10000060 Ga0157370_1000006086 248
19 3300015261 Ga0182006_1003023 Ga0182006_10030235 248
20 3300028800 Ga0265338_10028990 Ga0265338_100289902 249
21 3300039437 Ga0436365_0806230 Ga0436365_0806230_83_835 249
22 3300046557 Ga0495622_0024277 Ga0495622_0024277_1005_1754 249
23 3300049766 Ga0501269_015207 Ga0501269_015207_101_883 249
24 3300049823 Ga0501044_0006481 Ga0501044_0006481_18_767 249
25 3300053140 Ga0500573_0140910 Ga0500573_0140910_438_1220 249
26 3300031548 Ga0307408_100000340 Ga0307408_1000003407 251
27 3300031731 Ga0307405_10000707 Ga0307405_100007079 251
28 3300042876 Ga0451577_0279966 Ga0451577_0279966_145_909 253
29 3300046660 Ga0495625_0023123 Ga0495625_0023123_3964_4725 253
30 iso_pu_bacteria 2519899754 2520878579 255
31 iso_pu_bacteria 2739367857 2740000611 255
32 iso_pu_bacteria 2739367858 2740005427 255
33 iso_pu_bacteria 2816332280 2817415612 255
34 iso_pu_bacteria 2857618242 2857619258 255
35 iso_pu_bacteria 2903895155 2903898422 255
36 iso_pu_bacteria 2958458903 2958463461 255
37 iso_pu_bacteria 2965320100 2965320486 255
38 iso_pu_bacteria 8055419101 8055421301 255
39 iso_pu_bacteria 2643221667 2644370038 256
40 iso_pu_bacteria 2643221716 2644642114 256
41 iso_pu_bacteria 2643221725 2644685456 256
42 iso_pu_bacteria 2738541279 2738736439 256
43 iso_pu_bacteria 2738541285 2738768882 256
44 iso_pu_bacteria 2738543007 2739218021 256
45 iso_pu_bacteria 2802428842 2802653512 256
46 iso_pu_bacteria 2857613821 2857614383 256
47 iso_pu_bacteria 2881359912 2881362442 256
48 iso_pu_bacteria 2904419702 2904423219 256
49 iso_pu_bacteria 2904555929 2904556454 256
50 iso_pu_bacteria 2919191525 2919193160 256
51 iso_pu_bacteria 2929150217 2929152880 256
52 iso_pu_bacteria 2977268062 2977269546 256
53 iso_pu_bacteria 8054307821 8054308627 256
54 iso_pu_bacteria 2522125168 2522551826 257
55 iso_pu_bacteria 2890804823 2890807217 257
56 3300013102 Ga0157371_10076593 Ga0157371_100765932 258
57 3300032005 Ga0307411_10063307 Ga0307411_100633072 258
58 3300006942 Ga0099824_1007266 Ga0099824_10072662 259
59 3300006948 Ga0099826_10030207 Ga0099826_100302073 259
60 3300014326 Ga0157380_10008496 Ga0157380_100084964 259
61 3300014326 Ga0157380_10044606 Ga0157380_100446063 259
62 3300015261 Ga0182006_1028214 Ga0182006_10282141 259
63 3300015261 Ga0182006_1029315 Ga0182006_10293151 259
64 3300025942 Ga0207689_10381524 Ga0207689_103815242 259
65 3300027361 Ga0209489_120518 Ga0209489_1205181 259
66 3300031911 Ga0307412_10123288 Ga0307412_101232882 259
67 3300032002 Ga0307416_100004525 Ga0307416_1000045254 259
68 3300041407 Ga0439447_012730 Ga0439447_012730_72_851 259
69 3300048921 Ga0496118_0087346 Ga0496118_0087346_1216_1995 259
70 3300049679 Ga0501249_004865 Ga0501249_004865_444_1223 259
71 iso_pu_bacteria 2739367656 2739617990 259
72 iso_pu_bacteria 2842903701 2842905559 259
73 3300005293 Ga0065715_10153147 Ga0065715_101531472 260
74 3300009036 Ga0105244_10000003 Ga0105244_1000000334 260
75 3300009094 Ga0111539_10110864 Ga0111539_101108643 260
