F416117
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 344 | 220 | 344 | 827 |
Family's Representative Sequence
| Representative Sequence | 3300047317|Ga0495604_0000067|Ga0495604_0000067_31264_33984 |
| Length | 881 |
| Sequence | MKANEIRQTYLSFFEERGHEIVPSASLVPSVHDPSVLLTTAGMQPFKPYFLGREEPPARRLADVQKCFRTTDVTEVGDTARHLTFFEMLGNWSFGDYFKEESIAWGWELSTQGFGMDPERIWVTVFGGDEELGLGPDDEAIAIWLEVGVPDERIVRLGREDNFWQAGPELYLDRGEEFGAADDRPGDDTDRFLEFWNHVFMTYDLGADGALTELPMRNIDTGMGLDRMAAILQDVPSVFETDLLRPLVDLAEETSGRSYTEGGAVTRAMRIVADHSRAAAFLIADGVVPSNEDRGYILRRIMRRAIQQGRTLGLEAPWLGRFTERTIEIMVEAYPELGAAREAIARWVGDEEESFGLTLERGTELLERLVAEARESETSWIDAADAFKLHDTYGFPYDLTKELLAERGLSVDDGGFEELMEEQRQRARVGAATAHGSEDRHERVIAFASAAAPSRFVGYETLRATTGLAAVEREDGRALVKLEESPFYAEGGGQVADSGTIRWDGGETEVVDVYRVGDDQVLEVAPRRPRTRGQGHETSGGDEHALVGAGEAAVLDERATVEAEVDRETRHATMRNHTATAGSAVRPDKLRFDFTHGQALSAEDLRAVEDRVNDWIKASRPVRWLEMERTEAERLGAMALFGEKYGEWVRMVEVDGVSRELCGGTHVANTAEVGIFKIASEGSSAANVRRIEALSGPAAIDWFREREDRLHEVGDLLGSPQDPVTGARRAAERLREAGAGAEKAQREELSVEAGRIADRAVDLMVRDSAGEIVALVEAKTSIDAEPRQLLDLANRVQSKLGEPSVVVLGGASGSKAGLVALVSKDAIERGLSAVSIIREIAPIVQGXXXXRDDMAQAGGKDPSRLDEALDAARAAVERELA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 2 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 3 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 5 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 6 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 7 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 13 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 15 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 19 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 20 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 21 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 22 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 25 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 26 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 27 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 28 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 29 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 30 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 31 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 32 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 33 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 34 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 35 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 36 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 37 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 38 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 39 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 42 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 43 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 44 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 45 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 46 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 47 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 48 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 49 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 56 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 66 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 107 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 108 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 109 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 110 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 111 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 112 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 113 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 114 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 115 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 116 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 117 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 118 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 119 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 120 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 121 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 122 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 123 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 163 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 164 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 165 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 166 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 167 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 168 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 169 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 170 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 171 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 172 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 173 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 174 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 175 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 176 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 177 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 178 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 179 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 180 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 181 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 182 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 183 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 184 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 185 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 186 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 187 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 188 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 189 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 190 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 191 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 192 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 193 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 194 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 195 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 196 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 197 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 198 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 199 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 200 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 201 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 202 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 203 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 204 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 205 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 206 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 207 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 208 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 209 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 210 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 211 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 217 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 218 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 219 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 220 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.03 |
