F416352

General Info

Members Datasets Scaffolds Average Seq Length
345 170 690 145

Family's Representative Sequence

Representative Sequence 3300009147|Ga0114129_10036903|Ga0114129_100369036
Length 176
Sequence MCSTRQVAAHAAXXXHEEVHVVIEPAARRDLTEVRALLERHHLPLDGVDDLADSMIVARDEAHIVGAAALEVYADGALLRSVAVDPAAQGQRLGHRLTEAALQMAKARGARSVFLLTTTAERFFPRFGFEPIARADVPESVQASIEFQSACPASAVVMRKRLAAEDVGVPHPLEQS

Samples

Sample ID Description Type Environment
1 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
2 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
3 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
4 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
25 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
26 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
31 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
32 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
33 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
34 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
35 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
36 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
37 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
38 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
39 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
40 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
41 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
42 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
43 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
44 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
45 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
46 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
47 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
48 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
49 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
50 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
51 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
52 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
53 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
54 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
55 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
56 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
57 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
58 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
59 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
60 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
61 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
62 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
63 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
65 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
66 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
68 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
69 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
70 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
71 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
72 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
73 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
74 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
75 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
76 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
77 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
78 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
79 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
80 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
81 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
117 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
121 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
122 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
123 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
124 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
125 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
126 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
127 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
128 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
129 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
130 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
131 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
132 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
133 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
134 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
135 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
136 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
137 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
138 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
139 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
140 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
141 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
142 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
143 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
144 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
145 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
146 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
147 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
148 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
149 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
150 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
151 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
152 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
153 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
154 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
155 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
156 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
157 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
158 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
159 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
160 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
161 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
162 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
163 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
164 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
165 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
166 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
167 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
168 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
169 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
170 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.74
Nodule 0
Rhizoplane 1.74
Rhizosphere 96.52
Stem 0
Stem Tuber 0
Unclassified 18.84