76 3300013102 Ga0157371_10022026 Ga0157371_100220261 260
77 3300013104 Ga0157370_10003737 Ga0157370_1000373712 260
78 3300013104 Ga0157370_10316085 Ga0157370_103160852 260
79 3300013105 Ga0157369_10000766 Ga0157369_1000076637 260
80 3300013307 Ga0157372_10325881 Ga0157372_103258812 260
81 3300013308 Ga0157375_10085227 Ga0157375_100852274 260
82 3300015261 Ga0182006_1064257 Ga0182006_10642572 260
83 3300017792 Ga0163161_10000131 Ga0163161_100001315 260
84 3300025728 Ga0207655_1000010 Ga0207655_1000010515 260
85 3300027907 Ga0207428_10202225 Ga0207428_102022251 260
86 3300031548 Ga0307408_100006072 Ga0307408_1000060723 260
87 3300031731 Ga0307405_10008317 Ga0307405_100083173 260
88 3300031852 Ga0307410_10000072 Ga0307410_100000724 260
89 3300031901 Ga0307406_10000041 Ga0307406_1000004124 260
90 3300031911 Ga0307412_10334118 Ga0307412_103341182 260
91 3300032004 Ga0307414_10000001 Ga0307414_10000001520 260
92 3300032004 Ga0307414_10130442 Ga0307414_101304422 260
93 3300032005 Ga0307411_10081288 Ga0307411_100812882 260
94 3300041411 Ga0439466_0006443 Ga0439466_0006443_2632_3414 260
95 3300048919 Ga0496116_0000041 Ga0496116_0000041_137264_138046 260
96 3300048927 Ga0496124_0008556 Ga0496124_0008556_7135_7917 260
97 3300048928 Ga0496125_0000026 Ga0496125_0000026_294357_295139 260
98 3300048929 Ga0496126_0016794 Ga0496126_0016794_1875_2657 260
99 3300049671 Ga0501238_018059 Ga0501238_018059_121_903 260
100 3300049679 Ga0501249_000033 Ga0501249_000033_58882_59664 260
101 3300049776 Ga0501280_002038 Ga0501280_002038_1658_2440 260
102 3300050511 nmdc:mga08y16_23048_c1 nmdc:mga08y16_23048_c1_981_1763 260
103 3300053090 Ga0500646_0031140 Ga0500646_0031140_611_1393 260
104 3300053096 Ga0500641_0000006 Ga0500641_0000006_80154_80936 260
105 iso_pu_bacteria 2818991442 2819572727 260
106 iso_pu_bacteria 2821136567 2821139868 260
107 iso_pu_bacteria 2904467357 2904473820 260
108 3300005262 Ga0065165_1000130 Ga0065165_100013013 261
109 3300009545 Ga0105237_10019971 Ga0105237_100199715 261
110 3300013100 Ga0157373_10491833 Ga0157373_104918331 261
111 3300025292 Ga0209676_1001696 Ga0209676_10016962 261
112 3300031251 Ga0265327_10000006 Ga0265327_1000000643 261
113 3300045836 Ga0466958_0141455 Ga0466958_0141455_710_1495 261
114 3300061719 Ga0466962_0033400 Ga0466962_0033400_1121_1906 261
115 iso_pu_bacteria 2721755487 2722726677 261
116 iso_pu_bacteria 2738541278 2738730294 261
117 iso_pu_bacteria 2738541284 2738761071 261
118 iso_pu_bacteria 2739367866 2740032981 261
119 iso_pu_bacteria 2896109856 2896115435 261
120 iso_pu_bacteria 2896317667 2896318823 261
121 iso_pu_bacteria 2898713307 2898715944 261
122 iso_pu_bacteria 2919437846 2919438361 261
123 iso_pu_bacteria 2929154850 2929155623 261
124 iso_pu_bacteria 2977232053 2977233706 261
125 3300005983 Ga0081540_1022056 Ga0081540_10220563 262
126 3300031824 Ga0307413_10017657 Ga0307413_100176575 262
127 3300032004 Ga0307414_10029090 Ga0307414_100290903 262
128 3300046460 Ga0495638_0033523 Ga0495638_0033523_2193_2981 262