| Nodule | 0 |
| Rhizoplane | 13.95 |
| Rhizosphere | 80.81 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 3.2 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24746J21847_1001074 | 3300001977 | Bacteria | 4289 |
| 2 | Ga0070683_100006350 | 3300005329 | Bacteria | 9914 |
| 3 | Ga0070677_10000044 | 3300005333 | Bacteria | 39119 |
| 4 | Ga0070682_100000011 | 3300005337 | Bacteria | 266253 |
| 5 | Ga0070682_100000078 | 3300005337 | Bacteria | 87953 |
| 6 | Ga0070682_100001072 | 3300005337 | Bacteria | 15772 |
| 7 | Ga0068868_100000453 | 3300005338 | Bacteria | 27329 |
| 8 | Ga0070691_10000002 | 3300005341 | Bacteria | 90686 |
| 9 | Ga0070661_100000145 | 3300005344 | Bacteria | 58346 |
| 10 | Ga0070668_100025920 | 3300005347 | Bacteria | 4446 |
| 11 | Ga0070675_100000776 | 3300005354 | Bacteria | 22323 |
| 12 | Ga0070674_100000002 | 3300005356 | Bacteria | 271088 |
| 13 | Ga0070674_100000007 | 3300005356 | Bacteria | 145531 |
| 14 | Ga0070673_100002354 | 3300005364 | Bacteria | 11482 |
| 15 | Ga0070688_100000169 | 3300005365 | Bacteria | 35241 |
| 16 | Ga0070688_100002791 | 3300005365 | Bacteria | 8876 |
| 17 | Ga0070659_100006296 | 3300005366 | Bacteria | 8576 |
| 18 | Ga0070713_100001073 | 3300005436 | Bacteria | 17481 |
| 19 | Ga0070711_100004900 | 3300005439 | Bacteria | 7948 |
| 20 | Ga0070711_100026045 | 3300005439 | Bacteria | 3831 |
| 21 | Ga0070663_100002374 | 3300005455 | Bacteria | 10588 |
| 22 | Ga0070662_100000002 | 3300005457 | Bacteria | 253208 |
| 23 | Ga0068867_100000750 | 3300005459 | Bacteria | 21786 |
| 24 | Ga0070685_10000019 | 3300005466 | Bacteria | 105881 |
| 25 | Ga0070679_100000129 | 3300005530 | Bacteria | 60559 |
| 26 | Ga0070679_100002847 | 3300005530 | Bacteria | 15715 |
| 27 | Ga0068853_100016808 | 3300005539 | Bacteria | 6028 |
| 28 | Ga0070672_100000001 | 3300005543 | Bacteria | 204624 |
| 29 | Ga0070665_100000141 | 3300005548 | Bacteria | 135473 |
| 30 | Ga0070665_100011747 | 3300005548 | Bacteria | 8843 |
| 31 | Ga0068854_100000113 | 3300005578 | Bacteria | 55436 |
| 32 | Ga0068856_100001668 | 3300005614 | Bacteria | 23239 |
| 33 | Ga0068856_100004779 | 3300005614 | Bacteria | 13422 |
| 34 | Ga0068852_100000002 | 3300005616 | Bacteria | 268221 |
| 35 | Ga0068864_100000015 | 3300005618 | Bacteria | 303368 |
| 36 | Ga0068866_10000003 | 3300005718 | Bacteria | 281675 |
| 37 | Ga0068866_10000020 | 3300005718 | Bacteria | 62866 |
| 38 | Ga0068863_100000129 | 3300005841 | Bacteria | 79654 |
| 39 | Ga0068863_100025421 | 3300005841 | Bacteria | 5647 |
| 40 | Ga0068858_100000120 | 3300005842 | Bacteria | 81766 |
| 41 | Ga0068858_100001913 | 3300005842 | Bacteria | 21241 |
| 42 | Ga0068860_100002215 | 3300005843 | Bacteria | 20454 |
| 43 | Ga0068862_100002034 | 3300005844 | Bacteria | 18317 |
| 44 | Ga0081455_10006044 | 3300005937 | Bacteria | 13101 |
| 45 | Ga0081455_10051084 | 3300005937 | Bacteria | 3549 |
| 46 | Ga0081538_10000189 | 3300005981 | Bacteria | 67621 |
| 47 | Ga0081538_10004164 | 3300005981 | Bacteria | 13421 |
| 48 | Ga0081540_1000628 | 3300005983 | Bacteria | 33596 |
| 49 | Ga0081539_10003342 | 3300005985 | Bacteria | 19934 |
| 50 | Ga0081539_10011125 | 3300005985 | Bacteria | 7182 |
| 51 | Ga0075365_10012463 | 3300006038 | Bacteria | 5052 |
| 52 | Ga0075365_10013423 | 3300006038 | Bacteria | 4898 |
| 53 | Ga0075363_100017754 | 3300006048 | Bacteria | 3534 |
| 54 | Ga0070715_10000029 | 3300006163 | Bacteria | 88994 |
| 55 | Ga0070712_100010956 | 3300006175 | Bacteria | 5736 |
| 56 | Ga0070712_100010993 | 3300006175 | Bacteria | 5727 |
| 57 | Ga0075430_100018768 | 3300006846 | Bacteria | 5885 |
| 58 | Ga0075430_100041396 | 3300006846 | Bacteria | 3898 |
| 59 | Ga0075431_100020953 | 3300006847 | Bacteria | 6680 |
| 60 | Ga0075431_100045799 | 3300006847 | Bacteria | 4509 |
| 61 | Ga0075433_10000002 | 3300006852 | Bacteria | 92986 |
| 62 | Ga0075433_10040385 | 3300006852 | Bacteria | 4038 |
| 63 | Ga0075434_100016456 | 3300006871 | Bacteria | 7109 |
| 64 | Ga0068865_100000094 | 3300006881 | Bacteria | 46651 |
| 65 | Ga0105245_10000026 | 3300009098 | Bacteria | 163660 |
| 66 | Ga0105245_10000315 | 3300009098 | Bacteria | 46041 |
| 67 | Ga0105245_10001571 | 3300009098 | Bacteria | 20730 |
| 68 | Ga0105245_10002028 | 3300009098 | Bacteria | 18364 |
| 69 | Ga0105245_10006082 | 3300009098 | Bacteria | 10609 |
| 70 | Ga0105247_10000347 | 3300009101 | Bacteria | 40377 |
| 71 | Ga0114129_10021452 | 3300009147 | Bacteria | 9169 |
| 72 | Ga0114129_10029330 | 3300009147 | Bacteria | 7794 |
| 73 | Ga0105243_10008343 | 3300009148 | Bacteria | 7955 |
| 74 | Ga0105243_10037576 | 3300009148 | Bacteria | 3765 |
| 75 | Ga0105242_10000059 | 3300009176 | Bacteria | 75563 |
| 76 | Ga0105242_10001472 | 3300009176 | Bacteria | 18524 |
| 77 | Ga0105248_10000020 | 3300009177 | Bacteria | 284637 |
| 78 | Ga0105238_10000048 | 3300009551 | Bacteria | 146322 |
| 79 | Ga0105249_10000076 | 3300009553 | Bacteria | 144450 |
| 80 | Ga0105239_10052400 | 3300010375 | Bacteria | 4475 |
| 81 | Ga0105239_10075197 | 3300010375 | Bacteria | 3713 |
| 82 | Ga0157371_10009163 | 3300013102 | Bacteria | 7817 |
| 83 | Ga0157370_10005610 | 3300013104 | Bacteria | 14050 |
| 84 | Ga0157369_10000014 | 3300013105 | Bacteria | 266411 |
| 85 | Ga0157374_10010565 | 3300013296 | Bacteria | 7948 |
| 86 | Ga0157372_10000060 | 3300013307 | Bacteria | 122372 |
| 87 | Ga0157372_10035599 | 3300013307 | Bacteria | 5482 |
| 88 | Ga0157375_10000171 | 3300013308 | Bacteria | 61181 |
| 89 | Ga0157375_10003527 | 3300013308 | Bacteria | 13570 |
| 90 | Ga0157380_10000439 | 3300014326 | Bacteria | 25370 |
| 91 | Ga0157380_10001547 | 3300014326 | Bacteria | 15125 |
| 92 | Ga0157377_10018369 | 3300014745 | Bacteria | 3632 |
| 93 | Ga0157379_10013172 | 3300014968 | Bacteria | 7240 |
| 94 | Ga0163161_10000022 | 3300017792 | Bacteria | 207890 |
| 95 | Ga0213875_10005171 | 3300021388 | Bacteria | 7056 |
| 96 | Ga0207656_10001014 | 3300025321 | Bacteria | 9146 |
| 97 | Ga0207682_10000497 | 3300025893 | Bacteria | 18104 |
| 98 | Ga0207642_10000002 | 3300025899 | Bacteria | 658166 |
| 99 | Ga0207642_10002332 | 3300025899 | Bacteria | 5922 |
| 100 | Ga0207710_10000631 | 3300025900 | Bacteria | 20232 |
| 101 | Ga0207688_10001625 | 3300025901 | Bacteria | 11863 |
| 102 | Ga0207680_10021371 | 3300025903 | Bacteria | 3501 |
| 103 | Ga0207685_10000031 | 3300025905 | Bacteria | 77451 |
| 104 | Ga0207671_10047639 | 3300025914 | Bacteria | 3172 |
| 105 | Ga0207693_10006680 | 3300025915 | Bacteria | 9529 |
| 106 | Ga0207693_10007008 | 3300025915 | Bacteria | 9312 |
| 107 | Ga0207693_10022874 | 3300025915 | Bacteria | 4963 |
| 108 | Ga0207663_10002979 | 3300025916 | Bacteria | 8190 |
| 109 | Ga0207649_10000003 | 3300025920 | Bacteria | 388908 |
| 110 | Ga0207652_10000211 | 3300025921 | Bacteria | 61784 |
