F416129

General Info

Members Datasets Scaffolds Average Seq Length
344 239 688 168

Family's Representative Sequence

Representative Sequence 3300048919|Ga0496116_0036408|Ga0496116_0036408_2417_2983
Length 188
Sequence MNSVTYKQLFQGGITIMAQERTGVATLKGNPITLIGPELKAGDKAPAFTLNKSLTEAATLSDFAGKVKLISVVPSIDTGVCDAQTRKFNEAAAALGDNVVVLTVSVDTPFAQARWCAAADIDRVVMLSDYKENSFGEAYGVLIKEFALDMRAIFVVDANDTIQYVEYLSEMAEHPNYENAIQAAKALV

Samples

Sample ID Description Type Environment
1 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
2 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
3 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
6 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
7 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
8 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
9 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
10 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
11 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
12 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
17 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
18 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
19 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
20 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
21 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
22 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
23 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
24 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
25 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
26 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
27 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
28 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
29 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
30 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
31 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
32 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
33 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
34 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
35 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
36 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
37 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
38 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
39 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
40 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
47 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
48 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
50 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
51 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
52 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
53 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
54 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
55 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
56 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
57 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
58 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
59 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
60 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
61 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
62 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
63 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
64 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
65 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
66 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
67 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
68 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
69 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
70 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
71 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
72 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
73 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
74 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
75 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
76 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
77 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
78 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
79 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
80 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
81 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
82 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
83 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
84 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
85 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
86 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
87 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
88 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
89 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
90 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
91 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
92 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
93 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
94 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
95 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
96 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
97 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
98 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
99 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
100 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
101 3300049131 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
102 3300049132 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
103 3300049133 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
104 3300049160 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
105 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
106 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
107 3300049163 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
108 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
109 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
110 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
111 3300049529 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
112 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
113 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
114 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
115 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
116 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
117 3300049535 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
118 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
119 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
120 3300049538 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
121 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
122 3300049540 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
123 3300049542 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
124 3300049544 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
125 3300049546 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_B_4_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
126 3300049547 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_A_5_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
127 3300049548 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