129 3300046524 Ga0495648_0001413 Ga0495648_0001413_10901_11689 262
130 3300053090 Ga0500646_0079924 Ga0500646_0079924_46_834 262
131 3300053092 Ga0500583_0023090 Ga0500583_0023090_1196_1984 262
132 3300053136 Ga0500559_0039553 Ga0500559_0039553_1153_1941 262
133 3300053156 Ga0500622_0005657 Ga0500622_0005657_1744_2532 262
134 iso_pu_bacteria 2818991460 2819681275 262
135 iso_pu_bacteria 2929177148 2929179269 262
136 iso_pu_bacteria 2945977869 2945981673 262
137 iso_pu_bacteria 2946013367 2946018924 262
138 3300009093 Ga0105240_10922626 Ga0105240_109226261 263
139 3300009553 Ga0105249_10494711 Ga0105249_104947112 263
140 3300013104 Ga0157370_10129819 Ga0157370_101298191 263
141 3300013306 Ga0163162_10056004 Ga0163162_100560043 263
142 3300013308 Ga0157375_10013896 Ga0157375_100138962 263
143 3300014325 Ga0163163_10321737 Ga0163163_103217372 263
144 3300014969 Ga0157376_10068838 Ga0157376_100688382 263
145 3300017792 Ga0163161_10000224 Ga0163161_1000022418 263
146 3300025893 Ga0207682_10013033 Ga0207682_100130335 263
147 3300025921 Ga0207652_10009213 Ga0207652_100092135 263
148 3300025926 Ga0207659_10134631 Ga0207659_101346312 263
149 3300030731 Ga0316177_1120096 Ga0316177_11200966 263
150 3300030742 Ga0316183_1007327 Ga0316183_100732755 263
151 3300030744 Ga0316181_1260720 Ga0316181_12607207 263
152 3300033179 Ga0307507_10281296 Ga0307507_102812962 263
153 3300044672 Ga0466982_0010864 Ga0466982_0010864_2482_3273 263
154 3300053156 Ga0500622_0001604 Ga0500622_0001604_9531_10322 263
155 iso_pu_bacteria 2884791551 2884792242 263
156 3300002737 JGI25162J39368_1001217 JGI25162J39368_10012172 264
157 3300003214 JGI25165J46597_1001194 JGI25165J46597_100119415 264
158 3300003316 rootH1_10118026 rootH1_101180263 264
159 3300003322 rootL2_10081941 rootL2_100819412 264
160 3300003323 rootH1_10008848 rootH1_100088487 264
161 3300003323 rootH1_10039624 rootH1_100396247 264
162 3300005539 Ga0068853_100140462 Ga0068853_1001404621 264
163 3300005841 Ga0068863_100491081 Ga0068863_1004910811 264
164 3300006195 Ga0075366_10000123 Ga0075366_1000012313 264
165 3300009545 Ga0105237_10005011 Ga0105237_100050116 264
166 3300015265 Ga0182005_1000179 Ga0182005_100017928 264
167 3300025208 Ga0209436_107532 Ga0209436_1075322 264
168 3300025231 Ga0207427_100137 Ga0207427_10013731 264
169 3300025233 Ga0209437_100112 Ga0209437_10011289 264
170 3300025261 Ga0209233_1000126 Ga0209233_100012692 264
171 3300025298 Ga0209050_1002589 Ga0209050_10025895 264
172 3300025914 Ga0207671_10020551 Ga0207671_100205513 264
173 3300026088 Ga0207641_10449438 Ga0207641_104494381 264
174 3300028794 Ga0307515_10000235 Ga0307515_1000023524 264
175 3300028794 Ga0307515_10000280 Ga0307515_1000028015 264
176 3300028794 Ga0307515_10065516 Ga0307515_100655162 264
177 3300031456 Ga0307513_10023549 Ga0307513_100235494 264
178 3300031548 Ga0307408_100002675 Ga0307408_1000026753 264
179 3300031731 Ga0307405_10107179 Ga0307405_101071792 264
180 3300032002 Ga0307416_100095260 Ga0307416_1000952602 264