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0114129_10036903 3300009147 Bacteria 6899
2 JGI24746J21847_1035622 3300001977 Unclassified 688
3 JGI24034J26672_10117284 3300002239 Unclassified 513
4 JGI25406J46586_10015899 3300003203 Unclassified 3156
5 Ga0065712_10067868 3300005290 Bacteria 24325
6 Ga0065715_10001253 3300005293 Bacteria 10078
7 Ga0065707_10004763 3300005295 Bacteria 5876
8 Ga0065707_10070239 3300005295 Bacteria 512
9 Ga0065707_10114935 3300005295 Bacteria 2282
10 Ga0065707_10507042 3300005295 Bacteria 752
11 Ga0070677_10000342 3300005333 Bacteria 16287
12 Ga0070677_10380021 3300005333 Bacteria 739
13 Ga0068869_100062760 3300005334 Bacteria 2728
14 Ga0068869_100065361 3300005334 Bacteria 2677
15 Ga0068869_100254001 3300005334 Bacteria 1405
16 Ga0068869_100552797 3300005334 Bacteria 967
17 Ga0070666_10143373 3300005335 Bacteria 1664
18 Ga0070682_101154460 3300005337 Bacteria 651
19 Ga0070689_100069919 3300005340 Bacteria 2740
20 Ga0070689_100072841 3300005340 Bacteria 2685
21 Ga0070691_10035995 3300005341 Bacteria 2332
22 Ga0070661_100057149 3300005344 Bacteria 2859
23 Ga0070668_100127069 3300005347 Bacteria 2043
24 Ga0070668_100225676 3300005347 Bacteria 1547
25 Ga0070668_100419052 3300005347 Unclassified 1146
26 Ga0070669_100031868 3300005353 Bacteria 3808
27 Ga0070669_100071713 3300005353 Bacteria 2563
28 Ga0070669_100145847 3300005353 Unclassified 1829
29 Ga0070675_100008740 3300005354 Bacteria 7868
30 Ga0070675_100104682 3300005354 Bacteria 2387
31 Ga0070675_100106666 3300005354 Unclassified 2365
32 Ga0070675_100579558 3300005354 Bacteria 1016
33 Ga0070675_100752533 3300005354 Bacteria 889
34 Ga0070671_100019271 3300005355 Bacteria 5550
35 Ga0070674_100100358 3300005356 Unclassified 2107
36 Ga0070674_101391421 3300005356 Unclassified 628
37 Ga0070673_100418054 3300005364 Bacteria 1201
38 Ga0070688_100099289 3300005365 Bacteria 1916
39 Ga0070688_100135042 3300005365 Bacteria 1669
40 Ga0070688_100704388 3300005365 Unclassified 782
41 Ga0070659_100360460 3300005366 Unclassified 1221
42 Ga0070659_100806966 3300005366 Unclassified 816
43 Ga0070667_101684461 3300005367 Unclassified 596
44 Ga0070700_100188608 3300005441 Bacteria 1440
45 Ga0070700_101839557 3300005441 Unclassified 522
46 Ga0070694_100309183 3300005444 Unclassified 1213
47 Ga0070694_100589346 3300005444 Bacteria 894
48 Ga0070694_101635244 3300005444 Bacteria 547
49 Ga0070708_100165787 3300005445 Bacteria 2061
50 Ga0070678_100010244 3300005456 Bacteria 5717
51 Ga0070678_101774933 3300005456 Bacteria 581
52 Ga0070662_100134952 3300005457 Bacteria 1907
53 Ga0070662_100165135 3300005457 Bacteria 1734
54 Ga0070662_100314183 3300005457 Bacteria 1276
55 Ga0068867_100100948 3300005459 Bacteria 2204
56 Ga0068867_100168399 3300005459 Bacteria 1733
57 Ga0068867_102226763 3300005459 Unclassified 520
58 Ga0070698_100258961 3300005471 Bacteria 1672
59 Ga0070697_100762188 3300005536 Unclassified 855
60 Ga0068853_102124942 3300005539 Unclassified 544
61 Ga0070672_100005450 3300005543 Bacteria 8434
62 Ga0070686_100204516 3300005544 Bacteria 1418
63 Ga0070686_100920435 3300005544 Bacteria 712
64 Ga0070686_100929301 3300005544 Bacteria 709
65 Ga0070695_100466072 3300005545 Bacteria 971
66 Ga0070696_100117443 3300005546 Bacteria 1922
67 Ga0070665_100076846 3300005548 Bacteria 3345
68 Ga0070665_100402809 3300005548 Bacteria 1376
69 Ga0070665_101379479 3300005548 Unclassified 714
70 Ga0070704_100288354 3300005549 Bacteria 1363
71 Ga0070704_100698769 3300005549 Bacteria 899
72 Ga0070704_100871158 3300005549 Unclassified 808
73 Ga0070664_100001376 3300005564 Bacteria 19380
74 Ga0070664_100246080 3300005564 Bacteria 1606
75 Ga0068857_100094724 3300005577 Bacteria 2674
76 Ga0068857_100444170 3300005577 Bacteria 1212
77 Ga0068856_100372920 3300005614 Bacteria 1446
78 Ga0070702_100433739 3300005615 Unclassified 949
79 Ga0068859_100009546 3300005617 Bacteria 9794
80 Ga0068859_100174245 3300005617 Bacteria 2233
81 Ga0068859_100220140 3300005617 Bacteria 1986
82 Ga0068859_100530486 3300005617 Bacteria 1272
83 Ga0068859_101255573 3300005617 Bacteria 816
84 Ga0068864_100206762 3300005618 Bacteria 1806
85 Ga0068864_100392087 3300005618 Bacteria 1318