| 111 | Ga0207652_10002784 | 3300025921 | Bacteria | 14695 |
| 112 | Ga0207694_10000056 | 3300025924 | Bacteria | 146908 |
| 113 | Ga0207659_10000013 | 3300025926 | Bacteria | 172742 |
| 114 | Ga0207687_10000017 | 3300025927 | Bacteria | 237310 |
| 115 | Ga0207687_10000112 | 3300025927 | Bacteria | 58074 |
| 116 | Ga0207687_10004413 | 3300025927 | Bacteria | 9386 |
| 117 | Ga0207700_10000033 | 3300025928 | Bacteria | 123113 |
| 118 | Ga0207706_10000001 | 3300025933 | Bacteria | 423014 |
| 119 | Ga0207686_10000116 | 3300025934 | Bacteria | 64638 |
| 120 | Ga0207686_10000888 | 3300025934 | Bacteria | 18054 |
| 121 | Ga0207669_10000001 | 3300025937 | Bacteria | 377747 |
| 122 | Ga0207669_10000003 | 3300025937 | Bacteria | 252239 |
| 123 | Ga0207704_10000088 | 3300025938 | Bacteria | 53926 |
| 124 | Ga0207691_10000017 | 3300025940 | Bacteria | 134441 |
| 125 | Ga0207711_10000006 | 3300025941 | Bacteria | 792692 |
| 126 | Ga0207661_10000220 | 3300025944 | Bacteria | 37288 |
| 127 | Ga0207661_10013614 | 3300025944 | Bacteria | 5940 |
| 128 | Ga0207651_10001628 | 3300025960 | Bacteria | 10300 |
| 129 | Ga0207712_10000052 | 3300025961 | Bacteria | 152874 |
| 130 | Ga0207712_10005524 | 3300025961 | Bacteria | 7975 |
| 131 | Ga0207640_10000401 | 3300025981 | Bacteria | 27504 |
| 132 | Ga0207677_10000203 | 3300026023 | Bacteria | 47885 |
| 133 | Ga0207677_10000379 | 3300026023 | Bacteria | 30693 |
| 134 | Ga0207703_10000018 | 3300026035 | Bacteria | 271377 |
| 135 | Ga0207703_10000061 | 3300026035 | Bacteria | 132671 |
| 136 | Ga0207639_10012864 | 3300026041 | Bacteria | 5838 |
| 137 | Ga0207678_10000556 | 3300026067 | Bacteria | 34074 |
| 138 | Ga0207708_10001138 | 3300026075 | Bacteria | 19986 |
| 139 | Ga0207702_10000076 | 3300026078 | Bacteria | 112300 |
| 140 | Ga0207702_10002397 | 3300026078 | Bacteria | 17842 |
| 141 | Ga0207702_10008407 | 3300026078 | Bacteria | 8708 |
| 142 | Ga0207641_10000016 | 3300026088 | Bacteria | 307363 |
| 143 | Ga0207641_10005756 | 3300026088 | Bacteria | 10526 |
| 144 | Ga0207648_10001987 | 3300026089 | Bacteria | 22343 |
| 145 | Ga0207676_10000018 | 3300026095 | Bacteria | 306375 |
| 146 | Ga0207683_10022226 | 3300026121 | Bacteria | 5443 |
| 147 | Ga0207698_10000004 | 3300026142 | Bacteria | 313614 |
| 148 | Ga0268266_10000056 | 3300028379 | Bacteria | 289176 |
| 149 | Ga0268266_10000160 | 3300028379 | Bacteria | 125999 |
| 150 | Ga0268266_10000376 | 3300028379 | Bacteria | 68245 |
| 151 | Ga0268265_10000985 | 3300028380 | Bacteria | 25857 |
| 152 | Ga0268264_10001600 | 3300028381 | Bacteria | 20943 |
| 153 | Ga0265337_1000007 | 3300028556 | Bacteria | 98412 |
| 154 | Ga0265326_10000019 | 3300028558 | Bacteria | 137370 |
| 155 | Ga0265319_1000014 | 3300028563 | Bacteria | 177623 |
| 156 | Ga0265322_10000011 | 3300028654 | Bacteria | 167597 |
| 157 | Ga0265338_10000185 | 3300028800 | Bacteria | 116333 |
| 158 | Ga0265324_10000997 | 3300029957 | Bacteria | 17408 |
| 159 | Ga0265320_10000011 | 3300031240 | Bacteria | 249534 |
| 160 | Ga0265331_10004136 | 3300031250 | Bacteria | 9099 |
| 161 | Ga0265327_10000015 | 3300031251 | Bacteria | 496677 |
| 162 | Ga0265314_10000119 | 3300031711 | Bacteria | 122334 |
| 163 | Ga0307415_100000776 | 3300032126 | Bacteria | 14456 |
| 164 | Ga0395898_0008138 | 3300037466 | Bacteria | 11102 |
| 165 | Ga0395898_0008295 | 3300037466 | Bacteria | 10985 |
| 166 | Ga0395898_0035692 | 3300037466 | Bacteria | 4941 |
| 167 | Ga0436364_1521721 | 3300037853 | Bacteria | 19288 |
| 168 | Ga0395901_0016091 | 3300038443 | Bacteria | 7620 |
| 169 | Ga0466963_0000004 | 3300044694 | Bacteria | 102526 |
| 170 | Ga0466963_0038757 | 3300044694 | Bacteria | 3119 |
| 171 | Ga0466957_0008131 | 3300044842 | Bacteria | 5955 |
| 172 | Ga0466967_0000001 | 3300045976 | Bacteria | 229823 |
| 173 | Ga0466967_0002279 | 3300045976 | Bacteria | 11844 |
| 174 | Ga0495592_0000078 | 3300046454 | Bacteria | 85591 |
| 175 | Ga0495603_0000128 | 3300046455 | Bacteria | 37013 |
| 176 | Ga0495603_0001813 | 3300046455 | Bacteria | 12609 |
| 177 | Ga0495629_0000106 | 3300046459 | Bacteria | 74178 |
| 178 | Ga0495629_0001644 | 3300046459 | Bacteria | 17549 |
| 179 | Ga0495641_0000005 | 3300046461 | Bacteria | 206626 |
| 180 | Ga0495641_0000111 | 3300046461 | Bacteria | 57409 |
| 181 | Ga0495641_0018672 | 3300046461 | Bacteria | 3572 |
| 182 | Ga0495653_0010945 | 3300046463 | Bacteria | 7428 |
| 183 | Ga0495582_0000009 | 3300046473 | Bacteria | 123633 |
| 184 | Ga0495662_0000001 | 3300046476 | Bacteria | 179185 |
| 185 | Ga0495594_0000045 | 3300046499 | Bacteria | 54326 |
| 186 | Ga0495606_0000040 | 3300046507 | Bacteria | 223500 |
| 187 | Ga0495608_0000007 | 3300046511 | Bacteria | 313495 |
| 188 | Ga0495608_0000240 | 3300046511 | Bacteria | 39700 |
| 189 | Ga0495618_0000014 | 3300046514 | Bacteria | 163136 |
| 190 | Ga0495620_0000092 | 3300046515 | Bacteria | 72050 |
| 191 | Ga0495628_0000808 | 3300046516 | Bacteria | 28939 |
| 192 | Ga0495628_0011425 | 3300046516 | Bacteria | 7510 |
| 193 | Ga0495630_0000014 | 3300046517 | Bacteria | 217229 |
| 194 | Ga0495630_0000062 | 3300046517 | Bacteria | 86140 |
| 195 | Ga0495630_0006859 | 3300046517 | Bacteria | 8116 |
| 196 | Ga0495630_0041656 | 3300046517 | Bacteria | 3430 |
| 197 | Ga0495644_0000139 | 3300046523 | Bacteria | 35023 |
| 198 | Ga0495652_0000010 | 3300046529 | Bacteria | 261584 |
| 199 | Ga0495652_0038776 | 3300046529 | Bacteria | 4125 |
| 200 | Ga0495586_0000959 | 3300046535 | Bacteria | 16343 |
| 201 | Ga0495587_0027493 | 3300046536 | Bacteria | 3463 |
| 202 | Ga0495622_0001452 | 3300046557 | Bacteria | 11937 |
| 203 | Ga0495667_0000045 | 3300046559 | Bacteria | 118562 |
| 204 | Ga0495656_0002864 | 3300046615 | Bacteria | 5781 |
| 205 | Ga0495634_0000045 | 3300046642 | Bacteria | 99087 |
| 206 | Ga0495625_0000032 | 3300046660 | Bacteria | 233135 |
| 207 | Ga0495635_0000031 | 3300046663 | Bacteria | 110244 |
| 208 | Ga0495635_0022902 | 3300046663 | Bacteria | 4354 |
| 209 | Ga0495588_0000203 | 3300046674 | Bacteria | 59454 |
| 210 | Ga0495657_0000001 | 3300046675 | Bacteria | 445641 |
| 211 | Ga0495657_0002432 | 3300046675 | Bacteria | 15683 |
| 212 | Ga0495647_0000021 | 3300046681 | Bacteria | 72778 |
| 213 | Ga0495658_0000002 | 3300046683 | Bacteria | 309651 |
| 214 | Ga0495669_0000051 | 3300046684 | Bacteria | 80128 |
| 215 | Ga0495613_0000005 | 3300046689 | Bacteria | 222558 |
| 216 | Ga0495613_0000032 | 3300046689 | Bacteria | 139806 |
| 217 | Ga0495624_0000095 | 3300046690 | Bacteria | 59791 |
| 218 | Ga0495624_0000405 | 3300046690 | Bacteria | 34290 |
| 219 | Ga0495670_0012015 | 3300046691 | Bacteria | 4262 |
| 220 | Ga0495604_0000067 | 3300047317 | Bacteria | 90345 |
| 221 | Ga0495604_0000577 | 3300047317 | Bacteria | 32087 |
| 222 | Ga0495674_0000010 | 3300047319 | Bacteria | 285794 |
| 223 | Ga0495676_0000186 | 3300047321 | Bacteria | 49054 |
| 224 | Ga0495676_0000956 | 3300047321 | Bacteria | 24242 |
| 225 | Ga0495680_0000114 | 3300047322 | Bacteria | 76486 |
| 226 | Ga0495680_0000267 | 3300047322 | Bacteria | 57953 |
| 227 | Ga0495680_0000602 | 3300047322 | Bacteria | 40540 |