181 3300033179 Ga0307507_10000217 Ga0307507_1000021756 264
182 3300042004 Ga0439445_0057622 Ga0439445_0057622_189_983 264
183 3300042134 Ga0450898_036795 Ga0450898_036795_98_892 264
184 3300044658 Ga0466972_0000108 Ga0466972_0000108_28629_29423 264
185 3300044658 Ga0466972_0018596 Ga0466972_0018596_2560_3354 264
186 3300046492 Ga0495585_0010518 Ga0495585_0010518_356_1150 264
187 3300046507 Ga0495606_0048560 Ga0495606_0048560_929_1723 264
188 3300046529 Ga0495652_0292120 Ga0495652_0292120_332_1126 264
189 3300046538 Ga0495609_0031496 Ga0495609_0031496_132_926 264
190 3300046558 Ga0495633_0000029 Ga0495633_0000029_127890_128684 264
191 3300046558 Ga0495633_0002039 Ga0495633_0002039_11130_11924 264
192 3300046616 Ga0495668_0000012 Ga0495668_0000012_449620_450414 264
193 3300046660 Ga0495625_0000817 Ga0495625_0000817_8252_9046 264
194 3300046660 Ga0495625_0003937 Ga0495625_0003937_9007_9801 264
195 3300046660 Ga0495625_0046940 Ga0495625_0046940_582_1376 264
196 3300048924 Ga0496121_0000028 Ga0496121_0000028_32407_33246 264
197 3300049776 Ga0501280_002700 Ga0501280_002700_1926_2726 264
198 3300049822 Ga0501035_0068849 Ga0501035_0068849_2263_3057 264
199 3300050493 nmdc:mga0k408_171_c1 nmdc:mga0k408_171_c1_10886_11680 264
200 3300053086 Ga0500578_0012042 Ga0500578_0012042_2827_3621 264
201 3300053093 Ga0500651_0055396 Ga0500651_0055396_936_1730 264
202 3300053122 Ga0500608_015488 Ga0500608_015488_1433_2227 264
203 3300053123 Ga0500614_014682 Ga0500614_014682_569_1363 264
204 3300053125 Ga0500618_000037 Ga0500618_000037_115893_116795 264
205 3300053156 Ga0500622_0001873 Ga0500622_0001873_7015_7809 264
206 3300053177 Ga0500636_0023305 Ga0500636_0023305_1694_2488 264
207 3300053730 Ga0500645_027635 Ga0500645_027635_156_950 264
208 2162886012 MBSR1b_contig_13626306 MBSR1b_0849.00001940 265
209 3300001989 JGI24739J22299_10000636 JGI24739J22299_100006365 265
210 3300002737 JGI25162J39368_1000130 JGI25162J39368_100013039 265
211 3300003215 JGI25153J46596_10008465 JGI25153J46596_100084652 265
212 3300003320 rootH2_10084384 rootH2_100843843 265
213 3300003322 rootL2_10045912 rootL2_100459125 265
214 3300003323 rootH1_10006330 rootH1_1000633017 265
215 3300003323 rootH1_10017729 rootH1_100177292 265
216 3300003323 rootH1_10041830 rootH1_100418303 265
217 3300003354 JGI25160J50197_1000764 JGI25160J50197_10007647 265
218 3300003761 Ga0055535_1002449 Ga0055535_10024493 265
219 3300003762 Ga0055542_1003495 Ga0055542_10034951 265
220 3300003791 Ga0055530_10001184 Ga0055530_100011846 265
221 3300003794 Ga0055531_10000263 Ga0055531_1000026333 265
222 3300003794 Ga0055531_10037998 Ga0055531_100379982 265
223 3300004625 Ga0055543_1006911 Ga0055543_10069112 265
224 3300005262 Ga0065165_1000172 Ga0065165_10001728 265
225 3300005288 Ga0065714_10007993 Ga0065714_100079933 265
226 3300005288 Ga0065714_10076123 Ga0065714_100761232 265
227 3300005289 Ga0065704_10075654 Ga0065704_100756543 265
228 3300005336 Ga0070680_100153696 Ga0070680_1001536963 265