128 3300049549 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
129 3300049550 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
130 3300049551 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
131 3300049552 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
132 3300049553 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_A_7_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
133 3300049554 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_A_7_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
134 3300049556 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
135 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
136 3300049655 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought Metagenome Rhizosphere
137 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
138 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
139 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
140 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
141 2511231119 Bacillus velezensis CAU B946 Isolate Rhizosphere
142 2524023129 Paenibacillus pinihumi DSM 23905 Isolate Rhizosphere
143 2540341094 Bacillus subtilis XF-1 Isolate Rhizosphere
144 2551306519 Bacillus sp. WBUNB004 Isolate Rhizosphere
145 2554235283 Bacillus safensis VK Isolate Rhizosphere
146 2593339131 Bacillus sp. UNCCL81 Isolate Unclassified
147 2593339198 Paenibacillus sp. UNCCL117 Isolate Unclassified
148 2630968484 Bacillus methylotrophicus KACC 13105 Isolate Rhizosphere
149 2643221731 Bacillus sp. Root147 Isolate Unclassified
150 2643221732 Bacillus sp. Root239 Isolate Unclassified
151 2643221735 Bacillus sp. Root920 Isolate Unclassified
152 2671180330 Peribacillus simplex SH-B26 Isolate Unclassified
153 2671180844 Bacillus amyloliquefaciens Bs006 Isolate Unclassified
154 2684622632 Bacillus cereus 905 Isolate Unclassified
155 2684623153 Bacillus pumilus SH-B9 Isolate Unclassified
156 2687453109 Bacillus pumilus SH-B11 Isolate Unclassified
157 2695420987 Bacillus thuringiensis KNU-07 Isolate Unclassified
158 2703719227 Bacillus mycoides GOE6 Isolate Rhizosphere
159 2716884898 Bacillus methylotrophicus FKM10 Isolate Rhizosphere
160 2718218445 Bacillus sp. B25(2016b) Isolate Rhizosphere
161 2738541295 Bacillus sp. OK085 Isolate Unclassified
162 2738543010 Bacillus sp. YR335 Isolate Unclassified
163 2738543017 Bacillus sp. OV186 Isolate Unclassified
164 2757320391 Bacillus sp. NFR08 Isolate Rhizoplane
165 2775507177 Bacillus sp. AFS055030 Isolate Unclassified
166 2775507192 Bacillus sp. AFS041924 Isolate Unclassified
167 2791355222 Paenibacillus oryzae 1DrF-4 Isolate Unclassified
168 2808606364 Bacillus sp. SLBN-3 Isolate Unclassified
169 2808606399 Bacillus sp. SJZ110 Isolate Rhizosphere
170 2811994870 Bacillus sp. JB4 Isolate Unclassified
171 2816332186 Peribacillus frigoritolerans 3612 Isolate Unclassified
172 2818991441 Niallia circulans 3243 Isolate Rhizosphere
173 2818991459 Paenibacillus sp. 597 Isolate Unclassified
174 2818991465 Priestia megaterium 3291 Isolate Rhizosphere
175 2818991468 Bacillus safensis 3300 Isolate Rhizosphere
176 2823526263 Bacillus altitudinis P-10 Isolate Unclassified
177 2831905167 Ammoniphilus oxalaticus RAOx-1 Isolate Rhizosphere
178 2842682962 Bacillus sp. R-72492 Isolate Unclassified
179 2842882022 Bacillus sp. R-71893 Isolate Unclassified
180 2849139964 Bacillus sp. R-71875 Isolate Unclassified
181 2852673933 Sporosarcina sp. JAI121 Isolate Rhizosphere
182 2857472729 Cohnella sp. R-74144 Isolate Unclassified
183 2857581216 Bacillus sp. R-71922 Isolate Unclassified
184 2857586860 Bacillus sp. R-71935 Isolate Unclassified
185 2857604169 Domibacillus sp. R-71921 Isolate Unclassified
186 2857609550 Domibacillus sp. R-71929 Isolate Unclassified
187 2865002811 Paenibacillus sp. R-74131 Isolate Unclassified
188 2888578766 Paenibacillus lycopersici 12200R-189 Isolate Rhizosphere
189 2889049205 Paenibacillus rhizovicinus 14171R-81 Isolate Rhizosphere
190 2904524088 Priestia megaterium 1428 Isolate Rhizosphere
191 2904560550 Bacillus velezensis 1780 Isolate Rhizosphere
192 2908665501 Bacillus pumilus 1391 Isolate Rhizosphere
193 2919093281 Bacillus safensis 1383 Isolate Rhizosphere
194 2919143609 Priestia megaterium 1751 Isolate Rhizosphere
195 2919414237 Neobacillus niacini 3240 Isolate Rhizosphere
196 2919425241 Bacillus sp. 3255 Isolate Rhizosphere
197 2919517244 Priestia aryabhattai 3820 Isolate Unclassified
198 2919720352 Priestia megaterium 4340 Isolate Unclassified
199 2919726948 Bacillus pumilus 4489 Isolate Unclassified
200 2928093941 Priestia aryabhattai 1389 Isolate Rhizosphere
201 2928510474 Sporosarcina psychrophila 1288 Isolate Rhizosphere
202 2929004312 Priestia megaterium 1104 Isolate Unclassified
203 2929206907 Paenibacillus sp. R-74146 Hybrid assembly Isolate Unclassified
204 2929233124 Bacillus sp. R-74298 Hybrid assembly Isolate Unclassified
205 2936340661 Gottfriedia acidiceleris 1-17 Isolate Rhizosphere
206 2947426588 Bacillus sp. RZ2MS9 Isolate Rhizosphere
207 2954773129 Bacillus sp. TBS-096 Isolate Rhizosphere
208 2956897341 Ectobacillus funiculus W18-2 Isolate Rhizosphere
209 2960319331 Priestia megaterium AFS057444 Isolate Unclassified
210 2960375949 Priestia megaterium AFS067084 Isolate Unclassified
211 2964375228 Anaerobacillus alkaliphilus B16-10 Isolate Rhizosphere
212 2965761152 Bacillus sp. COPE52 Isolate Unclassified
213 2969141011 Bacillus velezensis MH25 Isolate Unclassified
214 2971893375 Bacillus sp. HNA3 Isolate Rhizosphere
215 2977254563 Bacillus sp. SORGH_AS 510 Isolate Unclassified
216 2979083700 Bacillus toyonensis SORGH_AS 407 Isolate Unclassified
217 2990275345 Bacillus sp. SLBN-46 Isolate Unclassified
218 3001267043 Bacillus sp. FJAT-49870 Isolate Rhizosphere
219 3001272096 Lederbergia citrisecunda FJAT-49732 Isolate Rhizosphere
220 3001892409 Neobacillus rhizophilus FJAT-49825 Isolate Rhizosphere
221 3006826541 Bacillus haikouensis CrR16 Isolate Unclassified
222 3006858327 Bacillus paralicheniformis SUBG0010 Isolate Unclassified
223 3006879489 Bacillus atrophaeus UCMB-5137 Isolate Rhizosphere
224 3006973921 Bacillus sp. FJAT-49736 Isolate Rhizosphere
225 3006978542 Bacillus sp. FJAT-49705 Isolate Rhizosphere
226 3006988479 Bacillus sp. FJAT-49711 Isolate Rhizosphere
227 8022621104 Bacillus sp. PIC28 Isolate Rhizosphere
228 8022792930 Bacillus sp. Xin Isolate Rhizosphere
229 8022893055 Bacillus aryabhattai AFS007213 Isolate Unclassified
230 8022914991 Bacillus aryabhattai SQU-R12 Isolate Unclassified
231 8022948649 Bacillus endophyticus FH5 Isolate Rhizosphere
232 8023438354 Bacillus sp. BH2 Isolate Unclassified
233 8052174270 Bacillus velezensis CH13 Isolate Rhizosphere
234 8054280661 Metabacillus kandeliae GX 13764 Isolate Rhizosphere
235 8054795415 Paenibacillus periandrae PM10 Isolate Nodule
236 8057582654 Bacillus arachidis YX15 Isolate Rhizosphere
237 8057632132 Cytobacillus kochii RZ2 Isolate Rhizosphere
238 8057733483 Paenibacillus apiarius MW-14 Isolate Rhizosphere
239 8057977335 Paenibacillus oenotherae DT7-4 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 40.99
Metatranscriptomes 29.36
Isolates 29.65

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.01
Nodule 0.29
Rhizoplane 4.94
Rhizosphere 63.08
Stem 0
Stem Tuber 0
Unclassified 1.16