| 228 | Ga0495675_0000017 | 3300047444 | Bacteria | 123394 |
| 229 | Ga0495686_0000008 | 3300047472 | Bacteria | 727479 |
| 230 | Ga0495686_0008569 | 3300047472 | Bacteria | 7490 |
| 231 | Ga0495602_0000007 | 3300048088 | Bacteria | 273212 |
| 232 | Ga0495602_0000775 | 3300048088 | Bacteria | 30490 |
| 233 | Ga0496100_0000001 | 3300048903 | Bacteria | 530179 |
| 234 | Ga0496100_0000061 | 3300048903 | Bacteria | 63790 |
| 235 | Ga0496101_0000004 | 3300048904 | Bacteria | 331599 |
| 236 | Ga0496101_0000141 | 3300048904 | Bacteria | 63790 |
| 237 | Ga0496102_0000801 | 3300048905 | Bacteria | 30565 |
| 238 | Ga0496102_0001710 | 3300048905 | Bacteria | 19219 |
| 239 | Ga0496102_0045550 | 3300048905 | Bacteria | 3983 |
| 240 | Ga0496103_0000057 | 3300048906 | Bacteria | 142223 |
| 241 | Ga0496104_0000015 | 3300048907 | Bacteria | 374530 |
| 242 | Ga0496104_0000025 | 3300048907 | Bacteria | 228519 |
| 243 | Ga0496104_0000133 | 3300048907 | Bacteria | 69099 |
| 244 | Ga0496104_0005958 | 3300048907 | Bacteria | 10677 |
| 245 | Ga0496104_0060170 | 3300048907 | Bacteria | 3598 |
| 246 | Ga0496105_0000004 | 3300048908 | Bacteria | 475798 |
| 247 | Ga0496105_0000023 | 3300048908 | Bacteria | 156126 |
| 248 | Ga0496105_0000187 | 3300048908 | Bacteria | 41418 |
| 249 | Ga0496106_0000030 | 3300048909 | Bacteria | 136804 |
| 250 | Ga0496106_0000056 | 3300048909 | Bacteria | 90682 |
| 251 | Ga0496106_0000094 | 3300048909 | Bacteria | 67511 |
| 252 | Ga0496107_0000005 | 3300048910 | Bacteria | 281747 |
| 253 | Ga0496107_0000045 | 3300048910 | Bacteria | 67420 |
| 254 | Ga0496107_0010510 | 3300048910 | Bacteria | 6433 |
| 255 | Ga0496107_0026157 | 3300048910 | Bacteria | 4136 |
| 256 | Ga0496107_0052635 | 3300048910 | Bacteria | 2936 |
| 257 | Ga0496108_0000164 | 3300048911 | Bacteria | 62669 |
| 258 | Ga0496108_0000582 | 3300048911 | Bacteria | 28516 |
| 259 | Ga0496108_0002101 | 3300048911 | Bacteria | 15953 |
| 260 | Ga0496108_0028301 | 3300048911 | Bacteria | 4636 |
| 261 | Ga0496109_0000012 | 3300048912 | Bacteria | 229699 |
| 262 | Ga0496109_0000056 | 3300048912 | Bacteria | 120835 |
| 263 | Ga0496109_0000180 | 3300048912 | Bacteria | 62669 |
| 264 | Ga0496109_0000446 | 3300048912 | Bacteria | 35477 |
| 265 | Ga0496110_0000114 | 3300048913 | Bacteria | 44437 |
| 266 | Ga0496110_0007161 | 3300048913 | Bacteria | 8881 |
| 267 | Ga0496110_0018768 | 3300048913 | Bacteria | 5804 |
| 268 | Ga0496111_0000008 | 3300048914 | Bacteria | 96148 |
| 269 | Ga0496111_0011444 | 3300048914 | Bacteria | 5975 |
| 270 | Ga0496111_0026207 | 3300048914 | Bacteria | 4116 |
| 271 | Ga0496112_0000006 | 3300048915 | Bacteria | 365227 |
| 272 | Ga0496112_0001447 | 3300048915 | Bacteria | 18224 |
| 273 | Ga0496113_0000099 | 3300048916 | Bacteria | 36270 |
| 274 | Ga0496113_0010910 | 3300048916 | Bacteria | 6030 |
| 275 | Ga0496114_0000171 | 3300048917 | Bacteria | 46036 |
| 276 | Ga0496114_0004008 | 3300048917 | Bacteria | 11381 |
| 277 | Ga0496114_0042332 | 3300048917 | Bacteria | 3775 |
| 278 | Ga0496115_0000011 | 3300048918 | Bacteria | 222529 |
| 279 | Ga0496115_0001687 | 3300048918 | Bacteria | 15870 |
| 280 | Ga0496115_0009515 | 3300048918 | Bacteria | 7219 |
| 281 | Ga0496116_0000367 | 3300048919 | Bacteria | 69349 |
| 282 | Ga0496117_0006020 | 3300048920 | Bacteria | 12473 |
| 283 | Ga0496118_0000790 | 3300048921 | Bacteria | 50676 |
| 284 | Ga0496119_0003161 | 3300048922 | Bacteria | 17290 |
| 285 | Ga0496119_0011461 | 3300048922 | Bacteria | 7336 |
| 286 | Ga0496120_0002463 | 3300048923 | Bacteria | 18648 |
| 287 | Ga0496121_0014139 | 3300048924 | Bacteria | 8503 |
| 288 | Ga0496121_0054181 | 3300048924 | Bacteria | 3354 |
| 289 | Ga0496125_0017097 | 3300048928 | Bacteria | 6930 |
| 290 | Ga0501031_0000147 | 3300049568 | Bacteria | 39718 |
| 291 | Ga0501031_0046728 | 3300049568 | Bacteria | 2823 |
| 292 | Ga0501032_0000328 | 3300049569 | Bacteria | 39724 |
| 293 | Ga0501033_0000261 | 3300049570 | Bacteria | 50442 |
| 294 | Ga0501034_0007529 | 3300049571 | Bacteria | 11586 |
| 295 | Ga0501034_0021429 | 3300049571 | Bacteria | 6589 |
| 296 | Ga0501034_0027628 | 3300049571 | Bacteria | 5770 |
| 297 | Ga0501036_0002670 | 3300049572 | Bacteria | 14071 |
| 298 | Ga0501037_0000221 | 3300049573 | Bacteria | 49689 |
| 299 | Ga0501038_0000101 | 3300049574 | Bacteria | 72459 |
| 300 | Ga0501040_0020469 | 3300049576 | Bacteria | 4409 |
| 301 | Ga0501042_0010905 | 3300049578 | Bacteria | 6117 |
| 302 | Ga0501043_0000237 | 3300049579 | Bacteria | 49809 |
| 303 | Ga0501046_0000608 | 3300049580 | Bacteria | 35208 |
| 304 | Ga0501047_0000376 | 3300049581 | Bacteria | 50385 |
| 305 | Ga0501048_0002386 | 3300049582 | Bacteria | 14347 |
| 306 | Ga0501068_0032682 | 3300049584 | Bacteria | 3094 |
| 307 | Ga0501070_0000178 | 3300049586 | Bacteria | 59157 |
| 308 | Ga0501070_0009297 | 3300049586 | Bacteria | 8313 |
| 309 | Ga0501073_0000255 | 3300049589 | Bacteria | 35173 |
| 310 | Ga0501074_0006995 | 3300049590 | Bacteria | 8149 |
| 311 | Ga0501075_0001056 | 3300049591 | Bacteria | 17694 |
| 312 | Ga0501079_0033584 | 3300049741 | Bacteria | 3946 |
| 313 | Ga0501083_0001338 | 3300049744 | Bacteria | 16699 |
| 314 | Ga0501083_0023901 | 3300049744 | Bacteria | 4237 |
| 315 | Ga0501035_0000616 | 3300049822 | Bacteria | 39216 |
| 316 | Ga0501044_0000416 | 3300049823 | Bacteria | 52684 |
| 317 | nmdc:mga05p37_22310_c1 | 3300050507 | Bacteria | 7677 |
| 318 | nmdc:mga05p37_78642_c1 | 3300050507 | Bacteria | 4061 |
| 319 | nmdc:mga08y16_69862_c1 | 3300050511 | Bacteria | 3661 |
| 320 | nmdc:mga0n895_32748_c1 | 3300050512 | Bacteria | 4990 |
| 321 | nmdc:mga0n895_77666_c1 | 3300050512 | Bacteria | 3303 |
| 322 | nmdc:mga0a205_13_c1 | 3300050515 | Bacteria | 111131 |
| 323 | nmdc:mga0a205_14130_c2 | 3300050515 | Bacteria | 7146 |
| 324 | nmdc:mga0a205_35959_c1 | 3300050515 | Bacteria | 4757 |
| 325 | Ga0495601_0000038 | 3300053077 | Bacteria | 81122 |
| 326 | Ga0495601_0000071 | 3300053077 | Bacteria | 56206 |
| 327 | Ga0495601_0013366 | 3300053077 | Bacteria | 4935 |
| 328 | Ga0495612_0000110 | 3300053078 | Bacteria | 34644 |
| 329 | Ga0495612_0001018 | 3300053078 | Bacteria | 11500 |
| 330 | Ga0495612_0013553 | 3300053078 | Bacteria | 3283 |
| 331 | Ga0495655_0000002 | 3300053083 | Bacteria | 312752 |
| 332 | Ga0495595_0000002 | 3300053084 | Bacteria | 445641 |
| 333 | Ga0495595_0000157 | 3300053084 | Bacteria | 26977 |
| 334 | Ga0495595_0001559 | 3300053084 | Bacteria | 8940 |
| 335 | Ga0495619_0000008 | 3300053085 | Bacteria | 305999 |
| 336 | Ga0495619_0000053 | 3300053085 | Bacteria | 98761 |
| 337 | Ga0495619_0000081 | 3300053085 | Bacteria | 72034 |
| 338 | Ga0495619_0001401 | 3300053085 | Bacteria | 15847 |
| 339 | Ga0495619_0001798 | 3300053085 | Bacteria | 14256 |
| 340 | Ga0500566_0012133 | 3300053094 | Bacteria | 5073 |
| 341 | Ga0500595_014385 | 3300053119 | Bacteria | 3002 |
| 342 | Ga0500614_000078 | 3300053123 | Bacteria | 21505 |
| 343 | Ga0500628_000001 | 3300053129 | Bacteria | 564074 |