229 3300005339 Ga0070660_100146980 Ga0070660_1001469802 265
230 3300005356 Ga0070674_100135401 Ga0070674_1001354012 265
231 3300005364 Ga0070673_100186515 Ga0070673_1001865152 265
232 3300005459 Ga0068867_100267419 Ga0068867_1002674192 265
233 3300005539 Ga0068853_100029888 Ga0068853_1000298883 265
234 3300005543 Ga0070672_100185176 Ga0070672_1001851761 265
235 3300005563 Ga0068855_100000054 Ga0068855_10000005470 265
236 3300005563 Ga0068855_100000856 Ga0068855_10000085612 265
237 3300005563 Ga0068855_100692908 Ga0068855_1006929081 265
238 3300005577 Ga0068857_100193014 Ga0068857_1001930143 265
239 3300005577 Ga0068857_100239019 Ga0068857_1002390192 265
240 3300005617 Ga0068859_100001409 Ga0068859_10000140919 265
241 3300005834 Ga0068851_10018829 Ga0068851_100188292 265
242 3300005841 Ga0068863_100132038 Ga0068863_1001320383 265
243 3300006195 Ga0075366_10033456 Ga0075366_100334561 265
244 3300006195 Ga0075366_10112270 Ga0075366_101122702 265
245 3300006237 Ga0097621_100275295 Ga0097621_1002752952 265
246 3300006931 Ga0097620_100001409 Ga0097620_10000140919 265
247 3300009093 Ga0105240_10538720 Ga0105240_105387201 265
248 3300009147 Ga0114129_10010785 Ga0114129_1001078514 265
249 3300009545 Ga0105237_10030489 Ga0105237_100304891 265
250 3300009545 Ga0105237_10251005 Ga0105237_102510051 265
251 3300010375 Ga0105239_10000690 Ga0105239_1000069037 265
252 3300010375 Ga0105239_10003864 Ga0105239_100038645 265
253 3300010375 Ga0105239_10029606 Ga0105239_100296062 265
254 3300013100 Ga0157373_10000188 Ga0157373_1000018817 265
255 3300013100 Ga0157373_10000560 Ga0157373_1000056012 265
256 3300013100 Ga0157373_10218522 Ga0157373_102185222 265
257 3300013102 Ga0157371_10001546 Ga0157371_1000154611 265
258 3300013102 Ga0157371_10032458 Ga0157371_100324583 265
259 3300013104 Ga0157370_10528546 Ga0157370_105285461 265
260 3300013105 Ga0157369_10081103 Ga0157369_100811033 265
261 3300013307 Ga0157372_10000458 Ga0157372_1000045813 265
262 3300013307 Ga0157372_10009152 Ga0157372_100091529 265
263 3300013307 Ga0157372_10097563 Ga0157372_100975632 265
264 3300013307 Ga0157372_10330433 Ga0157372_103304332 265
265 3300013307 Ga0157372_10636781 Ga0157372_106367811 265
266 3300015261 Ga0182006_1018310 Ga0182006_10183102 265
267 3300015262 Ga0182007_10004282 Ga0182007_100042826 265
268 3300017792 Ga0163161_10001043 Ga0163161_100010437 265
269 3300017792 Ga0163161_10070229 Ga0163161_100702292 265
270 3300025233 Ga0209437_100089 Ga0209437_10008938 265
271 3300025242 Ga0209258_100193 Ga0209258_10019353 265
272 3300025254 Ga0209148_1000167 Ga0209148_100016763 265
273 3300025284 Ga0209130_1010994 Ga0209130_10109943 265
274 3300025297 Ga0209758_1005024 Ga0209758_10050246 265
275 3300025298 Ga0209050_1000453 Ga0209050_10004538 265
276 3300025302 Ga0207426_1000034 Ga0207426_100003442 265
277 3300025302 Ga0207426_1002680 Ga0207426_10026802 265
278 3300025304 Ga0209257_1000025 Ga0209257_1000025267 265
279 3300025304 Ga0209257_1004280 Ga0209257_10042802 265