86 Ga0068864_101431671 3300005618 Unclassified 693
87 Ga0068861_100045450 3300005719 Bacteria 3307
88 Ga0068861_100333972 3300005719 Bacteria 1324
89 Ga0068861_100524030 3300005719 Bacteria 1075
90 Ga0068861_100641058 3300005719 Unclassified 980
91 Ga0068861_100935616 3300005719 Unclassified 823
92 Ga0068851_10230743 3300005834 Unclassified 1043
93 Ga0068870_10003188 3300005840 Bacteria 6918
94 Ga0068870_10028154 3300005840 Bacteria 2818
95 Ga0068870_10086730 3300005840 Bacteria 1742
96 Ga0068860_100060610 3300005843 Bacteria 3596
97 Ga0068862_100001770 3300005844 Bacteria 19529
98 Ga0068862_100069166 3300005844 Bacteria 3047
99 Ga0068862_100206253 3300005844 Bacteria 1774
100 Ga0068862_100389736 3300005844 Bacteria 1301
101 Ga0068862_100556226 3300005844 Bacteria 1096
102 Ga0068862_100568043 3300005844 Bacteria 1085
103 Ga0081455_10107807 3300005937 Bacteria 2220
104 Ga0081539_10000024 3300005985 Bacteria 354702
105 Ga0081539_10002277 3300005985 Bacteria 27822
106 Ga0075432_10025289 3300006058 Bacteria 2037
107 Ga0075367_10141998 3300006178 Bacteria 1488
108 Ga0075366_10002729 3300006195 Bacteria 9119
109 Ga0075366_10539095 3300006195 Unclassified 722
110 Ga0068871_100362631 3300006358 Bacteria 1284
111 Ga0075428_100019373 3300006844 Bacteria 7530
112 Ga0075428_100025258 3300006844 Bacteria 6574
113 Ga0075428_100087790 3300006844 Bacteria 3392
114 Ga0075428_100369898 3300006844 Bacteria 1537
115 Ga0075428_100453656 3300006844 Bacteria 1373
116 Ga0075428_100463796 3300006844 Bacteria 1356
117 Ga0075430_100017988 3300006846 Bacteria 6017
118 Ga0075430_100395593 3300006846 Bacteria 1140
119 Ga0075430_100556440 3300006846 Unclassified 946
120 Ga0075431_100008017 3300006847 Bacteria 10538
121 Ga0075431_100017633 3300006847 Bacteria 7259
122 Ga0075431_100050107 3300006847 Bacteria 4306
123 Ga0075431_100086286 3300006847 Bacteria 3239
124 Ga0075431_100419696 3300006847 Bacteria 1337
125 Ga0075431_100597909 3300006847 Bacteria 1087
126 Ga0075431_101601251 3300006847 Unclassified 609
127 Ga0075433_10021866 3300006852 Bacteria 5367
128 Ga0075433_10030758 3300006852 Bacteria 4583
129 Ga0075433_10358596 3300006852 Bacteria 1288
130 Ga0075434_100000561 3300006871 Bacteria 28555
131 Ga0075434_100023925 3300006871 Bacteria 5963
132 Ga0075434_100097428 3300006871 Bacteria 2946
133 Ga0075434_100440413 3300006871 Unclassified 1324
134 Ga0075429_100007885 3300006880 Bacteria 9249
135 Ga0075429_100020919 3300006880 Bacteria 5677
136 Ga0075429_100086441 3300006880 Bacteria 2733
137 Ga0075429_100149803 3300006880 Bacteria 2042
138 Ga0075429_101442943 3300006880 Unclassified 599
139 Ga0068865_100886622 3300006881 Bacteria 775
140 Ga0097620_100009546 3300006931 Bacteria 9794
141 Ga0097620_100174247 3300006931 Bacteria 2233
142 Ga0097620_100220132 3300006931 Bacteria 1986
143 Ga0097620_100530460 3300006931 Bacteria 1272
144 Ga0097620_101255464 3300006931 Bacteria 816
145 Ga0075435_100001244 3300007076 Bacteria 16320
146 Ga0075435_100805867 3300007076 Bacteria 818
147 Ga0105244_10237977 3300009036 Bacteria 851
148 Ga0111539_10004703 3300009094 Bacteria 17848
149 Ga0111539_10008615 3300009094 Bacteria 12956
150 Ga0111539_10010242 3300009094 Bacteria 11814
151 Ga0111539_10018811 3300009094 Bacteria 8547
152 Ga0111539_10034476 3300009094 Bacteria 6137
153 Ga0111539_10081309 3300009094 Bacteria 3811
154 Ga0111539_10110500 3300009094 Bacteria 3226
155 Ga0111539_10135723 3300009094 Bacteria 2881
156 Ga0114129_10002782 3300009147 Bacteria 24386
157 Ga0114129_10176250 3300009147 Bacteria 2912
158 Ga0114129_10277776 3300009147 Bacteria 2239
159 Ga0114129_10327313 3300009147 Bacteria 2036
160 Ga0114129_12450518 3300009147 Bacteria 624
161 Ga0105242_11002314 3300009176 Unclassified 843
162 Ga0105248_10017398 3300009177 Bacteria 7925
163 Ga0105248_10093194 3300009177 Bacteria 3392
164 Ga0105237_10340043 3300009545 Unclassified 1505
165 Ga0105238_10612003 3300009551 Bacteria 1098
166 Ga0105238_10696137 3300009551 Unclassified 1028
167 Ga0105249_10126660 3300009553 Bacteria 2433
168 Ga0105249_10144334 3300009553 Bacteria 2285
169 Ga0105246_10267488 3300011119 Bacteria 1365
170 Ga0105246_10290803 3300011119 Bacteria 1315
171 Ga0105246_11559224 3300011119 Unclassified 623