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496116_0036408 3300048919 Bacteria 3444
2 JGI25151J46595_10000046 3300003187 Bacteria 168647
3 JGI25151J46595_10001987 3300003187 Bacteria 12821
4 JGI25151J46595_10002239 3300003187 Bacteria 11899
5 JGI25151J46595_10006112 3300003187 Bacteria 6113
6 JGI25151J46595_10041143 3300003187 Bacteria 1684
7 rootH1_10001445 3300003316 Bacteria 56583
8 rootH2_10021470 3300003320 Bacteria 7146
9 rootL2_10013974 3300003322 Bacteria 148551
10 rootH1_10216221 3300003323 Bacteria 5115
11 Ga0006562J51391_1002637 3300003578 Bacteria 17100
12 Ga0055532_1000100 3300003758 Bacteria 92894
13 Ga0055532_1004122 3300003758 Bacteria 2279
14 Ga0055535_1001771 3300003761 Bacteria 9555
15 Ga0055528_1003345 3300003790 Bacteria 8118
16 Ga0055541_1000360 3300003841 Bacteria 14159
17 Ga0065704_10664407 3300005289 Bacteria 576
18 Ga0070670_100138519 3300005331 Bacteria 2104
19 Ga0070669_100553708 3300005353 Bacteria 959
20 Ga0070671_100175798 3300005355 Bacteria 1812
21 Ga0070707_100708841 3300005468 Unclassified 969
22 Ga0105251_10253651 3300009011 Bacteria 793
23 Ga0105245_10294715 3300009098 Bacteria 1590
24 Ga0105247_10090485 3300009101 Bacteria 1941
25 Ga0105243_10010115 3300009148 Bacteria 7177
26 Ga0105242_10243564 3300009176 Bacteria 1617
27 Ga0105249_10143785 3300009553 Bacteria 2290
28 Ga0105239_10102719 3300010375 Bacteria 3163
29 Ga0105246_10010651 3300011119 Bacteria 5696
30 Ga0157371_10002617 3300013102 Bacteria 17082
31 Ga0157374_10138438 3300013296 Bacteria 2361
32 Ga0157378_10017869 3300013297 Bacteria 6225
33 Ga0157372_10067420 3300013307 Bacteria 4021
34 Ga0157377_10005932 3300014745 Bacteria 5782
35 Ga0157376_10250766 3300014969 Bacteria 1653
36 Ga0209566_100069 3300025225 Bacteria 177387
37 Ga0209566_100132 3300025225 Bacteria 91879
38 Ga0209147_100058 3300025229 Bacteria 252750
39 Ga0209147_100262 3300025229 Bacteria 48219
40 Ga0209258_101413 3300025242 Bacteria 8556
41 Ga0209673_1045338 3300025273 Bacteria 1209
42 Ga0209130_1020806 3300025284 Bacteria 1493
43 Ga0209675_1004083 3300025291 Bacteria 6643
44 Ga0209676_1000709 3300025292 Bacteria 46167
45 Ga0209676_1013193 3300025292 Bacteria 3193
46 Ga0209025_1000001 3300025294 Bacteria 1888151
47 Ga0209025_1000273 3300025294 Bacteria 119753
48 Ga0209025_1000347 3300025294 Bacteria 100528
49 Ga0209025_1001181 3300025294 Bacteria 36965
50 Ga0209025_1010504 3300025294 Bacteria 6264
51 Ga0209025_1014645 3300025294 Bacteria 4802
52 Ga0209025_1030474 3300025294 Bacteria 2582
53 Ga0209025_1034337 3300025294 Bacteria 2318
54 Ga0209025_1088453 3300025294 Bacteria 1022
55 Ga0209025_1102179 3300025294 Bacteria 904
56 Ga0207426_1020725 3300025302 Bacteria 2281
57 Ga0207696_1019415 3300025711 Bacteria 2215
58 Ga0207655_1033214 3300025728 Bacteria 2343
59 Ga0207713_1000727 3300025735 Bacteria 30847
60 Ga0207710_10511467 3300025900 Bacteria 624
61 Ga0207686_10272104 3300025934 Bacteria 1246
62 Ga0207709_10004671 3300025935 Bacteria 7879
63 Ga0210000_1029999 3300027462 Bacteria 848
64 Ga0209974_10150704 3300027876 Bacteria 839
65 Ga0268266_10608399 3300028379 Bacteria 1050
66 Ga0265338_10229599 3300028800 Bacteria 1381
67 Ga0265316_10000109 3300031344 Bacteria 88245
68 Ga0307408_100077460 3300031548 Bacteria 2475
69 Ga0307408_100554774 3300031548 Bacteria 1014
70 Ga0307408_100558113 3300031548 Bacteria 1011
71 Ga0307408_101013127 3300031548 Bacteria 766
72 Ga0307413_10370055 3300031824 Bacteria 1113
73 Ga0307410_11046170 3300031852 Bacteria 706
74 Ga0307412_10755548 3300031911 Bacteria 840
75 Ga0307409_100012064 3300031995 Bacteria 5487
76 Ga0307416_100035216 3300032002 Bacteria 3820
77 Ga0307416_100287568 3300032002 Bacteria 1625
78 Ga0316583_10172488 3300032133 Unclassified 753
79 Ga0316593_10033216 3300032168 Unclassified 1688
80 Ga0395900_0361136 3300037418 Bacteria 1424
81 Ga0439449_0018051 3300042007 Bacteria 2648
82 Ga0439462_0007370 3300042015 Bacteria 2754
83 Ga0466972_0261048 3300044658 Bacteria 810
84 Ga0466970_0212162 3300044765 Bacteria 1079
85 Ga0466957_0088467 3300044842 Bacteria 1938
86 Ga0495603_0078940 3300046455 Bacteria 1929
87 Ga0495603_0383284 3300046455 Bacteria 806
88 Ga0495605_0123245 3300046474 Bacteria 1174
89 Ga0495585_0076495 3300046492 Bacteria 1818
90 Ga0495606_0277955 3300046507 Bacteria 917
91 Ga0495654_0062268 3300046530 Bacteria 1789
92 Ga0495622_0048269 3300046557 Bacteria 1978
93 Ga0495622_0148382 3300046557 Bacteria 1062
94 Ga0495661_0094366 3300046665 Bacteria 1696
95 Ga0495661_0100393 3300046665 Bacteria 1630
96 Ga0495661_0247639 3300046665 Bacteria 911
97 Ga0495588_0453296 3300046674 Bacteria 673
98 Ga0495649_0305716 3300046694 Bacteria 809
99 Ga0495649_0349179 3300046694 Bacteria 748
100 Ga0495660_0348481 3300046810 Bacteria 659
101 Ga0496101_0001975 3300048904 Bacteria 12434
102 Ga0496102_0011042 3300048905 Bacteria 7781
103 Ga0496102_0014519 3300048905 Bacteria 6843
104 Ga0496103_0031932 3300048906 Bacteria 3212
105 Ga0496104_0008096 3300048907 Bacteria 9325
106 Ga0496105_0000266 3300048908 Bacteria 34749
107 Ga0496106_0000224 3300048909 Bacteria 39551
108 Ga0496107_0004486 3300048910 Bacteria 9469
109 Ga0496107_0922231 3300048910 Bacteria 636
110 Ga0496108_0001891 3300048911 Bacteria 16781
111 Ga0496109_0000475 3300048912 Bacteria 34137
112 Ga0496110_0002503 3300048913 Bacteria 13793
113 Ga0496110_0005975 3300048913 Bacteria 9584
114 Ga0496111_0001047 3300048914 Bacteria 15233
115 Ga0496111_0079860 3300048914 Bacteria 2387
116 Ga0496112_0005572 3300048915 Bacteria 10916
117 Ga0496117_0009983 3300048920 Bacteria 8727
118 Ga0496118_0115025 3300048921 Bacteria 1772
119 Ga0496119_0005894 3300048922 Bacteria 11563
120 Ga0496120_0298460 3300048923 Bacteria 739
121 Ga0496121_0563362 3300048924 Bacteria 710
122 Ga0496121_0586929 3300048924 Bacteria 690
123 Ga0496122_0014515 3300048925 Bacteria 7604
124 Ga0496122_0015038 3300048925 Bacteria 7429
125 Ga0496122_0020758 3300048925 Bacteria 5913
126 Ga0496122_0171899 3300048925 Bacteria 1305
127 Ga0496122_0225939 3300048925 Bacteria 1069
128 Ga0496123_0004702 3300048926 Bacteria 14132
129 Ga0496123_0343132 3300048926 Bacteria 697
130 Ga0496124_0006304 3300048927 Bacteria 12961
131 Ga0496124_0222583 3300048927 Bacteria 1418
132 Ga0496125_0002634 3300048928 Bacteria 22980
133 Ga0496125_0022915 3300048928 Bacteria 5785
134 Ga0496125_0296500 3300048928 Bacteria 993
135 Ga0496126_0075778 3300048929 Bacteria 2985
136 Ga0496126_0212569 3300048929 Bacteria 1628
137 Ga0501306_010214 3300049127 Bacteria 1178
138 Ga0501306_050923 3300049127 Bacteria 664
139 Ga0501308_059013 3300049128 Bacteria 576
140 Ga0501309_001906 3300049129 Bacteria 2156
141 Ga0501309_015172 3300049129 Bacteria 1040
142 Ga0501309_026160 3300049129 Bacteria 841
143 Ga0501309_092409 3300049129 Bacteria 517
144 Ga0501310_036906 3300049130 Bacteria 668
145 Ga0501341_02469 3300049131 Bacteria 1000
146 Ga0501341_07645 3300049131 Bacteria 679
147 Ga0501343_001661 3300049132 Bacteria 1525
148 Ga0501343_014748 3300049132 Bacteria 661
149 Ga0501343_019689 3300049132 Bacteria 592
150 Ga0501344_02297 3300049133 Bacteria 981
151 Ga0501344_03208 3300049133 Bacteria 865
152 Ga0501304_019198 3300049160 Bacteria 665
153 Ga0501304_034830 3300049160 Bacteria 547
154 Ga0501305_004385 3300049161 Bacteria 1656
155 Ga0501305_033420 3300049161 Bacteria 811
156 Ga0501305_049208 3300049161 Bacteria 704
157 Ga0501305_087682 3300049161 Bacteria 566
158 Ga0501305_094611 3300049161 Bacteria 550
159 Ga0501305_100181 3300049161 Bacteria 539
160 Ga0501307_059485 3300049162 Bacteria 590
161 Ga0501342_01815 3300049163 Bacteria 698
162 Ga0501342_03020 3300049163 Bacteria 586
163 Ga0501342_04915 3300049163 Bacteria 500
164 Ga0501292_117315 3300049515 Bacteria 540
165 Ga0501311_020898 3300049527 Bacteria 889
166 Ga0501311_029529 3300049527 Bacteria 787
167 Ga0501311_032336 3300049527 Bacteria 763
168 Ga0501312_005997 3300049528 Bacteria 1501
169 Ga0501312_026600 3300049528 Bacteria 888
170 Ga0501312_027856 3300049528 Bacteria 873
171 Ga0501312_046813 3300049528 Bacteria 720
172 Ga0501312_048486 3300049528 Bacteria 711
173 Ga0501312_093608 3300049528 Bacteria 557
174 Ga0501312_099541 3300049528 Bacteria 544
175 Ga0501312_099567 3300049528 Bacteria 544
176 Ga0501312_107053 3300049528 Bacteria 530
177 Ga0501313_005224 3300049529 Bacteria 1363
178 Ga0501313_010059 3300049529 Bacteria 1072
179 Ga0501313_020771 3300049529 Bacteria 811
180 Ga0501313_041744 3300049529 Bacteria 618
181 Ga0501313_050038 3300049529 Unclassified 576
182 Ga0501313_059399 3300049529 Bacteria 540
183 Ga0501314_036130 3300049530 Bacteria 564
184 Ga0501314_039275 3300049530 Bacteria 548
185 Ga0501315_003926 3300049531 Bacteria 1520
186 Ga0501315_026654 3300049531 Bacteria 811
187 Ga0501315_074913 3300049531 Bacteria 567
188 Ga0501315_083472 3300049531 Bacteria 545
189 Ga0501315_095359 3300049531 Bacteria 520
190 Ga0501316_002229 3300049532 Bacteria 1772
191 Ga0501316_002762 3300049532 Bacteria 1652
192 Ga0501316_025203 3300049532 Bacteria 772