280 3300025914 Ga0207671_10002069 Ga0207671_1000206912 265
281 3300025940 Ga0207691_10098967 Ga0207691_100989675 265
282 3300025949 Ga0207667_10000023 Ga0207667_10000023241 265
283 3300025949 Ga0207667_10006360 Ga0207667_1000636010 265
284 3300025960 Ga0207651_10116940 Ga0207651_101169403 265
285 3300025981 Ga0207640_10277067 Ga0207640_102770672 265
286 3300026041 Ga0207639_10047981 Ga0207639_100479814 265
287 3300026089 Ga0207648_10124709 Ga0207648_101247093 265
288 3300026116 Ga0207674_10123763 Ga0207674_101237633 265
289 3300026116 Ga0207674_10235558 Ga0207674_102355582 265
290 3300029957 Ga0265324_10017982 Ga0265324_100179821 265
291 3300030521 Ga0307511_10000046 Ga0307511_1000004667 265
292 3300031238 Ga0265332_10047907 Ga0265332_100479071 265
293 3300031251 Ga0265327_10000024 Ga0265327_10000024275 265
294 3300031911 Ga0307412_10000067 Ga0307412_1000006711 265
295 3300032004 Ga0307414_10000141 Ga0307414_1000014139 265
296 3300032004 Ga0307414_10008314 Ga0307414_100083148 265
297 3300032004 Ga0307414_10056025 Ga0307414_100560253 265
298 3300032004 Ga0307414_10423299 Ga0307414_104232991 265
299 3300037418 Ga0395900_0654681 Ga0395900_0654681_141_944 265
300 3300041404 Ga0439436_0057091 Ga0439436_0057091_92_892 265
301 3300041999 Ga0439433_0025171 Ga0439433_0025171_88_888 265
302 3300042007 Ga0439449_0057261 Ga0439449_0057261_132_929 265
303 3300042134 Ga0450898_031224 Ga0450898_031224_29_826 265
304 3300044656 Ga0466969_0000745 Ga0466969_0000745_8090_8887 265
305 3300044658 Ga0466972_0000035 Ga0466972_0000035_78366_79163 265
306 3300044683 Ga0466965_0114398 Ga0466965_0114398_47_859 265
307 3300044684 Ga0466966_0000186 Ga0466966_0000186_26695_27492 265
308 3300044693 Ga0466961_0063158 Ga0466961_0063158_414_1211 265
309 3300044706 Ga0466964_0008517 Ga0466964_0008517_2262_3059 265
310 3300044765 Ga0466970_0013485 Ga0466970_0013485_2673_3470 265
311 3300044765 Ga0466970_0062455 Ga0466970_0062455_909_1706 265
312 3300044901 Ga0466960_0076580 Ga0466960_0076580_864_1661 265
313 3300045049 Ga0466959_0000025 Ga0466959_0000025_77431_78228 265
314 3300045049 Ga0466959_0004768 Ga0466959_0004768_8056_8868 265
315 3300046507 Ga0495606_0106261 Ga0495606_0106261_234_1046 265
316 3300046507 Ga0495606_0133822 Ga0495606_0133822_116_913 265
317 3300046513 Ga0495616_0001308 Ga0495616_0001308_10393_11190 265
318 3300046616 Ga0495668_0000268 Ga0495668_0000268_67799_68596 265
319 3300046694 Ga0495649_0180635 Ga0495649_0180635_231_1028 265
320 3300047472 Ga0495686_0000443 Ga0495686_0000443_59981_60778 265
321 3300048918 Ga0496115_0013641 Ga0496115_0013641_1147_1944 265
322 3300048923 Ga0496120_0192238 Ga0496120_0192238_144_941 265
323 3300048929 Ga0496126_0009414 Ga0496126_0009414_5206_6003 265
324 3300049459 Ga0495678_047530 Ga0495678_047530_701_1498 265
325 3300049586 Ga0501070_0116637 Ga0501070_0116637_874_1671 265
326 3300049758 Ga0501241_000647 Ga0501241_000647_1217_2014 265
327 3300049758 Ga0501241_007231 Ga0501241_007231_425_1222 265