172 Ga0157369_11717846 3300013105 Bacteria 638
173 Ga0157378_12378215 3300013297 Unclassified 582
174 Ga0163163_10147239 3300014325 Bacteria 2399
175 Ga0157380_10134179 3300014326 Bacteria 2116
176 Ga0157380_10182600 3300014326 Bacteria 1844
177 Ga0157377_10088093 3300014745 Bacteria 1828
178 Ga0157377_10261927 3300014745 Bacteria 1125
179 Ga0157379_10585499 3300014968 Bacteria 1040
180 Ga0157376_11041404 3300014969 Bacteria 842
181 Ga0163161_10467779 3300017792 Unclassified 1022
182 Ga0207697_10002285 3300025315 Bacteria 10015
183 Ga0207656_10168064 3300025321 Unclassified 1047
184 Ga0207682_10003545 3300025893 Bacteria 6752
185 Ga0207688_10000519 3300025901 Bacteria 18625
186 Ga0207688_10268593 3300025901 Bacteria 1037
187 Ga0207680_10349099 3300025903 Bacteria 1039
188 Ga0207680_10469080 3300025903 Bacteria 895
189 Ga0207645_10008795 3300025907 Bacteria 7021
190 Ga0207643_10022431 3300025908 Bacteria 3476
191 Ga0207643_10023307 3300025908 Bacteria 3413
192 Ga0207643_10078723 3300025908 Bacteria 1907
193 Ga0207662_10003436 3300025918 Bacteria 8150
194 Ga0207649_10752263 3300025920 Bacteria 758
195 Ga0207652_11180954 3300025921 Bacteria 667
196 Ga0207681_10112687 3300025923 Bacteria 1981
197 Ga0207694_10693492 3300025924 Unclassified 859
198 Ga0207694_11013928 3300025924 Bacteria 702
199 Ga0207659_10003582 3300025926 Bacteria 9349
200 Ga0207659_10111090 3300025926 Bacteria 2084
201 Ga0207659_10112491 3300025926 Bacteria 2072
202 Ga0207659_11320391 3300025926 Unclassified 619
203 Ga0207644_10029286 3300025931 Bacteria 3819
204 Ga0207706_10089285 3300025933 Bacteria 2710
205 Ga0207706_10303622 3300025933 Bacteria 1390
206 Ga0207706_10839106 3300025933 Bacteria 779
207 Ga0207670_10070561 3300025936 Bacteria 2414
208 Ga0207670_10129924 3300025936 Bacteria 1844
209 Ga0207670_10329365 3300025936 Bacteria 1204
210 Ga0207669_10139943 3300025937 Bacteria 1678
211 Ga0207669_10435143 3300025937 Bacteria 1036
212 Ga0207704_10101633 3300025938 Bacteria 1918
213 Ga0207691_10021552 3300025940 Bacteria 6084
214 Ga0207691_10946109 3300025940 Unclassified 720
215 Ga0207711_10338923 3300025941 Bacteria 1391
216 Ga0207711_10989726 3300025941 Bacteria 780
217 Ga0207689_10017949 3300025942 Bacteria 5974
218 Ga0207689_10028147 3300025942 Bacteria 4700
219 Ga0207689_10170903 3300025942 Bacteria 1792
220 Ga0207689_11278310 3300025942 Bacteria 617
221 Ga0207667_11360045 3300025949 Bacteria 685
222 Ga0207651_10102997 3300025960 Bacteria 2123
223 Ga0207651_10107490 3300025960 Bacteria 2085
224 Ga0207712_10066539 3300025961 Bacteria 2576
225 Ga0207668_10231145 3300025972 Bacteria 1491
226 Ga0207658_11074751 3300025986 Unclassified 735
227 Ga0207678_10136749 3300026067 Bacteria 2091
228 Ga0207708_10040401 3300026075 Bacteria 3557
229 Ga0207708_10143907 3300026075 Bacteria 1872
230 Ga0207708_10174933 3300026075 Bacteria 1702
231 Ga0207708_10571912 3300026075 Bacteria 955
232 Ga0207708_11290147 3300026075 Bacteria 639
233 Ga0207702_10006579 3300026078 Bacteria 9988
234 Ga0207641_10144236 3300026088 Bacteria 2151
235 Ga0207676_10179783 3300026095 Bacteria 1851
236 Ga0207676_12196210 3300026095 Unclassified 550
237 Ga0207674_10323133 3300026116 Bacteria 1492
238 Ga0207674_11588650 3300026116 Unclassified 623
239 Ga0207675_100022746 3300026118 Bacteria 5833
240 Ga0207675_100063365 3300026118 Bacteria 3454
241 Ga0207675_100324605 3300026118 Bacteria 1503
242 Ga0207675_100387028 3300026118 Bacteria 1376
243 Ga0207675_100623643 3300026118 Bacteria 1083
244 Ga0207675_101402091 3300026118 Unclassified 719
245 Ga0207683_10010039 3300026121 Bacteria 8079
246 Ga0207698_10265578 3300026142 Bacteria 1579
247 Ga0207428_10006851 3300027907 Bacteria 10445
248 Ga0207428_10029623 3300027907 Bacteria 4533
249 Ga0207428_10071730 3300027907 Bacteria 2719
250 Ga0207428_10097513 3300027907 Bacteria 2275
251 Ga0207428_10128083 3300027907 Bacteria 1943
252 Ga0268266_10009414 3300028379 Bacteria 8604
253 Ga0268266_10159698 3300028379 Bacteria 2038
254 Ga0268265_10007493 3300028380 Bacteria 7370
255 Ga0268265_10044915 3300028380 Bacteria 3293
256 Ga0268265_10172901 3300028380 Bacteria 1848
257 Ga0268265_10377969 3300028380 Bacteria 1302