| 344 | Ga0501082_0003986 | 3300060353 | Bacteria | 12888 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300048924 | Ga0496121_0054181 | Ga0496121_0054181_955_3330 | 673 |
| 2 | 3300028563 | Ga0265319_1000014 | Ga0265319_1000014123 | 730 |
| 3 | 3300028800 | Ga0265338_10000185 | Ga0265338_10000185121 | 730 |
| 4 | 3300044694 | Ga0466963_0000004 | Ga0466963_0000004_39489_42110 | 738 |
| 5 | 3300053119 | Ga0500595_014385 | Ga0500595_014385_484_2985 | 766 |
| 6 | 3300005365 | Ga0070688_100000169 | Ga0070688_10000016930 | 771 |
| 7 | 3300005466 | Ga0070685_10000019 | Ga0070685_100000197 | 771 |
| 8 | 3300005329 | Ga0070683_100006350 | Ga0070683_1000063504 | 774 |
| 9 | 3300025944 | Ga0207661_10000220 | Ga0207661_1000022013 | 774 |
| 10 | 3300005459 | Ga0068867_100000750 | Ga0068867_1000007505 | 776 |
| 11 | 3300026089 | Ga0207648_10001987 | Ga0207648_100019876 | 776 |
| 12 | 3300046454 | Ga0495592_0000078 | Ga0495592_0000078_46374_48995 | 776 |
| 13 | 3300046690 | Ga0495624_0000405 | Ga0495624_0000405_7905_10541 | 777 |
| 14 | 3300048903 | Ga0496100_0000001 | Ga0496100_0000001_299350_301971 | 777 |
| 15 | 3300048904 | Ga0496101_0000004 | Ga0496101_0000004_100702_103323 | 777 |
| 16 | 3300048909 | Ga0496106_0000056 | Ga0496106_0000056_21675_24296 | 777 |
| 17 | 3300048910 | Ga0496107_0000005 | Ga0496107_0000005_228277_230898 | 777 |
| 18 | 3300006175 | Ga0070712_100010956 | Ga0070712_1000109562 | 778 |
| 19 | 3300009098 | Ga0105245_10006082 | Ga0105245_100060827 | 778 |
| 20 | 3300025915 | Ga0207693_10006680 | Ga0207693_100066803 | 778 |
| 21 | 3300046529 | Ga0495652_0038776 | Ga0495652_0038776_1186_3813 | 778 |
| 22 | 3300048910 | Ga0496107_0052635 | Ga0496107_0052635_155_2761 | 778 |
| 23 | 3300048913 | Ga0496110_0007161 | Ga0496110_0007161_3646_6252 | 778 |
| 24 | 3300048914 | Ga0496111_0011444 | Ga0496111_0011444_2124_4730 | 778 |
| 25 | 3300048917 | Ga0496114_0042332 | Ga0496114_0042332_274_2880 | 778 |
| 26 | 3300014326 | Ga0157380_10001547 | Ga0157380_100015475 | 783 |
| 27 | 3300048911 | Ga0496108_0000582 | Ga0496108_0000582_22899_25574 | 783 |
| 28 | 3300048912 | Ga0496109_0000446 | Ga0496109_0000446_3726_6401 | 783 |
| 29 | 3300006048 | Ga0075363_100017754 | Ga0075363_1000177542 | 787 |
| 30 | 3300005981 | Ga0081538_10000189 | Ga0081538_1000018915 | 788 |
| 31 | 3300046459 | Ga0495629_0001644 | Ga0495629_0001644_9145_11769 | 788 |
| 32 | 3300048903 | Ga0496100_0000061 | Ga0496100_0000061_18710_21385 | 788 |
| 33 | 3300048904 | Ga0496101_0000141 | Ga0496101_0000141_18710_21385 | 788 |
| 34 | 3300048909 | Ga0496106_0000094 | Ga0496106_0000094_18710_21385 | 788 |
| 35 | 3300048910 | Ga0496107_0000045 | Ga0496107_0000045_46047_48722 | 788 |
| 36 | 3300053094 | Ga0500566_0012133 | Ga0500566_0012133_577_3201 | 788 |
| 37 | 3300037466 | Ga0395898_0008138 | Ga0395898_0008138_1232_3838 | 790 |
| 38 | 3300038443 | Ga0395901_0016091 | Ga0395901_0016091_2096_4702 | 790 |
| 39 | 3300048917 | Ga0496114_0000171 | Ga0496114_0000171_16997_19681 | 790 |
| 40 | 3300048918 | Ga0496115_0001687 | Ga0496115_0001687_10716_13400 | 790 |
| 41 | 3300046499 | Ga0495594_0000045 | Ga0495594_0000045_36713_39337 | 791 |
| 42 | 3300005548 | Ga0070665_100011747 | Ga0070665_1000117476 | 792 |
| 43 | 3300028379 | Ga0268266_10000376 | Ga0268266_1000037640 | 792 |
| 44 | 3300046557 | Ga0495622_0001452 | Ga0495622_0001452_1634_4318 | 792 |
| 45 | 3300005618 | Ga0068864_100000015 | Ga0068864_100000015110 | 793 |
| 46 | 3300026095 | Ga0207676_10000018 | Ga0207676_10000018190 | 793 |
| 47 | 3300005347 | Ga0070668_100025920 | Ga0070668_1000259203 | 794 |
| 48 | 3300005844 | Ga0068862_100002034 | Ga0068862_1000020342 | 794 |
| 49 | 3300025961 | Ga0207712_10005524 | Ga0207712_100055246 | 794 |
| 50 | 3300028380 | Ga0268265_10000985 | Ga0268265_1000098518 | 794 |
| 51 | 3300048928 | Ga0496125_0017097 | Ga0496125_0017097_3725_6337 | 794 |
| 52 | 3300005937 | Ga0081455_10006044 | Ga0081455_1000604410 | 795 |
| 53 | 3300010375 | Ga0105239_10052400 | Ga0105239_100524003 | 795 |
| 54 | 3300046517 | Ga0495630_0000014 | Ga0495630_0000014_31648_34284 | 795 |
| 55 | 3300048917 | Ga0496114_0004008 | Ga0496114_0004008_267_2822 | 795 |
| 56 | 3300049568 | Ga0501031_0000147 | Ga0501031_0000147_16184_18802 | 795 |
| 57 | 3300049569 | Ga0501032_0000328 | Ga0501032_0000328_21001_23619 | 795 |
| 58 | 3300049570 | Ga0501033_0000261 | Ga0501033_0000261_21186_23804 | 795 |
| 59 | 3300049571 | Ga0501034_0007529 | Ga0501034_0007529_6143_8761 | 795 |
| 60 | 3300049572 | Ga0501036_0002670 | Ga0501036_0002670_7902_10520 | 795 |
| 61 | 3300049573 | Ga0501037_0000221 | Ga0501037_0000221_26138_28756 | 795 |
| 62 | 3300049574 | Ga0501038_0000101 | Ga0501038_0000101_20882_23500 | 795 |
| 63 | 3300049576 | Ga0501040_0020469 | Ga0501040_0020469_1044_3662 | 795 |
| 64 | 3300049579 | Ga0501043_0000237 | Ga0501043_0000237_20906_23524 | 795 |
| 65 | 3300049580 | Ga0501046_0000608 | Ga0501046_0000608_11564_14182 | 795 |
| 66 | 3300049581 | Ga0501047_0000376 | Ga0501047_0000376_21129_23747 | 795 |
| 67 | 3300049582 | Ga0501048_0002386 | Ga0501048_0002386_46_2673 | 795 |
| 68 | 3300049584 | Ga0501068_0032682 | Ga0501068_0032682_328_2946 | 795 |
| 69 | 3300049586 | Ga0501070_0000178 | Ga0501070_0000178_28159_30777 | 795 |
| 70 | 3300049589 | Ga0501073_0000255 | Ga0501073_0000255_20890_23508 | 795 |
| 71 | 3300049590 | Ga0501074_0006995 | Ga0501074_0006995_2805_5423 | 795 |
| 72 | 3300049741 | Ga0501079_0033584 | Ga0501079_0033584_365_2983 | 795 |
| 73 | 3300049744 | Ga0501083_0001338 | Ga0501083_0001338_10614_13232 | 795 |
| 74 | 3300049822 | Ga0501035_0000616 | Ga0501035_0000616_8440_11058 | 795 |
| 75 | 3300049823 | Ga0501044_0000416 | Ga0501044_0000416_26639_29257 | 795 |
| 76 | 3300060353 | Ga0501082_0003986 | Ga0501082_0003986_6137_8755 | 795 |
| 77 | 3300046511 | Ga0495608_0000007 | Ga0495608_0000007_223429_226074 | 796 |
| 78 | 3300046675 | Ga0495657_0000001 | Ga0495657_0000001_355575_358220 | 796 |
| 79 | 3300047444 | Ga0495675_0000017 | Ga0495675_0000017_87428_90073 | 796 |
| 80 | 3300048907 | Ga0496104_0005958 | Ga0496104_0005958_6296_8914 | 796 |
| 81 | 3300048922 | Ga0496119_0011461 | Ga0496119_0011461_4154_6772 | 796 |
| 82 | 3300053084 | Ga0495595_0000002 | Ga0495595_0000002_87422_90067 | 796 |
| 83 | 3300053085 | Ga0495619_0000053 | Ga0495619_0000053_41080_43725 | 796 |
| 84 | 3300005344 | Ga0070661_100000145 | Ga0070661_10000014524 | 797 |
| 85 | 3300025920 | Ga0207649_10000003 | Ga0207649_10000003387 | 797 |
| 86 | 3300046536 | Ga0495587_0027493 | Ga0495587_0027493_492_3125 | 797 |
| 87 | 3300048907 | Ga0496104_0000025 | Ga0496104_0000025_110894_113515 | 798 |
| 88 | 3300048908 | Ga0496105_0000023 | Ga0496105_0000023_110894_113515 | 798 |
| 89 | 3300053077 | Ga0495601_0000038 | Ga0495601_0000038_66172_68811 | 798 |
| 90 | 3300013308 | Ga0157375_10003527 | Ga0157375_100035272 | 799 |
| 91 | 3300046514 | Ga0495618_0000014 | Ga0495618_0000014_27106_29727 | 799 |
| 92 | 3300047321 | Ga0495676_0000186 | Ga0495676_0000186_20518_23139 | 799 |
| 93 | 3300005578 | Ga0068854_100000113 | Ga0068854_10000011337 | 800 |