328 3300049822 Ga0501035_0245667 Ga0501035_0245667_306_1106 265
329 3300050507 nmdc:mga05p37_3328_c1 nmdc:mga05p37_3328_c1_10736_11533 265
330 3300050513 nmdc:mga0rr50_187543_c1 nmdc:mga0rr50_187543_c1_723_1520 265
331 3300053088 Ga0500644_0000081 Ga0500644_0000081_5306_6103 265
332 3300053092 Ga0500583_0026904 Ga0500583_0026904_819_1616 265
333 3300053093 Ga0500651_0000484 Ga0500651_0000484_16394_17191 265
334 3300053104 Ga0500556_0126440 Ga0500556_0126440_76_876 265
335 3300053121 Ga0500607_076168 Ga0500607_076168_95_892 265
336 3300053131 Ga0500652_005836 Ga0500652_005836_1749_2546 265
337 3300053136 Ga0500559_0151799 Ga0500559_0151799_235_1032 265
338 3300053138 Ga0500564_172027 Ga0500564_172027_17_814 265
339 3300053142 Ga0500577_0005295 Ga0500577_0005295_2658_3455 265
340 3300053153 Ga0500616_0014422 Ga0500616_0014422_1502_2299 265
341 3300053156 Ga0500622_0001788 Ga0500622_0001788_12581_13378 265
342 3300053160 Ga0500633_0007578 Ga0500633_0007578_61_858 265
343 3300053161 Ga0500634_0036261 Ga0500634_0036261_437_1234 265
344 3300053161 Ga0500634_0037918 Ga0500634_0037918_1404_2201 265
345 3300061719 Ga0466962_0197336 Ga0466962_0197336_174_971 265

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF20613

HipA_2

HipA-like kinase

10

242

0.77

Structural Annotation

Top 5 Hits

ID Description Score Start End
3akj-assembly1.cif.gz_A crystal structure of a helicobacter pylori proinflammatory kinase ctka 0.6161 27 259
3akk-assembly2.cif.gz_D crystal structure of a helicobacter pylori proinflammatory kinase ctka 0.596 8 265
3akl-assembly2.cif.gz_D crystal structure of a helicobacter pylori proinflammatory kinase ctka 0.5933 10 259
3akk-assembly1.cif.gz_A crystal structure of a helicobacter pylori proinflammatory kinase ctka 0.5909 9 264
3akl-assembly1.cif.gz_B crystal structure of a helicobacter pylori proinflammatory kinase ctka 0.5844 7 259
ID Description Score Start End Superfamily
af_P0C0K3_17_108_3.30.200.70 Alpha Beta;2-Layer Sandwich;Phosphorylase Kinase; domain 1; 0.7398 11 42 3.30.200.70
af_Q2G2A7_273_342_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.7259 15 41 2.40.50.140
1zylA01 Alpha Beta;2-Layer Sandwich;Phosphorylase Kinase; domain 1; 0.6843 13 42 3.30.200.70
3oyyA03 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.6517 11 41 2.40.50.140
af_K7M0I8_269_382_3.30.200.20 Alpha Beta;2-Layer Sandwich;Phosphorylase Kinase; domain 1;Phosphorylase Kinase; domain 1 0.5508 15 105 3.30.200.20
ID Description Score Start End GO Terms
AF-A0A1I1JRJ8-F1-model_v4 HipA-like kinase domain-containing protein 0.992 7 265
AF-A0A2P8E5Z8-F1-model_v4 HipA-like kinase domain-containing protein 0.9897 7 265
AF-A0A1M6GFS8-F1-model_v4 HipA-like kinase domain-containing protein 0.9868 7 265
AF-A0A4Q3T132-F1-model_v4 Aminotransferase class I and II 0.9861 7 101 GO:0008483
AF-A0A7W0WFH2-F1-model_v4 Aminotransferase class I and II 0.9855 8 164 GO:0008483

Feature Viewer

pLDDT pTM Quality
91.1 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map