258 Ga0268265_10421661 3300028380 Bacteria 1239
259 Ga0268265_10797108 3300028380 Bacteria 920
260 Ga0268264_10474784 3300028381 Bacteria 1215
261 Ga0265327_10013007 3300031251 Bacteria 5563
262 Ga0307405_10191110 3300031731 Bacteria 1479
263 Ga0307413_10812117 3300031824 Bacteria 787
264 Ga0307410_10077969 3300031852 Bacteria 2318
265 Ga0307412_10293524 3300031911 Bacteria 1282
266 Ga0307409_102147238 3300031995 Bacteria 588
267 Ga0307416_100142487 3300032002 Bacteria 2181
268 Ga0307416_101353185 3300032002 Unclassified 818
269 Ga0307411_10017605 3300032005 Bacteria 4078
270 Ga0307411_10696125 3300032005 Bacteria 885
271 Ga0373961_0019931 3300035241 Bacteria 1767
272 Ga0395900_1492546 3300037418 Unclassified 588
273 Ga0395898_0358199 3300037466 Bacteria 1391
274 Ga0395905_1437836 3300037471 Unclassified 594
275 Ga0395901_1128014 3300038443 Bacteria 753
276 Ga0439453_0014619 3300041408 Bacteria 1348
277 Ga0439457_108080 3300042014 Bacteria 652
278 Ga0439435_0061766 3300042436 Unclassified 1093
279 Ga0439444_0129672 3300042437 Bacteria 595
280 Ga0439464_0073286 3300042439 Unclassified 1015
281 Ga0439460_0018699 3300042461 Bacteria 1869
282 Ga0451576_0135718 3300045051 Bacteria 2565
283 Ga0451576_0647333 3300045051 Bacteria 1110
284 Ga0451576_1998422 3300045051 Unclassified 597
285 Ga0495603_0400956 3300046455 Bacteria 786
286 Ga0495658_0303046 3300046683 Bacteria 1011
287 Ga0496102_0003011 3300048905 Bacteria 14268
288 Ga0496103_0825207 3300048906 Bacteria 584
289 Ga0496106_0112284 3300048909 Bacteria 2123
290 Ga0496107_0747401 3300048910 Unclassified 718
291 Ga0496109_0344665 3300048912 Bacteria 1407
292 Ga0496111_0216134 3300048914 Bacteria 1424
293 Ga0501040_0848700 3300049576 Unclassified 661
294 Ga0501041_0162124 3300049577 Bacteria 1398
295 Ga0501041_0243219 3300049577 Unclassified 1131
296 Ga0501046_0966350 3300049580 Unclassified 592
297 Ga0501048_0214622 3300049582 Bacteria 1364
298 Ga0501071_0077020 3300049587 Bacteria 2436
299 Ga0501072_0032444 3300049588 Bacteria 4090
300 Ga0501072_1597117 3300049588 Unclassified 503
301 Ga0501075_0315958 3300049591 Bacteria 1190
302 Ga0501075_0881453 3300049591 Unclassified 681
303 Ga0501077_0503523 3300049593 Bacteria 776
304 Ga0501077_0531935 3300049593 Bacteria 754
305 Ga0501079_0083002 3300049741 Bacteria 2479
306 Ga0501079_0195855 3300049741 Bacteria 1577
307 Ga0501080_1473378 3300049742 Bacteria 579
308 Ga0501081_0142018 3300049743 Bacteria 1721
309 Ga0501081_0188295 3300049743 Unclassified 1494
310 Ga0501045_0025229 3300049824 Bacteria 4272
311 nmdc:mga0k408_12124_c1 3300050493 Bacteria 4708
312 nmdc:mga0k408_62980_c1 3300050493 Bacteria 2157
313 nmdc:mga06z11_142099_c1 3300050494 Unclassified 1358
314 nmdc:mga05p37_122578_c1 3300050507 Bacteria 3193
315 nmdc:mga05p37_2116513_c1 3300050507 Bacteria 526
316 nmdc:mga05p37_218594_c1 3300050507 Bacteria 1278
317 nmdc:mga05p37_27714_c1 3300050507 Bacteria 6901
318 nmdc:mga05p37_302506_c1 3300050507 Bacteria 1900
319 nmdc:mga05p37_54944_c1 3300050507 Bacteria 4898
320 nmdc:mga05p37_766358_c1 3300050507 Unclassified 1061
321 nmdc:mga09592_15370_c1 3300050508 Bacteria 6251
322 nmdc:mga09592_205976_c1 3300050508 Bacteria 1704
323 nmdc:mga09592_403395_c1 3300050508 Unclassified 1182
324 nmdc:mga0qj67_14749_c1 3300050509 Bacteria 5907
325 nmdc:mga0qj67_995136_c1 3300050509 Bacteria 658
326 nmdc:mga06r32_136305_c1 3300050510 Bacteria 2429
327 nmdc:mga06r32_1456635_c1 3300050510 Unclassified 626
328 nmdc:mga06r32_14934_c1 3300050510 Bacteria 7049
329 nmdc:mga06r32_41689_c1 3300050510 Bacteria 4363
330 nmdc:mga06r32_431357_c1 3300050510 Bacteria 1299
331 nmdc:mga08y16_1652737_c1 3300050511 Unclassified 597
332 nmdc:mga08y16_1727_c1 3300050511 Bacteria 22179
333 nmdc:mga08y16_633593_c1 3300050511 Unclassified 1075
334 nmdc:mga08y16_7009_c1 3300050511 Bacteria 11818
335 nmdc:mga08y16_97167_c1 3300050511 Bacteria 3067
336 nmdc:mga0n895_13079_c1 3300050512 Bacteria 7467
337 nmdc:mga0n895_157383_c1 3300050512 Bacteria 2303
338 nmdc:mga0n895_88750_c1 3300050512 Bacteria 3092
339 nmdc:mga0rr50_45907_c1 3300050513 Unclassified 3214
340 nmdc:mga0a205_1512674_c1 3300050515 Unclassified 519
341 nmdc:mga0a205_48232_c2 3300050515 Bacteria 1111
342 nmdc:mga0a205_4936_c1 3300050515 Bacteria 12001
343 nmdc:mga0a205_58283_c1 3300050515 Unclassified 3730
344 Ga0501084_0277698 3300054114 Bacteria 1415
345 Ga0501084_1115269 3300054114 Bacteria 662
346 Ga0114129_10036903
347 JGI24746J21847_1035622
348 JGI24034J26672_10117284
349 JGI25406J46586_10015899
350 Ga0065712_10067868
351 Ga0065715_10001253
352 Ga0065707_10004763
353 Ga0065707_10070239
354 Ga0065707_10114935
355 Ga0065707_10507042
356 Ga0070677_10000342
357 Ga0070677_10380021
358 Ga0068869_100062760
359 Ga0068869_100065361
360 Ga0068869_100254001
361 Ga0068869_100552797
362 Ga0070666_10143373
363 Ga0070682_101154460
364 Ga0070689_100069919
365 Ga0070689_100072841
366 Ga0070691_10035995
367 Ga0070661_100057149
368 Ga0070668_100127069
369 Ga0070668_100225676
370 Ga0070668_100419052
371 Ga0070669_100031868
372 Ga0070669_100071713
373 Ga0070669_100145847
374 Ga0070675_100008740
375 Ga0070675_100104682
376 Ga0070675_100106666
377 Ga0070675_100579558
378 Ga0070675_100752533
379 Ga0070671_100019271
380 Ga0070674_100100358
381 Ga0070674_101391421
382 Ga0070673_100418054
383 Ga0070688_100099289
384 Ga0070688_100135042
385 Ga0070688_100704388
386 Ga0070659_100360460
387 Ga0070659_100806966
388 Ga0070667_101684461
389 Ga0070700_100188608
390 Ga0070700_101839557
391 Ga0070694_100309183
392 Ga0070694_100589346
393 Ga0070694_101635244
394 Ga0070708_100165787
395 Ga0070678_100010244
396 Ga0070678_101774933
397 Ga0070662_100134952
398 Ga0070662_100165135
399 Ga0070662_100314183
400 Ga0068867_100100948
401 Ga0068867_100168399
402 Ga0068867_102226763
403 Ga0070698_100258961
404 Ga0070697_100762188
405 Ga0068853_102124942
406 Ga0070672_100005450
407 Ga0070686_100204516
408 Ga0070686_100920435
409 Ga0070686_100929301
410 Ga0070695_100466072
411 Ga0070696_100117443
412 Ga0070665_100076846
413 Ga0070665_100402809
414 Ga0070665_101379479
415 Ga0070704_100288354
416 Ga0070704_100698769
417 Ga0070704_100871158
418 Ga0070664_100001376
419 Ga0070664_100246080
420 Ga0068857_100094724
421 Ga0068857_100444170
422 Ga0068856_100372920
423 Ga0070702_100433739
424 Ga0068859_100009546
425 Ga0068859_100174245
426 Ga0068859_100220140
427 Ga0068859_100530486
428 Ga0068859_101255573
429 Ga0068864_100206762
430 Ga0068864_100392087
431 Ga0068864_101431671
432 Ga0068861_100045450
433 Ga0068861_100333972
434 Ga0068861_100524030
435 Ga0068861_100641058
436 Ga0068861_100935616
437 Ga0068851_10230743
438 Ga0068870_10003188
439 Ga0068870_10028154
440 Ga0068870_10086730
441 Ga0068860_100060610
442 Ga0068862_100001770
443 Ga0068862_100069166
444 Ga0068862_100206253
445 Ga0068862_100389736
446 Ga0068862_100556226
447 Ga0068862_100568043
448 Ga0081455_10107807
449 Ga0081539_10000024
450 Ga0081539_10002277
451 Ga0075432_10025289
452 Ga0075367_10141998
453 Ga0075366_10002729
454 Ga0075366_10539095
455 Ga0068871_100362631
456 Ga0075428_100019373
457 Ga0075428_100025258
458 Ga0075428_100087790
459 Ga0075428_100369898
460 Ga0075428_100453656
461 Ga0075428_100463796
462 Ga0075430_100017988
463 Ga0075430_100395593
464 Ga0075430_100556440
465 Ga0075431_100008017
466 Ga0075431_100017633
467 Ga0075431_100050107
468 Ga0075431_100086286
469 Ga0075431_100419696
470 Ga0075431_100597909
471 Ga0075431_101601251
472 Ga0075433_10021866
473 Ga0075433_10030758
474 Ga0075433_10358596
475 Ga0075434_100000561
476 Ga0075434_100023925
477 Ga0075434_100097428
478 Ga0075434_100440413
479 Ga0075429_100007885
480 Ga0075429_100020919
481 Ga0075429_100086441
482 Ga0075429_100149803
483 Ga0075429_101442943
484 Ga0068865_100886622
485 Ga0097620_100009546
486 Ga0097620_100174247
487 Ga0097620_100220132
488 Ga0097620_100530460
489 Ga0097620_101255464
490 Ga0075435_100001244
491 Ga0075435_100805867
492 Ga0105244_10237977
493 Ga0111539_10004703
494 Ga0111539_10008615
495 Ga0111539_10010242
496 Ga0111539_10018811
497 Ga0111539_10034476
498 Ga0111539_10081309
499 Ga0111539_10110500
500 Ga0111539_10135723
501 Ga0114129_10002782
502 Ga0114129_10176250
503 Ga0114129_10277776
504 Ga0114129_10327313
505 Ga0114129_12450518
506 Ga0105242_11002314
507 Ga0105248_10017398
508 Ga0105248_10093194
509 Ga0105237_10340043
510 Ga0105238_10612003
511 Ga0105238_10696137
512 Ga0105249_10126660
513 Ga0105249_10144334
514 Ga0105246_10267488
515 Ga0105246_10290803
516 Ga0105246_11559224
517 Ga0157369_11717846
518 Ga0157378_12378215
519 Ga0163163_10147239
520 Ga0157380_10134179
521 Ga0157380_10182600
522 Ga0157377_10088093
523 Ga0157377_10261927
524 Ga0157379_10585499
525 Ga0157376_11041404
526 Ga0163161_10467779
527 Ga0207697_10002285
528 Ga0207656_10168064
529 Ga0207682_10003545
530 Ga0207688_10000519
531 Ga0207688_10268593
532 Ga0207680_10349099
533 Ga0207680_10469080
534 Ga0207645_10008795
535 Ga0207643_10022431
536 Ga0207643_10023307
537 Ga0207643_10078723
538 Ga0207662_10003436
539 Ga0207649_10752263
540 Ga0207652_11180954
541 Ga0207681_10112687
542 Ga0207694_10693492
543 Ga0207694_11013928
544 Ga0207659_10003582
545 Ga0207659_10111090
546 Ga0207659_10112491
547 Ga0207659_11320391
548 Ga0207644_10029286
549 Ga0207706_10089285
550 Ga0207706_10303622
551 Ga0207706_10839106
552 Ga0207670_10070561
553 Ga0207670_10129924
554 Ga0207670_10329365
555 Ga0207669_10139943
556 Ga0207669_10435143
557 Ga0207704_10101633
558 Ga0207691_10021552
559 Ga0207691_10946109
560 Ga0207711_10338923
561 Ga0207711_10989726
562 Ga0207689_10017949
563 Ga0207689_10028147
564 Ga0207689_10170903
565 Ga0207689_11278310
566 Ga0207667_11360045
567 Ga0207651_10102997
568 Ga0207651_10107490
569 Ga0207712_10066539
570 Ga0207668_10231145
571 Ga0207658_11074751
572 Ga0207678_10136749
573 Ga0207708_10040401
574 Ga0207708_10143907
575 Ga0207708_10174933
576 Ga0207708_10571912
577 Ga0207708_11290147
578 Ga0207702_10006579
579 Ga0207641_10144236
580 Ga0207676_10179783
581 Ga0207676_12196210
582 Ga0207674_10323133
583 Ga0207674_11588650
584 Ga0207675_100022746
585 Ga0207675_100063365
586 Ga0207675_100324605
587 Ga0207675_100387028
588 Ga0207675_100623643
589 Ga0207675_101402091
590 Ga0207683_10010039
591 Ga0207698_10265578
592 Ga0207428_10006851
593 Ga0207428_10029623
594 Ga0207428_10071730
595 Ga0207428_10097513
596 Ga0207428_10128083
597 Ga0268266_10009414
598 Ga0268266_10159698
599 Ga0268265_10007493
600 Ga0268265_10044915
601 Ga0268265_10172901
602 Ga0268265_10377969
603 Ga0268265_10421661
604 Ga0268265_10797108
605 Ga0268264_10474784
606 Ga0265327_10013007
607 Ga0307405_10191110
608 Ga0307413_10812117
609 Ga0307410_10077969
610 Ga0307412_10293524
611 Ga0307409_102147238
612 Ga0307416_100142487
613 Ga0307416_101353185
614 Ga0307411_10017605
615 Ga0307411_10696125
616 Ga0373961_0019931
617 Ga0395900_1492546
618 Ga0395898_0358199
619 Ga0395905_1437836
620 Ga0395901_1128014
621 Ga0439453_0014619
622 Ga0439457_108080
623 Ga0439435_0061766
624 Ga0439444_0129672
625 Ga0439464_0073286
626 Ga0439460_0018699
627 Ga0451576_0135718
628 Ga0451576_0647333
629 Ga0451576_1998422
630 Ga0495603_0400956
631 Ga0495658_0303046
632 Ga0496102_0003011
633 Ga0496103_0825207
634 Ga0496106_0112284
635 Ga0496107_0747401
636 Ga0496109_0344665
637 Ga0496111_0216134
638 Ga0501040_0848700
639 Ga0501041_0162124
640 Ga0501041_0243219
641 Ga0501046_0966350
642 Ga0501048_0214622
643 Ga0501071_0077020
644 Ga0501072_0032444
645 Ga0501072_1597117
646 Ga0501075_0315958
647 Ga0501075_0881453
648 Ga0501077_0503523
649 Ga0501077_0531935
650 Ga0501079_0083002
651 Ga0501079_0195855
652 Ga0501080_1473378
653 Ga0501081_0142018
654 Ga0501081_0188295
655 Ga0501045_0025229
656 nmdc:mga0k408_12124_c1
657 nmdc:mga0k408_62980_c1
658 nmdc:mga06z11_142099_c1
659 nmdc:mga05p37_122578_c1
660 nmdc:mga05p37_2116513_c1
661 nmdc:mga05p37_218594_c1
662 nmdc:mga05p37_27714_c1
663 nmdc:mga05p37_302506_c1
664 nmdc:mga05p37_54944_c1
665 nmdc:mga05p37_766358_c1
666 nmdc:mga09592_15370_c1
667 nmdc:mga09592_205976_c1
668 nmdc:mga09592_403395_c1
669 nmdc:mga0qj67_14749_c1
670 nmdc:mga0qj67_995136_c1
671 nmdc:mga06r32_136305_c1
672 nmdc:mga06r32_1456635_c1
673 nmdc:mga06r32_14934_c1
674 nmdc:mga06r32_41689_c1
675 nmdc:mga06r32_431357_c1
676 nmdc:mga08y16_1652737_c1
677 nmdc:mga08y16_1727_c1
678 nmdc:mga08y16_633593_c1
679 nmdc:mga08y16_7009_c1
680 nmdc:mga08y16_97167_c1
681 nmdc:mga0n895_13079_c1
682 nmdc:mga0n895_157383_c1
683 nmdc:mga0n895_88750_c1
684 nmdc:mga0rr50_45907_c1
685 nmdc:mga0a205_1512674_c1
686 nmdc:mga0a205_48232_c2
687 nmdc:mga0a205_4936_c1
688 nmdc:mga0a205_58283_c1
689 Ga0501084_0277698
690 Ga0501084_1115269