| 94 | 3300006846 | Ga0075430_100018768 | Ga0075430_1000187684 | 800 |
| 95 | 3300009148 | Ga0105243_10037576 | Ga0105243_100375762 | 800 |
| 96 | 3300013307 | Ga0157372_10000060 | Ga0157372_1000006071 | 800 |
| 97 | 3300025981 | Ga0207640_10000401 | Ga0207640_100004017 | 800 |
| 98 | 3300037466 | Ga0395898_0008295 | Ga0395898_0008295_8098_10704 | 800 |
| 99 | 3300046517 | Ga0495630_0041656 | Ga0495630_0041656_479_3094 | 800 |
| 100 | 3300046681 | Ga0495647_0000021 | Ga0495647_0000021_17578_20199 | 800 |
| 101 | 3300009148 | Ga0105243_10008343 | Ga0105243_100083436 | 801 |
| 102 | 3300048088 | Ga0495602_0000775 | Ga0495602_0000775_5510_8143 | 801 |
| 103 | 3300005439 | Ga0070711_100004900 | Ga0070711_1000049002 | 802 |
| 104 | 3300005455 | Ga0070663_100002374 | Ga0070663_1000023745 | 802 |
| 105 | 3300005530 | Ga0070679_100002847 | Ga0070679_1000028475 | 802 |
| 106 | 3300025914 | Ga0207671_10047639 | Ga0207671_100476392 | 802 |
| 107 | 3300025916 | Ga0207663_10002979 | Ga0207663_100029792 | 802 |
| 108 | 3300025921 | Ga0207652_10002784 | Ga0207652_100027846 | 802 |
| 109 | 3300026067 | Ga0207678_10000556 | Ga0207678_100005563 | 802 |
| 110 | 3300046523 | Ga0495644_0000139 | Ga0495644_0000139_4549_7170 | 802 |
| 111 | 3300046660 | Ga0495625_0000032 | Ga0495625_0000032_196460_199093 | 802 |
| 112 | 3300046642 | Ga0495634_0000045 | Ga0495634_0000045_74239_76863 | 803 |
| 113 | 3300006038 | Ga0075365_10013423 | Ga0075365_100134233 | 804 |
| 114 | 3300046461 | Ga0495641_0018672 | Ga0495641_0018672_119_2755 | 804 |
| 115 | 3300046516 | Ga0495628_0000808 | Ga0495628_0000808_9120_11753 | 804 |
| 116 | 3300005614 | Ga0068856_100004779 | Ga0068856_1000047792 | 805 |
| 117 | 3300013296 | Ga0157374_10010565 | Ga0157374_100105655 | 805 |
| 118 | 3300026078 | Ga0207702_10002397 | Ga0207702_1000239715 | 805 |
| 119 | 3300047317 | Ga0495604_0000577 | Ga0495604_0000577_16309_18948 | 805 |
| 120 | 3300005983 | Ga0081540_1000628 | Ga0081540_100062811 | 806 |
| 121 | 3300005337 | Ga0070682_100000011 | Ga0070682_10000001198 | 807 |
| 122 | 3300005354 | Ga0070675_100000776 | Ga0070675_10000077617 | 807 |
| 123 | 3300025926 | Ga0207659_10000013 | Ga0207659_10000013165 | 807 |
| 124 | 3300046674 | Ga0495588_0000203 | Ga0495588_0000203_48341_50995 | 807 |
| 125 | 3300053085 | Ga0495619_0000081 | Ga0495619_0000081_19196_21832 | 807 |
| 126 | 3300005338 | Ga0068868_100000453 | Ga0068868_10000045321 | 808 |
| 127 | 3300026023 | Ga0207677_10000203 | Ga0207677_1000020321 | 808 |
| 128 | 3300046689 | Ga0495613_0000032 | Ga0495613_0000032_38756_41395 | 808 |
| 129 | 3300046689 | Ga0495613_0000005 | Ga0495613_0000005_183772_186393 | 809 |
| 130 | 3300006852 | Ga0075433_10040385 | Ga0075433_100403852 | 810 |
| 131 | 3300009098 | Ga0105245_10002028 | Ga0105245_100020283 | 810 |
| 132 | 3300046615 | Ga0495656_0002864 | Ga0495656_0002864_248_2872 | 810 |
| 133 | 3300048918 | Ga0496115_0000011 | Ga0496115_0000011_181967_184591 | 810 |
| 134 | 3300046455 | Ga0495603_0001813 | Ga0495603_0001813_816_3440 | 811 |
| 135 | 3300046529 | Ga0495652_0000010 | Ga0495652_0000010_148058_150763 | 811 |
| 136 | 3300048914 | Ga0496111_0026207 | Ga0496111_0026207_524_3148 | 811 |
| 137 | 3300048923 | Ga0496120_0002463 | Ga0496120_0002463_4210_6864 | 811 |
| 138 | 3300049578 | Ga0501042_0010905 | Ga0501042_0010905_1697_4324 | 811 |
| 139 | 3300005985 | Ga0081539_10003342 | Ga0081539_100033429 | 812 |
| 140 | 3300006038 | Ga0075365_10012463 | Ga0075365_100124633 | 812 |
| 141 | 3300014968 | Ga0157379_10013172 | Ga0157379_100131724 | 813 |
| 142 | 3300047321 | Ga0495676_0000956 | Ga0495676_0000956_13531_16206 | 813 |
| 143 | 3300048909 | Ga0496106_0000030 | Ga0496106_0000030_84813_87437 | 813 |
| 144 | 3300048910 | Ga0496107_0026157 | Ga0496107_0026157_1347_3971 | 813 |
| 145 | 3300048912 | Ga0496109_0000056 | Ga0496109_0000056_103070_105703 | 813 |
| 146 | 3300049571 | Ga0501034_0021429 | Ga0501034_0021429_3131_5758 | 813 |
| 147 | 3300025915 | Ga0207693_10007008 | Ga0207693_100070087 | 814 |
| 148 | 3300026023 | Ga0207677_10000379 | Ga0207677_1000037910 | 814 |
| 149 | 3300046515 | Ga0495620_0000092 | Ga0495620_0000092_46990_49635 | 815 |
| 150 | 3300046691 | Ga0495670_0012015 | Ga0495670_0012015_161_2857 | 815 |
| 151 | 3300048905 | Ga0496102_0001710 | Ga0496102_0001710_15527_18157 | 815 |
| 152 | 3300048920 | Ga0496117_0006020 | Ga0496117_0006020_6144_8774 | 815 |
| 153 | 3300048921 | Ga0496118_0000790 | Ga0496118_0000790_22545_25175 | 815 |
| 154 | 3300053077 | Ga0495601_0000071 | Ga0495601_0000071_21491_24112 | 815 |
| 155 | 3300005333 | Ga0070677_10000044 | Ga0070677_1000004430 | 816 |
| 156 | 3300005337 | Ga0070682_100000078 | Ga0070682_10000007843 | 816 |
| 157 | 3300005530 | Ga0070679_100000129 | Ga0070679_10000012941 | 816 |
| 158 | 3300009553 | Ga0105249_10000076 | Ga0105249_10000076110 | 816 |
| 159 | 3300025893 | Ga0207682_10000497 | Ga0207682_1000049712 | 816 |
| 160 | 3300025921 | Ga0207652_10000211 | Ga0207652_1000021141 | 816 |
| 161 | 3300046473 | Ga0495582_0000009 | Ga0495582_0000009_118824_121445 | 816 |
| 162 | 3300046683 | Ga0495658_0000002 | Ga0495658_0000002_118819_121440 | 816 |
| 163 | 3300048913 | Ga0496110_0000114 | Ga0496110_0000114_34327_36963 | 816 |
| 164 | 3300048914 | Ga0496111_0000008 | Ga0496111_0000008_44057_46693 | 816 |
| 165 | 3300049744 | Ga0501083_0023901 | Ga0501083_0023901_866_3493 | 816 |
| 166 | 3300005364 | Ga0070673_100002354 | Ga0070673_1000023546 | 817 |
| 167 | 3300005548 | Ga0070665_100000141 | Ga0070665_10000014145 | 817 |
| 168 | 3300005842 | Ga0068858_100001913 | Ga0068858_10000191315 | 817 |
| 169 | 3300009098 | Ga0105245_10000315 | Ga0105245_1000031526 | 817 |
| 170 | 3300025903 | Ga0207680_10021371 | Ga0207680_100213711 | 817 |
| 171 | 3300025927 | Ga0207687_10000112 | Ga0207687_1000011236 | 817 |
| 172 | 3300025944 | Ga0207661_10013614 | Ga0207661_100136144 | 817 |
| 173 | 3300026035 | Ga0207703_10000061 | Ga0207703_1000006115 | 817 |
| 174 | 3300028379 | Ga0268266_10000056 | Ga0268266_1000005654 | 817 |
| 175 | 3300028379 | Ga0268266_10000160 | Ga0268266_1000016051 | 817 |
| 176 | 3300046461 | Ga0495641_0000005 | Ga0495641_0000005_56010_58631 | 817 |
| 177 | 3300053085 | Ga0495619_0001798 | Ga0495619_0001798_3345_6044 | 817 |
| 178 | 3300053123 | Ga0500614_000078 | Ga0500614_000078_14128_16749 | 817 |
| 179 | 3300005981 | Ga0081538_10004164 | Ga0081538_100041646 | 818 |
| 180 | 3300025960 | Ga0207651_10001628 | Ga0207651_100016284 | 818 |
| 181 | 3300046517 | Ga0495630_0000062 | Ga0495630_0000062_10420_13140 | 818 |
| 182 | 3300046675 | Ga0495657_0002432 | Ga0495657_0002432_11498_14119 | 818 |
| 183 | 3300048911 | Ga0496108_0000164 | Ga0496108_0000164_19120_21795 | 818 |
| 184 | 3300048912 | Ga0496109_0000180 | Ga0496109_0000180_40875_43550 | 818 |
| 185 | 3300048918 | Ga0496115_0009515 | Ga0496115_0009515_2253_4877 | 818 |
| 186 | 3300048919 | Ga0496116_0000367 | Ga0496116_0000367_38343_40967 | 818 |
| 187 | 3300048922 | Ga0496119_0003161 | Ga0496119_0003161_14022_16646 | 818 |
| 188 | 3300048924 | Ga0496121_0014139 | Ga0496121_0014139_3331_6009 | 818 |