193 Ga0501316_036051 3300049532 Bacteria 677
194 Ga0501316_074674 3300049532 Bacteria 518
195 Ga0501317_003282 3300049533 Bacteria 1602
196 Ga0501317_005750 3300049533 Bacteria 1340
197 Ga0501317_036840 3300049533 Bacteria 733
198 Ga0501318_018337 3300049534 Bacteria 863
199 Ga0501318_066783 3300049534 Bacteria 562
200 Ga0501318_071905 3300049534 Bacteria 548
201 Ga0501319_009937 3300049535 Bacteria 751
202 Ga0501319_030317 3300049535 Bacteria 518
203 Ga0501320_026582 3300049536 Bacteria 700
204 Ga0501320_061812 3300049536 Bacteria 528
205 Ga0501321_002169 3300049537 Bacteria 1667
206 Ga0501321_017296 3300049537 Bacteria 866
207 Ga0501321_040763 3300049537 Bacteria 652
208 Ga0501321_067193 3300049537 Bacteria 552
209 Ga0501321_077010 3300049537 Bacteria 527
210 Ga0501322_016221 3300049538 Bacteria 622
211 Ga0501323_001433 3300049539 Bacteria 2114
212 Ga0501323_041724 3300049539 Bacteria 675
213 Ga0501323_058179 3300049539 Bacteria 599
214 Ga0501324_007348 3300049540 Bacteria 949
215 Ga0501326_06933 3300049542 Bacteria 639
216 Ga0501328_08513 3300049544 Bacteria 559
217 Ga0501330_006853 3300049546 Bacteria 754
218 Ga0501331_07460 3300049547 Bacteria 651
219 Ga0501332_04404 3300049548 Bacteria 838
220 Ga0501332_16103 3300049548 Bacteria 535
221 Ga0501333_014022 3300049549 Bacteria 598
222 Ga0501334_07611 3300049550 Bacteria 749
223 Ga0501335_001530 3300049551 Bacteria 1783
224 Ga0501335_016575 3300049551 Bacteria 760
225 Ga0501335_030870 3300049551 Bacteria 605
226 Ga0501335_033345 3300049551 Bacteria 588
227 Ga0501335_043718 3300049551 Bacteria 533
228 Ga0501335_045233 3300049551 Bacteria 527
229 Ga0501336_002391 3300049552 Bacteria 1201
230 Ga0501336_025331 3300049552 Bacteria 560
231 Ga0501337_007979 3300049553 Bacteria 746
232 Ga0501337_011033 3300049553 Bacteria 665
233 Ga0501338_00831 3300049554 Bacteria 1517
234 Ga0501338_15906 3300049554 Bacteria 539
235 Ga0501340_000448 3300049556 Bacteria 1800
236 Ga0501198_049703 3300049649 Bacteria 745
237 Ga0501208_037299 3300049655 Bacteria 886
238 Ga0501217_017186 3300049661 Bacteria 1666
239 Ga0501217_055848 3300049661 Bacteria 1043
240 Ga0501230_017619 3300049667 Bacteria 1211
241 Ga0501279_064158 3300049775 Bacteria 607
242 Ga0587079_102014 3300059647 Bacteria 686
243 2511700610 2511231119 Bacteria 4019861
244 2524187594 2524023129 Bacteria 6762600
245 2540607835 2540341094 Bacteria 4061186
246 2553396435 2551306519 Bacteria 5465154
247 2555469885 2554235283 Bacteria 3683090
248 2595090761 2593339131 Bacteria 5116855
249 2595315963 2593339198 Bacteria 7267884
250 2631984488 2630968484 Bacteria 3876276
251 2644715521 2643221731 Bacteria 5623886
252 2644726825 2643221732 Bacteria 5756404
253 2644741477 2643221735 Bacteria 3676263
254 2672337369 2671180330 Bacteria 5521719
255 2674418562 2671180844 Bacteria 4164150
256 2685152609 2684622632 Bacteria 5380049
257 2686997898 2684623153 Bacteria 3878815
258 2687499238 2687453109 Bacteria 3860091
259 2698320563 2695420987 Bacteria 6152737
260 2705996529 2703719227 Bacteria 5631989
261 2717915702 2716884898 Bacteria 3928789
262 2721507768 2718218445 Bacteria 5113413
263 2738815513 2738541295 Bacteria 5730091
264 2739229868 2738543010 Bacteria 5583595
265 2739270672 2738543017 Bacteria 4271950
266 2757568662 2757320391 Bacteria 4746095
267 2777763654 2775507177 Bacteria 4384303
268 2777836460 2775507192 Bacteria 4622234
269 2793182826 2791355222 Bacteria 5898266
270 2808869751 2808606364 Bacteria 4465927
271 2809056200 2808606399 Bacteria 4021018
272 2812317092 2811994870 Bacteria 3776934
273 2816862208 2816332186 Bacteria 5331395
274 2819568816 2818991441 Bacteria 5062707
275 2819675353 2818991459 Bacteria 8736032
276 2819708989 2818991465 Bacteria 5388835
277 2819724172 2818991468 Bacteria 3723169
278 2823529050 2823526263 Bacteria 3765752
279 2831908611 2831905167 Bacteria 3319172
280 2842684878 2842682962 Bacteria 5589973
281 2842884772 2842882022 Bacteria 6158489
282 2849141434 2849139964 Bacteria 5613304
283 2852675975 2852673933 Bacteria 3347676
284 2857473756 2857472729 Bacteria 6568124
285 2857584143 2857581216 Bacteria 5522813
286 2857589162 2857586860 Bacteria 4354574
287 2857604612 2857604169 Bacteria 5111450
288 2857605440 2857604169 Bacteria 5111450
289 2857607858 2857604169 Bacteria 5111450
290 2857610532 2857609550 Bacteria 3753890
291 2865008789 2865002811 Bacteria 6333767
292 2888580736 2888578766 Bacteria 6743310
293 2889050607 2889049205 Bacteria 7524325
294 2904524198 2904524088 Bacteria 5887454
295 2904563971 2904560550 Bacteria 4029838
296 2908667734 2908665501 Bacteria 3678115
297 2919095530 2919093281 Bacteria 3660974
298 2919147225 2919143609 Bacteria 6219228
299 2919417613 2919414237 Bacteria 5429133
300 2919429992 2919425241 Bacteria 8055701
301 2919519129 2919517244 Bacteria 5858162
302 2919723497 2919720352 Bacteria 5986006
303 2919728762 2919726948 Bacteria 3696050
304 2928095976 2928093941 Bacteria 5965005
305 2928514426 2928510474 Bacteria 4815308
306 2929006652 2929004312 Bacteria 5678476
307 2929208410 2929206907 Bacteria 5918291
308 2929238312 2929233124 Bacteria 5948380
309 2936342712 2936340661 Bacteria 5139038
310 2947431396 2947426588 Bacteria 5357194
311 2954773401 2954773129 Bacteria 3741715
312 2956897529 2956897341 Bacteria 5447711
313 2956897718 2956897341 Bacteria 5447711
314 2960319595 2960319331 Bacteria 5502575
315 2960381194 2960375949 Bacteria 5361395
316 2964379365 2964375228 Bacteria 4909004
317 2965765858 2965761152 Bacteria 5806513
318 2969143966 2969141011 Bacteria 4118468
319 2971896185 2971893375 Bacteria 3929648
320 2977256293 2977254563 Bacteria 4828420
321 2979088299 2979083700 Bacteria 5894929
322 2990277172 2990275345 Bacteria 4887158
323 3001268731 3001267043 Bacteria 4823521
324 3001274193 3001272096 Bacteria 4729684
325 3001896717 3001892409 Bacteria 6328293
326 3006828378 3006826541 Bacteria 4678913
327 3006861262 3006858327 Bacteria 4317835
328 3006882224 3006879489 Bacteria 4064221
329 3006976221 3006973921 Bacteria 4423788
330 3006982186 3006978542 Bacteria 5328100
331 3006988638 3006988479 Bacteria 4767936
332 8022624564 8022621104 Bacteria 5241040
333 8022797970 8022792930 Bacteria 5693794
334 8022898475 8022893055 Bacteria 5300455
335 8022917626 8022914991 Bacteria 5584517
336 8022948756 8022948649 Bacteria 5366783
337 8023443668 8023438354 Bacteria 5779374
338 8052176430 8052174270 Bacteria 3881265
339 8054280844 8054280661 Bacteria 4232245
340 8054797648 8054795415 Bacteria 9785225
341 8057587060 8057582654 Bacteria 5218944
342 8057635759 8057632132 Bacteria 4726859
343 8057734076 8057733483 Bacteria 6578323
344 8057977509 8057977335 Bacteria 5694872
345 Ga0496116_0036408
346 JGI25151J46595_10000046
347 JGI25151J46595_10001987
348 JGI25151J46595_10002239
349 JGI25151J46595_10006112
350 JGI25151J46595_10041143
351 rootH1_10001445
352 rootH2_10021470
353 rootL2_10013974
354 rootH1_10216221
355 Ga0006562J51391_1002637
356 Ga0055532_1000100
357 Ga0055532_1004122
358 Ga0055535_1001771
359 Ga0055528_1003345
360 Ga0055541_1000360
361 Ga0065704_10664407
362 Ga0070670_100138519
363 Ga0070669_100553708
364 Ga0070671_100175798
365 Ga0070707_100708841
366 Ga0105251_10253651
367 Ga0105245_10294715
368 Ga0105247_10090485
369 Ga0105243_10010115
370 Ga0105242_10243564
371 Ga0105249_10143785
372 Ga0105239_10102719
373 Ga0105246_10010651
374 Ga0157371_10002617
375 Ga0157374_10138438
376 Ga0157378_10017869
377 Ga0157372_10067420
378 Ga0157377_10005932
379 Ga0157376_10250766
380 Ga0209566_100069
381 Ga0209566_100132
382 Ga0209147_100058
383 Ga0209147_100262
384 Ga0209258_101413
385 Ga0209673_1045338
386 Ga0209130_1020806
387 Ga0209675_1004083
388 Ga0209676_1000709
389 Ga0209676_1013193
390 Ga0209025_1000001
391 Ga0209025_1000273
392 Ga0209025_1000347
393 Ga0209025_1001181
394 Ga0209025_1010504
395 Ga0209025_1014645
396 Ga0209025_1030474
397 Ga0209025_1034337
398 Ga0209025_1088453
399 Ga0209025_1102179
400 Ga0207426_1020725
401 Ga0207696_1019415
402 Ga0207655_1033214
403 Ga0207713_1000727
404 Ga0207710_10511467
405 Ga0207686_10272104
406 Ga0207709_10004671
407 Ga0210000_1029999
408 Ga0209974_10150704
409 Ga0268266_10608399
410 Ga0265338_10229599
411 Ga0265316_10000109
412 Ga0307408_100077460
413 Ga0307408_100554774
414 Ga0307408_100558113
415 Ga0307408_101013127
416 Ga0307413_10370055
417 Ga0307410_11046170
418 Ga0307412_10755548
419 Ga0307409_100012064
420 Ga0307416_100035216
421 Ga0307416_100287568
422 Ga0316583_10172488
423 Ga0316593_10033216
424 Ga0395900_0361136
425 Ga0439449_0018051
426 Ga0439462_0007370
427 Ga0466972_0261048
428 Ga0466970_0212162
429 Ga0466957_0088467
430 Ga0495603_0078940
431 Ga0495603_0383284
432 Ga0495605_0123245
433 Ga0495585_0076495
434 Ga0495606_0277955
435 Ga0495654_0062268
436 Ga0495622_0048269
437 Ga0495622_0148382
438 Ga0495661_0094366
439 Ga0495661_0100393
440 Ga0495661_0247639
441 Ga0495588_0453296
442 Ga0495649_0305716
443 Ga0495649_0349179
444 Ga0495660_0348481
445 Ga0496101_0001975
446 Ga0496102_0011042
447 Ga0496102_0014519
448 Ga0496103_0031932
449 Ga0496104_0008096
450 Ga0496105_0000266
451 Ga0496106_0000224
452 Ga0496107_0004486
453 Ga0496107_0922231
454 Ga0496108_0001891
455 Ga0496109_0000475
456 Ga0496110_0002503
457 Ga0496110_0005975
458 Ga0496111_0001047
459 Ga0496111_0079860
460 Ga0496112_0005572
461 Ga0496117_0009983
462 Ga0496118_0115025
463 Ga0496119_0005894
464 Ga0496120_0298460
465 Ga0496121_0563362
466 Ga0496121_0586929
467 Ga0496122_0014515
468 Ga0496122_0015038
469 Ga0496122_0020758
470 Ga0496122_0171899
471 Ga0496122_0225939
472 Ga0496123_0004702
473 Ga0496123_0343132
474 Ga0496124_0006304
475 Ga0496124_0222583
476 Ga0496125_0002634
477 Ga0496125_0022915
478 Ga0496125_0296500
479 Ga0496126_0075778
480 Ga0496126_0212569
481 Ga0501306_010214
482 Ga0501306_050923
483 Ga0501308_059013
484 Ga0501309_001906
485 Ga0501309_015172
486 Ga0501309_026160
487 Ga0501309_092409
488 Ga0501310_036906
489 Ga0501341_02469
490 Ga0501341_07645
491 Ga0501343_001661
492 Ga0501343_014748
493 Ga0501343_019689
494 Ga0501344_02297
495 Ga0501344_03208
496 Ga0501304_019198
497 Ga0501304_034830
498 Ga0501305_004385
499 Ga0501305_033420
500 Ga0501305_049208
501 Ga0501305_087682
502 Ga0501305_094611
503 Ga0501305_100181
504 Ga0501307_059485
505 Ga0501342_01815
506 Ga0501342_03020
507 Ga0501342_04915
508 Ga0501292_117315
509 Ga0501311_020898
510 Ga0501311_029529
511 Ga0501311_032336
512 Ga0501312_005997
513 Ga0501312_026600
514 Ga0501312_027856
515 Ga0501312_046813
516 Ga0501312_048486
517 Ga0501312_093608
518 Ga0501312_099541
519 Ga0501312_099567
520 Ga0501312_107053
521 Ga0501313_005224
522 Ga0501313_010059
523 Ga0501313_020771
524 Ga0501313_041744
525 Ga0501313_050038
526 Ga0501313_059399
527 Ga0501314_036130
528 Ga0501314_039275
529 Ga0501315_003926
530 Ga0501315_026654
531 Ga0501315_074913
532 Ga0501315_083472
533 Ga0501315_095359
534 Ga0501316_002229
535 Ga0501316_002762
536 Ga0501316_025203
537 Ga0501316_036051
538 Ga0501316_074674
539 Ga0501317_003282
540 Ga0501317_005750
541 Ga0501317_036840
542 Ga0501318_018337
543 Ga0501318_066783
544 Ga0501318_071905
545 Ga0501319_009937
546 Ga0501319_030317
547 Ga0501320_026582
548 Ga0501320_061812
549 Ga0501321_002169
550 Ga0501321_017296
551 Ga0501321_040763
552 Ga0501321_067193
553 Ga0501321_077010
554 Ga0501322_016221
555 Ga0501323_001433
556 Ga0501323_041724
557 Ga0501323_058179
558 Ga0501324_007348
559 Ga0501326_06933
560 Ga0501328_08513
561 Ga0501330_006853
562 Ga0501331_07460
563 Ga0501332_04404
564 Ga0501332_16103
565 Ga0501333_014022
566 Ga0501334_07611
567 Ga0501335_001530
568 Ga0501335_016575
569 Ga0501335_030870
570 Ga0501335_033345
571 Ga0501335_043718
572 Ga0501335_045233
573 Ga0501336_002391
574 Ga0501336_025331
575 Ga0501337_007979
576 Ga0501337_011033
577 Ga0501338_00831
578 Ga0501338_15906
579 Ga0501340_000448
580 Ga0501198_049703
581 Ga0501208_037299
582 Ga0501217_017186
583 Ga0501217_055848
584 Ga0501230_017619
585 Ga0501279_064158
586 Ga0587079_102014
587 2511700610
588 2524187594
589 2540607835
590 2553396435
591 2555469885
592 2595090761
593 2595315963
594 2631984488
595 2644715521
596 2644726825
597 2644741477
598 2672337369
599 2674418562
600 2685152609
601 2686997898
602 2687499238
603 2698320563
604 2705996529
605 2717915702
606 2721507768
607 2738815513
608 2739229868
609 2739270672
610 2757568662
611 2777763654
612 2777836460
613 2793182826
614 2808869751
615 2809056200
616 2812317092
617 2816862208
618 2819568816
619 2819675353
620 2819708989
621 2819724172
622 2823529050
623 2831908611
624 2842684878
625 2842884772
626 2849141434
627 2852675975
628 2857473756
629 2857584143
630 2857589162
631 2857604612
632 2857605440
633 2857607858
634 2857610532
635 2865008789
636 2888580736
637 2889050607
638 2904524198
639 2904563971
640 2908667734
641 2919095530
642 2919147225
643 2919417613
644 2919429992
645 2919519129
646 2919723497
647 2919728762
648 2928095976
649 2928514426
650 2929006652
651 2929208410
652 2929238312
653 2936342712
654 2947431396
655 2954773401
656 2956897529
657 2956897718
658 2960319595
659 2960381194
660 2964379365
661 2965765858
662 2969143966
663 2971896185
664 2977256293
665 2979088299
666 2990277172
667 3001268731
668 3001274193
669 3001896717
670 3006828378
671 3006861262
672 3006882224
673 3006976221
674 3006982186
675 3006988638
676 8022624564
677 8022797970
678 8022898475
679 8022917626
680 8022948756
681 8023443668
682 8052176430
683 8054280844
684 8054797648
685 8057587060
686 8057635759
687 8057734076
688 8057977509

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00578

AhpC-TSA

AhpC/TSA family

41

165

0.97

PF08534

Redoxin

Redoxin

40

181

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
3p7x-assembly1.cif.gz_A crystal structure of an atypical two-cysteine peroxiredoxin (saouhsc_01822) from staphylococcus aureus nctc8325 0.9518 1 164
1psq-assembly1.cif.gz_B structure of a probable thiol peroxidase from streptococcus pneumoniae 0.9473 4 165
2jsz-assembly1.cif.gz_A solution structure of tpx in the reduced state 0.945 1 165
4af2-assembly1.cif.gz_A c61s mutant of thiol peroxidase form e. coli. 0.9385 2 163
2yjh-assembly1.cif.gz_A-2 thiol peroxidase from yersinia psuedotuberculosis, inactive mutant c61s 0.9374 2 158
ID Description Score Start End Superfamily
1psqB00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9463 4 165 3.40.30.10
1psqB00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9407 4 165 3.40.30.10
4af2A00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9385 2 163 3.40.30.10
2yzhD00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9221 1 166 3.40.30.10
2yzhD00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9169 1 166 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A0S4PNV1-F1-model_v4 deleted 0.9766 4 166
AF-D0DUN6-F1-model_v4 Redoxin family protein 0.9764 2 166 GO:0008379
AF-A0A1V6DC50-F1-model_v4 Thiol peroxidase (Tpx) (EC 1.11.1.24) (Peroxiredoxin tpx) (Prx) (Thioredoxin peroxidase) (Thioredoxin-dependent peroxiredoxin) 0.9754 2 166 GO:0008379
AF-A0A7Y5UYK7-F1-model_v4 Thiol peroxidase (EC 1.11.1.-) 0.9735 2 166 GO:0008379
AF-A0A6G7WFJ2-F1-model_v4 Thiol peroxidase (EC 1.11.1.-) 0.9731 2 166 GO:0008379

Map