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13508

Acetyltransf_7

Acetyltransferase (GNAT) domain

52

131

0.87

PF00583

Acetyltransf_1

Acetyltransferase (GNAT) family

15

129

0.85

PF13673

Acetyltransf_10

Acetyltransferase (GNAT) domain

47

148

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
4my0-assembly1.cif.gz_C crystal structure of gcn5-related n-acetyltransferase from kribbella flavida 0.8699 2 111
3b8g-assembly1.cif.gz_A crysta structure of n-acetylglutamate synthase from neisseria gonorrhoeae complexed with coenzyme a and n-acetyl-glutamate 0.8609 2 144
6yca-assembly1.cif.gz_A crystal structure of eis1 from mycobacterium abscessus 0.8574 1 109
6yca-assembly1.cif.gz_E crystal structure of eis1 from mycobacterium abscessus 0.8543 2 109
6yca-assembly1.cif.gz_F crystal structure of eis1 from mycobacterium abscessus 0.8543 2 109
ID Description Score Start End Superfamily
af_O13738_1_94_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9203 35 106 3.40.630.30
1vkcB01 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9198 35 110 3.40.630.30
af_A0A286YBP0_57_178_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8877 35 118 3.40.630.30
af_A4IGD2_129_261_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8862 35 118 3.40.630.30
af_E7F6N3_74_217_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8766 37 113 3.40.630.30
ID Description Score Start End GO Terms
AF-A0A2V7R536-F1-model_v4 GNAT family N-acetyltransferase 0.9915 2 108 GO:0016747
AF-W0RFD7-F1-model_v4 GCN5-related N-acetyltransferase 0.9861 2 142 GO:0016747
AF-A0A7C8EQ95-F1-model_v4 GNAT family N-acetyltransferase 0.9836 2 146 GO:0008080
AF-A0A2U3CDZ1-F1-model_v4 N-acetyltransferase domain-containing protein 0.9835 1 141 GO:0016747
AF-A0A0N8PRW3-F1-model_v4 Uncharacterized protein 0.981 5 122 GO:0016747

Map