| 189 | 3300050511 | nmdc:mga08y16_69862_c1 | nmdc:mga08y16_69862_c1_732_3365 | 818 |
| 190 | 3300050515 | nmdc:mga0a205_35959_c1 | nmdc:mga0a205_35959_c1_820_3453 | 818 |
| 191 | 3300005457 | Ga0070662_100000002 | Ga0070662_100000002150 | 819 |
| 192 | 3300025933 | Ga0207706_10000001 | Ga0207706_10000001332 | 819 |
| 193 | 3300037466 | Ga0395898_0035692 | Ga0395898_0035692_288_2903 | 819 |
| 194 | 3300048088 | Ga0495602_0000007 | Ga0495602_0000007_57199_59835 | 819 |
| 195 | 3300048907 | Ga0496104_0000133 | Ga0496104_0000133_16121_18745 | 819 |
| 196 | 3300048908 | Ga0496105_0000187 | Ga0496105_0000187_22514_25138 | 819 |
| 197 | 3300005356 | Ga0070674_100000002 | Ga0070674_100000002253 | 820 |
| 198 | 3300005718 | Ga0068866_10000020 | Ga0068866_1000002028 | 820 |
| 199 | 3300005937 | Ga0081455_10051084 | Ga0081455_100510842 | 820 |
| 200 | 3300025899 | Ga0207642_10002332 | Ga0207642_100023323 | 820 |
| 201 | 3300025937 | Ga0207669_10000003 | Ga0207669_1000000342 | 820 |
| 202 | 3300025961 | Ga0207712_10000052 | Ga0207712_1000005221 | 820 |
| 203 | 3300046476 | Ga0495662_0000001 | Ga0495662_0000001_89863_92484 | 820 |
| 204 | 3300005539 | Ga0068853_100016808 | Ga0068853_1000168084 | 821 |
| 205 | 3300026041 | Ga0207639_10012864 | Ga0207639_100128642 | 821 |
| 206 | 3300046511 | Ga0495608_0000240 | Ga0495608_0000240_19124_21745 | 821 |
| 207 | 3300049571 | Ga0501034_0027628 | Ga0501034_0027628_363_2987 | 821 |
| 208 | 3300053078 | Ga0495612_0001018 | Ga0495612_0001018_7932_10580 | 821 |
| 209 | 3300005366 | Ga0070659_100006296 | Ga0070659_1000062967 | 822 |
| 210 | 3300005841 | Ga0068863_100000129 | Ga0068863_10000012951 | 822 |
| 211 | 3300006852 | Ga0075433_10000002 | Ga0075433_1000000224 | 822 |
| 212 | 3300017792 | Ga0163161_10000022 | Ga0163161_1000002280 | 822 |
| 213 | 3300026088 | Ga0207641_10000016 | Ga0207641_1000001671 | 822 |
| 214 | 3300046517 | Ga0495630_0006859 | Ga0495630_0006859_1172_3793 | 822 |
| 215 | 3300046559 | Ga0495667_0000045 | Ga0495667_0000045_27731_30373 | 822 |
| 216 | 3300047322 | Ga0495680_0000114 | Ga0495680_0000114_17704_20325 | 822 |
| 217 | 3300047322 | Ga0495680_0000602 | Ga0495680_0000602_27718_30360 | 822 |
| 218 | 3300049568 | Ga0501031_0046728 | Ga0501031_0046728_94_2718 | 822 |
| 219 | 3300009551 | Ga0105238_10000048 | Ga0105238_1000004839 | 823 |
| 220 | 3300025924 | Ga0207694_10000056 | Ga0207694_1000005639 | 823 |
| 221 | 3300026121 | Ga0207683_10022226 | Ga0207683_100222263 | 823 |
| 222 | 3300046690 | Ga0495624_0000095 | Ga0495624_0000095_185_2806 | 823 |
| 223 | 3300048915 | Ga0496112_0001447 | Ga0496112_0001447_9895_12543 | 823 |
| 224 | 3300048916 | Ga0496113_0000099 | Ga0496113_0000099_21919_24567 | 823 |
| 225 | 3300049591 | Ga0501075_0001056 | Ga0501075_0001056_7109_9727 | 823 |
| 226 | 3300050515 | nmdc:mga0a205_13_c1 | nmdc:mga0a205_13_c1_22496_25120 | 823 |
| 227 | 3300053084 | Ga0495595_0000157 | Ga0495595_0000157_2974_5595 | 823 |
| 228 | 3300006881 | Ga0068865_100000094 | Ga0068865_10000009439 | 824 |
| 229 | 3300025938 | Ga0207704_10000088 | Ga0207704_1000008813 | 824 |
| 230 | 3300046459 | Ga0495629_0000106 | Ga0495629_0000106_9853_12489 | 824 |
| 231 | 3300046663 | Ga0495635_0022902 | Ga0495635_0022902_1296_3989 | 824 |
| 232 | 3300048905 | Ga0496102_0000801 | Ga0496102_0000801_591_3242 | 824 |
| 233 | 3300048906 | Ga0496103_0000057 | Ga0496103_0000057_7129_9780 | 824 |
| 234 | 3300048912 | Ga0496109_0000012 | Ga0496109_0000012_110316_112952 | 824 |
| 235 | 3300049586 | Ga0501070_0009297 | Ga0501070_0009297_3753_6413 | 824 |
| 236 | 3300005841 | Ga0068863_100025421 | Ga0068863_1000254212 | 825 |
| 237 | 3300025321 | Ga0207656_10001014 | Ga0207656_100010147 | 825 |
| 238 | 3300026088 | Ga0207641_10005756 | Ga0207641_100057566 | 825 |
| 239 | 3300044694 | Ga0466963_0038757 | Ga0466963_0038757_101_2737 | 825 |
| 240 | 3300047322 | Ga0495680_0000267 | Ga0495680_0000267_19750_22374 | 825 |
| 241 | 3300006163 | Ga0070715_10000029 | Ga0070715_1000002979 | 826 |
| 242 | 3300009176 | Ga0105242_10000059 | Ga0105242_1000005945 | 826 |
| 243 | 3300025905 | Ga0207685_10000031 | Ga0207685_1000003111 | 826 |
| 244 | 3300025934 | Ga0207686_10000116 | Ga0207686_100001162 | 826 |
| 245 | 3300005843 | Ga0068860_100002215 | Ga0068860_10000221516 | 827 |
| 246 | 3300009098 | Ga0105245_10001571 | Ga0105245_100015716 | 827 |
| 247 | 3300013308 | Ga0157375_10000171 | Ga0157375_1000017142 | 827 |
| 248 | 3300025927 | Ga0207687_10004413 | Ga0207687_100044136 | 827 |
| 249 | 3300028381 | Ga0268264_10001600 | Ga0268264_1000160016 | 827 |
| 250 | 3300032126 | Ga0307415_100000776 | Ga0307415_10000077610 | 827 |
| 251 | 3300046507 | Ga0495606_0000040 | Ga0495606_0000040_181032_183680 | 827 |
| 252 | 3300050515 | nmdc:mga0a205_14130_c2 | nmdc:mga0a205_14130_c2_3120_5744 | 827 |
| 253 | 3300053084 | Ga0495595_0001559 | Ga0495595_0001559_5532_8168 | 827 |
| 254 | 3300053085 | Ga0495619_0001401 | Ga0495619_0001401_7192_9819 | 827 |
| 255 | 3300005341 | Ga0070691_10000002 | Ga0070691_1000000227 | 828 |
| 256 | 3300006846 | Ga0075430_100041396 | Ga0075430_1000413963 | 828 |
| 257 | 3300021388 | Ga0213875_10005171 | Ga0213875_100051715 | 829 |
| 258 | 3300037853 | Ga0436364_1521721 | Ga0436364_1521721_4500_7142 | 829 |
| 259 | 3300046455 | Ga0495603_0000128 | Ga0495603_0000128_26289_28916 | 829 |
| 260 | 3300048907 | Ga0496104_0000015 | Ga0496104_0000015_125412_128057 | 829 |
| 261 | 3300048908 | Ga0496105_0000004 | Ga0496105_0000004_347742_350387 | 829 |
| 262 | 3300053077 | Ga0495601_0013366 | Ga0495601_0013366_133_2781 | 829 |
| 263 | 3300005337 | Ga0070682_100001072 | Ga0070682_1000010723 | 830 |
| 264 | 3300005439 | Ga0070711_100026045 | Ga0070711_1000260452 | 830 |
| 265 | 3300005842 | Ga0068858_100000120 | Ga0068858_1000001204 | 830 |
| 266 | 3300006175 | Ga0070712_100010993 | Ga0070712_1000109932 | 830 |
| 267 | 3300006847 | Ga0075431_100020953 | Ga0075431_1000209533 | 830 |
| 268 | 3300009147 | Ga0114129_10029330 | Ga0114129_100293306 | 830 |
| 269 | 3300010375 | Ga0105239_10075197 | Ga0105239_100751972 | 830 |
| 270 | 3300013104 | Ga0157370_10005610 | Ga0157370_100056107 | 830 |
| 271 | 3300013307 | Ga0157372_10035599 | Ga0157372_100355992 | 830 |
| 272 | 3300014326 | Ga0157380_10000439 | Ga0157380_1000043923 | 830 |
| 273 | 3300014745 | Ga0157377_10018369 | Ga0157377_100183691 | 830 |
| 274 | 3300025901 | Ga0207688_10001625 | Ga0207688_1000162510 | 830 |
| 275 | 3300025915 | Ga0207693_10022874 | Ga0207693_100228742 | 830 |
| 276 | 3300026035 | Ga0207703_10000018 | Ga0207703_10000018247 | 830 |
| 277 | 3300026075 | Ga0207708_10001138 | Ga0207708_1000113816 | 830 |
| 278 | 3300048905 | Ga0496102_0045550 | Ga0496102_0045550_1112_3748 | 830 |
| 279 | 3300048907 | Ga0496104_0060170 | Ga0496104_0060170_842_3478 | 830 |
| 280 | 3300048910 | Ga0496107_0010510 | Ga0496107_0010510_3140_5776 | 830 |
| 281 | 3300048911 | Ga0496108_0028301 | Ga0496108_0028301_1010_3646 | 830 |
| 282 | 3300048913 | Ga0496110_0018768 | Ga0496110_0018768_491_3127 | 830 |
| 283 | 3300048916 | Ga0496113_0010910 | Ga0496113_0010910_3022_5658 | 830 |
| 284 | 3300050507 | nmdc:mga05p37_78642_c1 | nmdc:mga05p37_78642_c1_296_2902 | 830 |
| 285 | 3300050512 | nmdc:mga0n895_77666_c1 | nmdc:mga0n895_77666_c1_128_2734 | 830 |
| 286 | 3300053078 | Ga0495612_0013553 | Ga0495612_0013553_222_2867 | 830 |
| 287 | 3300005356 | Ga0070674_100000007 | Ga0070674_10000000771 | 831 |
| 288 | 3300005436 | Ga0070713_100001073 | Ga0070713_1000010739 | 831 |
| 289 | 3300005718 | Ga0068866_10000003 | Ga0068866_10000003212 | 831 |
| 290 | 3300025899 | Ga0207642_10000002 | Ga0207642_10000002463 | 831 |
| 291 | 3300025928 | Ga0207700_10000033 | Ga0207700_10000033115 | 831 |
| 292 | 3300025937 | Ga0207669_10000001 | Ga0207669_1000000179 | 831 |
| 293 | 3300047317 | Ga0495604_0000067 | Ga0495604_0000067_31264_33984 | 831 |
| 294 | 3300009101 | Ga0105247_10000347 | Ga0105247_100003478 | 832 |
| 295 | 3300009176 | Ga0105242_10001472 | Ga0105242_1000147217 | 832 |
| 296 | 3300025900 | Ga0207710_10000631 | Ga0207710_1000063111 | 832 |
| 297 | 3300025934 | Ga0207686_10000888 | Ga0207686_100008884 | 832 |
| 298 | 3300046684 | Ga0495669_0000051 | Ga0495669_0000051_24838_27513 | 832 |
| 299 | 3300048911 | Ga0496108_0002101 | Ga0496108_0002101_11779_14418 | 832 |
| 300 | 3300005985 | Ga0081539_10011125 | Ga0081539_100111252 | 833 |
| 301 | 3300028556 | Ga0265337_1000007 | Ga0265337_100000727 | 833 |
| 302 | 3300028558 | Ga0265326_10000019 | Ga0265326_1000001925 | 833 |
| 303 | 3300028654 | Ga0265322_10000011 | Ga0265322_1000001125 | 833 |
| 304 | 3300029957 | Ga0265324_10000997 | Ga0265324_100009973 | 833 |
| 305 | 3300031240 | Ga0265320_10000011 | Ga0265320_1000001125 | 833 |
| 306 | 3300031250 | Ga0265331_10004136 | Ga0265331_100041363 | 833 |
| 307 | 3300031251 | Ga0265327_10000015 | Ga0265327_10000015133 | 833 |
| 308 | 3300031711 | Ga0265314_10000119 | Ga0265314_10000119102 | 833 |
| 309 | 3300046535 | Ga0495586_0000959 | Ga0495586_0000959_3197_5818 | 833 |
| 310 | 3300047472 | Ga0495686_0000008 | Ga0495686_0000008_268195_270861 | 833 |
| 311 | 3300047472 | Ga0495686_0008569 | Ga0495686_0008569_3376_6030 | 833 |
| 312 | 3300053085 | Ga0495619_0000008 | Ga0495619_0000008_85353_87977 | 833 |
| 313 | 3300005543 | Ga0070672_100000001 | Ga0070672_100000001198 | 834 |
| 314 | 3300009177 | Ga0105248_10000020 | Ga0105248_10000020228 | 834 |
| 315 | 3300025940 | Ga0207691_10000017 | Ga0207691_10000017123 | 834 |
| 316 | 3300025941 | Ga0207711_10000006 | Ga0207711_10000006150 | 834 |
| 317 | 3300045976 | Ga0466967_0002279 | Ga0466967_0002279_581_3256 | 834 |
| 318 | 3300046461 | Ga0495641_0000111 | Ga0495641_0000111_20904_23570 | 834 |
| 319 | 3300053078 | Ga0495612_0000110 | Ga0495612_0000110_16403_19027 | 836 |
| 320 | 3300005616 | Ga0068852_100000002 | Ga0068852_100000002123 | 837 |
| 321 | 3300006847 | Ga0075431_100045799 | Ga0075431_1000457992 | 837 |
| 322 | 3300006871 | Ga0075434_100016456 | Ga0075434_1000164562 | 837 |
| 323 | 3300009147 | Ga0114129_10021452 | Ga0114129_100214527 | 837 |
| 324 | 3300026142 | Ga0207698_10000004 | Ga0207698_10000004162 | 837 |
| 325 | 3300046463 | Ga0495653_0010945 | Ga0495653_0010945_2467_5106 | 837 |
| 326 | 3300050507 | nmdc:mga05p37_22310_c1 | nmdc:mga05p37_22310_c1_1735_4377 | 837 |
| 327 | 3300050512 | nmdc:mga0n895_32748_c1 | nmdc:mga0n895_32748_c1_1939_4581 | 837 |
| 328 | 3300046663 | Ga0495635_0000031 | Ga0495635_0000031_27466_30087 | 838 |
| 329 | 3300047319 | Ga0495674_0000010 | Ga0495674_0000010_54693_57317 | 838 |
| 330 | 3300046516 | Ga0495628_0011425 | Ga0495628_0011425_1491_4151 | 839 |
| 331 | 3300048915 | Ga0496112_0000006 | Ga0496112_0000006_32182_34815 | 839 |
| 332 | 3300053083 | Ga0495655_0000002 | Ga0495655_0000002_29150_31798 | 840 |
| 333 | 3300053129 | Ga0500628_000001 | Ga0500628_000001_117820_120468 | 840 |
| 334 | 3300005614 | Ga0068856_100001668 | Ga0068856_10000166815 | 843 |
| 335 | 3300026078 | Ga0207702_10000076 | Ga0207702_1000007660 | 843 |
| 336 | 3300026078 | Ga0207702_10008407 | Ga0207702_100084074 | 843 |
| 337 | 3300044842 | Ga0466957_0008131 | Ga0466957_0008131_1142_3775 | 843 |
| 338 | 3300005365 | Ga0070688_100002791 | Ga0070688_1000027913 | 844 |
| 339 | 3300009098 | Ga0105245_10000026 | Ga0105245_1000002694 | 844 |
| 340 | 3300013105 | Ga0157369_10000014 | Ga0157369_1000001425 | 844 |
| 341 | 3300025927 | Ga0207687_10000017 | Ga0207687_1000001788 | 844 |
| 342 | 3300045976 | Ga0466967_0000001 | Ga0466967_0000001_205731_208382 | 844 |
| 343 | 3300013102 | Ga0157371_10009163 | Ga0157371_100091635 | 847 |
| 344 | 3300001977 | JGI24746J21847_1001074 | JGI24746J21847_10010743 | 848 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1v4p-assembly3.cif.gz_C | crystal structure of alanyl-trna synthetase from pyrococcus horikoshii ot3 | 0.9196 | 546 | 685 |
| 4xem-assembly1.cif.gz_A | crystal structure of wild type human alars catalytic domain | 0.9104 | 1 | 354 |
| 5v59-assembly1.cif.gz_A | crystal structure of catalytic fragment of human alars in complex with aze-sa | 0.9077 | 1 | 354 |
| 4xeo-assembly2.cif.gz_B | crystal structure of human alars catalytic domain with r329h mutation | 0.9045 | 1 | 357 |
| 3htz-assembly1.cif.gz_A | crystal structure of the catalytic fragment of alanyl-trna synthetase in complex with l-serine: re-refined | 0.9018 | 1 | 433 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q8ID31_1067_1217_3.30.980.10 | Alpha Beta;2-Layer Sandwich;Threonyl-tRNA Synthetase; Chain A, domain 2;Threonyl-trna Synthetase; Chain A, domain 2 | 0.9564 | 569 | 696 | 3.30.980.10 |
| af_A0A2R8QSU7_595_766_3.30.980.10 | Alpha Beta;2-Layer Sandwich;Threonyl-tRNA Synthetase; Chain A, domain 2;Threonyl-trna Synthetase; Chain A, domain 2 | 0.9465 | 540 | 692 | 3.30.980.10 |
| af_P40825_614_789_3.30.980.10 | Alpha Beta;2-Layer Sandwich;Threonyl-tRNA Synthetase; Chain A, domain 2;Threonyl-trna Synthetase; Chain A, domain 2 | 0.9446 | 540 | 697 | 3.30.980.10 |
| af_Q9VRJ1_645_810_3.30.980.10 | Alpha Beta;2-Layer Sandwich;Threonyl-tRNA Synthetase; Chain A, domain 2;Threonyl-trna Synthetase; Chain A, domain 2 | 0.9402 | 540 | 696 | 3.30.980.10 |
| af_Q4DQ33_587_768_3.30.980.10 | Alpha Beta;2-Layer Sandwich;Threonyl-tRNA Synthetase; Chain A, domain 2;Threonyl-trna Synthetase; Chain A, domain 2 | 0.9273 | 540 | 696 | 3.30.980.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3D0X827-F1-model_v4 | Alanine--tRNA ligase | 0.9786 | 223 | 341 |
GO:0000049
GO:0002161 GO:0004813 GO:0005524 GO:0005829 GO:0006419 |
| AF-A0A7X5N2T7-F1-model_v4 | Alanine--tRNA ligase | 0.9724 | 582 | 694 |
GO:0002161
GO:0003723 GO:0004813 GO:0005524 GO:0005829 GO:0006419 GO:0045892 GO:0046872 |
| AF-A0A0B0HRZ6-F1-model_v4 | deleted | 0.9704 | 557 | 713 |
|
| AF-A0A7C1SN25-F1-model_v4 | Alanine--tRNA ligase | 0.9669 | 555 | 687 |
GO:0002161
GO:0003723 GO:0004813 GO:0005524 GO:0005829 GO:0006419 |
| AF-A0A3D0X827-F1-model_v4 | Alanine--tRNA ligase | 0.9627 | 223 | 341 |
GO:0000049
GO:0002161 GO:0004813 GO:0005524 GO:0005829 GO:0006419 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar