F416117

General Info

Members Datasets Scaffolds Average Seq Length
344 220 344 827

Family's Representative Sequence

Representative Sequence 3300047317|Ga0495604_0000067|Ga0495604_0000067_31264_33984
Length 881
Sequence MKANEIRQTYLSFFEERGHEIVPSASLVPSVHDPSVLLTTAGMQPFKPYFLGREEPPARRLADVQKCFRTTDVTEVGDTARHLTFFEMLGNWSFGDYFKEESIAWGWELSTQGFGMDPERIWVTVFGGDEELGLGPDDEAIAIWLEVGVPDERIVRLGREDNFWQAGPELYLDRGEEFGAADDRPGDDTDRFLEFWNHVFMTYDLGADGALTELPMRNIDTGMGLDRMAAILQDVPSVFETDLLRPLVDLAEETSGRSYTEGGAVTRAMRIVADHSRAAAFLIADGVVPSNEDRGYILRRIMRRAIQQGRTLGLEAPWLGRFTERTIEIMVEAYPELGAAREAIARWVGDEEESFGLTLERGTELLERLVAEARESETSWIDAADAFKLHDTYGFPYDLTKELLAERGLSVDDGGFEELMEEQRQRARVGAATAHGSEDRHERVIAFASAAAPSRFVGYETLRATTGLAAVEREDGRALVKLEESPFYAEGGGQVADSGTIRWDGGETEVVDVYRVGDDQVLEVAPRRPRTRGQGHETSGGDEHALVGAGEAAVLDERATVEAEVDRETRHATMRNHTATAGSAVRPDKLRFDFTHGQALSAEDLRAVEDRVNDWIKASRPVRWLEMERTEAERLGAMALFGEKYGEWVRMVEVDGVSRELCGGTHVANTAEVGIFKIASEGSSAANVRRIEALSGPAAIDWFREREDRLHEVGDLLGSPQDPVTGARRAAERLREAGAGAEKAQREELSVEAGRIADRAVDLMVRDSAGEIVALVEAKTSIDAEPRQLLDLANRVQSKLGEPSVVVLGGASGSKAGLVALVSKDAIERGLSAVSIIREIAPIVQGXXXXRDDMAQAGGKDPSRLDEALDAARAAVERELA

Samples

Sample ID Description Type Environment
1 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
4 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
5 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
6 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
7 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
8 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
9 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
10 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
11 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
12 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
13 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
14 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
15 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
16 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
17 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
18 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
19 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
20 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
21 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
22 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
23 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
24 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
25 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
26 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
27 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
28 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
29 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
30 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
31 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
32 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
33 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
34 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
35 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
36 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
37 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
38 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
39 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
40 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
41 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
42 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
43 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
44 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
45 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
46 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
47 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
48 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
49 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
50 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
51 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
52 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
53 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
54 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
55 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
56 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
57 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
58 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
59 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
60 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
61 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
62 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
63 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
64 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
65 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
66 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
107 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
108 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
109 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
110 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
111 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
112 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
113 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
114 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
115 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
116 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
117 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
118 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
119 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
120 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
121 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
122 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
123 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
124 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
125 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
126 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
127 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
128 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
129 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
130 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
131 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
132 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
133 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
134 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
135 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
136 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
137 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
138 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
139 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
140 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
141 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
142 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
143 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
144 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
145 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
146 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
147 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
148 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
149 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
150 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
151 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
152 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
153 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
154 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
155 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
156 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
157 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
158 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
159 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
160 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
161 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
162 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
163 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
164 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
165 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
166 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
167 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
168 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
169 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
170 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
171 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
172 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
173 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
174 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
175 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
176 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
177 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
178 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
179 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
180 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
181 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
182 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
183 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
184 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
185 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
186 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
187 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
188 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
189 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
190 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
191 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
192 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
193 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
194 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
195 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
196 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
197 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
198 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
199 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
200 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
201 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
202 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
203 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
204 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
205 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
206 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
207 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
208 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
209 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
210 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
211 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
212 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
213 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
214 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
215 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
216 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
217 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
218 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
219 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
220 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.03
Nodule 0
Rhizoplane 13.95
Rhizosphere 80.81
Stem 0
Stem Tuber 0
Unclassified 3.2

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24746J21847_1001074 3300001977 Bacteria 4289
2 Ga0070683_100006350 3300005329 Bacteria 9914
3 Ga0070677_10000044 3300005333 Bacteria 39119
4 Ga0070682_100000011 3300005337 Bacteria 266253
5 Ga0070682_100000078 3300005337 Bacteria 87953
6 Ga0070682_100001072 3300005337 Bacteria 15772
7 Ga0068868_100000453 3300005338 Bacteria 27329
8 Ga0070691_10000002 3300005341 Bacteria 90686
9 Ga0070661_100000145 3300005344 Bacteria 58346
10 Ga0070668_100025920 3300005347 Bacteria 4446
11 Ga0070675_100000776 3300005354 Bacteria 22323
12 Ga0070674_100000002 3300005356 Bacteria 271088
13 Ga0070674_100000007 3300005356 Bacteria 145531
14 Ga0070673_100002354 3300005364 Bacteria 11482
15 Ga0070688_100000169 3300005365 Bacteria 35241
16 Ga0070688_100002791 3300005365 Bacteria 8876
17 Ga0070659_100006296 3300005366 Bacteria 8576
18 Ga0070713_100001073 3300005436 Bacteria 17481
19 Ga0070711_100004900 3300005439 Bacteria 7948
20 Ga0070711_100026045 3300005439 Bacteria 3831
21 Ga0070663_100002374 3300005455 Bacteria 10588
22 Ga0070662_100000002 3300005457 Bacteria 253208
23 Ga0068867_100000750 3300005459 Bacteria 21786
24 Ga0070685_10000019 3300005466 Bacteria 105881
25 Ga0070679_100000129 3300005530 Bacteria 60559
26 Ga0070679_100002847 3300005530 Bacteria 15715
27 Ga0068853_100016808 3300005539 Bacteria 6028
28 Ga0070672_100000001 3300005543 Bacteria 204624
29 Ga0070665_100000141 3300005548 Bacteria 135473
30 Ga0070665_100011747 3300005548 Bacteria 8843
31 Ga0068854_100000113 3300005578 Bacteria 55436
32 Ga0068856_100001668 3300005614 Bacteria 23239
33 Ga0068856_100004779 3300005614 Bacteria 13422
34 Ga0068852_100000002 3300005616 Bacteria 268221
35 Ga0068864_100000015 3300005618 Bacteria 303368
36 Ga0068866_10000003 3300005718 Bacteria 281675
37 Ga0068866_10000020 3300005718 Bacteria 62866
38 Ga0068863_100000129 3300005841 Bacteria 79654
39 Ga0068863_100025421 3300005841 Bacteria 5647
40 Ga0068858_100000120 3300005842 Bacteria 81766
41 Ga0068858_100001913 3300005842 Bacteria 21241
42 Ga0068860_100002215 3300005843 Bacteria 20454
43 Ga0068862_100002034 3300005844 Bacteria 18317
44 Ga0081455_10006044 3300005937 Bacteria 13101
45 Ga0081455_10051084 3300005937 Bacteria 3549
46 Ga0081538_10000189 3300005981 Bacteria 67621
47 Ga0081538_10004164 3300005981 Bacteria 13421
48 Ga0081540_1000628 3300005983 Bacteria 33596
49 Ga0081539_10003342 3300005985 Bacteria 19934
50 Ga0081539_10011125 3300005985 Bacteria 7182
51 Ga0075365_10012463 3300006038 Bacteria 5052
52 Ga0075365_10013423 3300006038 Bacteria 4898
53 Ga0075363_100017754 3300006048 Bacteria 3534
54 Ga0070715_10000029 3300006163 Bacteria 88994
55 Ga0070712_100010956 3300006175 Bacteria 5736
56 Ga0070712_100010993 3300006175 Bacteria 5727
57 Ga0075430_100018768 3300006846 Bacteria 5885
58 Ga0075430_100041396 3300006846 Bacteria 3898
59 Ga0075431_100020953 3300006847 Bacteria 6680
60 Ga0075431_100045799 3300006847 Bacteria 4509
61 Ga0075433_10000002 3300006852 Bacteria 92986
62 Ga0075433_10040385 3300006852 Bacteria 4038
63 Ga0075434_100016456 3300006871 Bacteria 7109
64 Ga0068865_100000094 3300006881 Bacteria 46651
65 Ga0105245_10000026 3300009098 Bacteria 163660
66 Ga0105245_10000315 3300009098 Bacteria 46041
67 Ga0105245_10001571 3300009098 Bacteria 20730
68 Ga0105245_10002028 3300009098 Bacteria 18364
69 Ga0105245_10006082 3300009098 Bacteria 10609
70 Ga0105247_10000347 3300009101 Bacteria 40377
71 Ga0114129_10021452 3300009147 Bacteria 9169
72 Ga0114129_10029330 3300009147 Bacteria 7794
73 Ga0105243_10008343 3300009148 Bacteria 7955
74 Ga0105243_10037576 3300009148 Bacteria 3765
75 Ga0105242_10000059 3300009176 Bacteria 75563
76 Ga0105242_10001472 3300009176 Bacteria 18524
77 Ga0105248_10000020 3300009177 Bacteria 284637
78 Ga0105238_10000048 3300009551 Bacteria 146322
79 Ga0105249_10000076 3300009553 Bacteria 144450
80 Ga0105239_10052400 3300010375 Bacteria 4475
81 Ga0105239_10075197 3300010375 Bacteria 3713
82 Ga0157371_10009163 3300013102 Bacteria 7817
83 Ga0157370_10005610 3300013104 Bacteria 14050
84 Ga0157369_10000014 3300013105 Bacteria 266411
85 Ga0157374_10010565 3300013296 Bacteria 7948
86 Ga0157372_10000060 3300013307 Bacteria 122372
87 Ga0157372_10035599 3300013307 Bacteria 5482
88 Ga0157375_10000171 3300013308 Bacteria 61181
89 Ga0157375_10003527 3300013308 Bacteria 13570
90 Ga0157380_10000439 3300014326 Bacteria 25370
91 Ga0157380_10001547 3300014326 Bacteria 15125
92 Ga0157377_10018369 3300014745 Bacteria 3632
93 Ga0157379_10013172 3300014968 Bacteria 7240
94 Ga0163161_10000022 3300017792 Bacteria 207890
95 Ga0213875_10005171 3300021388 Bacteria 7056
96 Ga0207656_10001014 3300025321 Bacteria 9146
97 Ga0207682_10000497 3300025893 Bacteria 18104
98 Ga0207642_10000002 3300025899 Bacteria 658166
99 Ga0207642_10002332 3300025899 Bacteria 5922
100 Ga0207710_10000631 3300025900 Bacteria 20232
101 Ga0207688_10001625 3300025901 Bacteria 11863
102 Ga0207680_10021371 3300025903 Bacteria 3501
103 Ga0207685_10000031 3300025905 Bacteria 77451
104 Ga0207671_10047639 3300025914 Bacteria 3172
105 Ga0207693_10006680 3300025915 Bacteria 9529
106 Ga0207693_10007008 3300025915 Bacteria 9312
107 Ga0207693_10022874 3300025915 Bacteria 4963
108 Ga0207663_10002979 3300025916 Bacteria 8190
109 Ga0207649_10000003 3300025920 Bacteria 388908
110 Ga0207652_10000211 3300025921 Bacteria 61784
111 Ga0207652_10002784 3300025921 Bacteria 14695
112 Ga0207694_10000056 3300025924 Bacteria 146908
113 Ga0207659_10000013 3300025926 Bacteria 172742
114 Ga0207687_10000017 3300025927 Bacteria 237310
115 Ga0207687_10000112 3300025927 Bacteria 58074
116 Ga0207687_10004413 3300025927 Bacteria 9386
117 Ga0207700_10000033 3300025928 Bacteria 123113
118 Ga0207706_10000001 3300025933 Bacteria 423014
119 Ga0207686_10000116 3300025934 Bacteria 64638
120 Ga0207686_10000888 3300025934 Bacteria 18054
121 Ga0207669_10000001 3300025937 Bacteria 377747
122 Ga0207669_10000003 3300025937 Bacteria 252239
123 Ga0207704_10000088 3300025938 Bacteria 53926
124 Ga0207691_10000017 3300025940 Bacteria 134441
125 Ga0207711_10000006 3300025941 Bacteria 792692
126 Ga0207661_10000220 3300025944 Bacteria 37288
127 Ga0207661_10013614 3300025944 Bacteria 5940
128 Ga0207651_10001628 3300025960 Bacteria 10300
129 Ga0207712_10000052 3300025961 Bacteria 152874
130 Ga0207712_10005524 3300025961 Bacteria 7975
131 Ga0207640_10000401 3300025981 Bacteria 27504
132 Ga0207677_10000203 3300026023 Bacteria 47885
133 Ga0207677_10000379 3300026023 Bacteria 30693
134 Ga0207703_10000018 3300026035 Bacteria 271377
135 Ga0207703_10000061 3300026035 Bacteria 132671
136 Ga0207639_10012864 3300026041 Bacteria 5838
137 Ga0207678_10000556 3300026067 Bacteria 34074
138 Ga0207708_10001138 3300026075 Bacteria 19986
139 Ga0207702_10000076 3300026078 Bacteria 112300
140 Ga0207702_10002397 3300026078 Bacteria 17842
141 Ga0207702_10008407 3300026078 Bacteria 8708
142 Ga0207641_10000016 3300026088 Bacteria 307363
143 Ga0207641_10005756 3300026088 Bacteria 10526
144 Ga0207648_10001987 3300026089 Bacteria 22343
145 Ga0207676_10000018 3300026095 Bacteria 306375
146 Ga0207683_10022226 3300026121 Bacteria 5443
147 Ga0207698_10000004 3300026142 Bacteria 313614
148 Ga0268266_10000056 3300028379 Bacteria 289176
149 Ga0268266_10000160 3300028379 Bacteria 125999
150 Ga0268266_10000376 3300028379 Bacteria 68245
151 Ga0268265_10000985 3300028380 Bacteria 25857
152 Ga0268264_10001600 3300028381 Bacteria 20943
153 Ga0265337_1000007 3300028556 Bacteria 98412
154 Ga0265326_10000019 3300028558 Bacteria 137370
155 Ga0265319_1000014 3300028563 Bacteria 177623
156 Ga0265322_10000011 3300028654 Bacteria 167597
157 Ga0265338_10000185 3300028800 Bacteria 116333
158 Ga0265324_10000997 3300029957 Bacteria 17408
159 Ga0265320_10000011 3300031240 Bacteria 249534
160 Ga0265331_10004136 3300031250 Bacteria 9099
161 Ga0265327_10000015 3300031251 Bacteria 496677
162 Ga0265314_10000119 3300031711 Bacteria 122334
163 Ga0307415_100000776 3300032126 Bacteria 14456
164 Ga0395898_0008138 3300037466 Bacteria 11102
165 Ga0395898_0008295 3300037466 Bacteria 10985
166 Ga0395898_0035692 3300037466 Bacteria 4941
167 Ga0436364_1521721 3300037853 Bacteria 19288
168 Ga0395901_0016091 3300038443 Bacteria 7620
169 Ga0466963_0000004 3300044694 Bacteria 102526
170 Ga0466963_0038757 3300044694 Bacteria 3119
171 Ga0466957_0008131 3300044842 Bacteria 5955
172 Ga0466967_0000001 3300045976 Bacteria 229823
173 Ga0466967_0002279 3300045976 Bacteria 11844
174 Ga0495592_0000078 3300046454 Bacteria 85591
175 Ga0495603_0000128 3300046455 Bacteria 37013
176 Ga0495603_0001813 3300046455 Bacteria 12609
177 Ga0495629_0000106 3300046459 Bacteria 74178
178 Ga0495629_0001644 3300046459 Bacteria 17549
179 Ga0495641_0000005 3300046461 Bacteria 206626
180 Ga0495641_0000111 3300046461 Bacteria 57409
181 Ga0495641_0018672 3300046461 Bacteria 3572
182 Ga0495653_0010945 3300046463 Bacteria 7428
183 Ga0495582_0000009 3300046473 Bacteria 123633
184 Ga0495662_0000001 3300046476 Bacteria 179185
185 Ga0495594_0000045 3300046499 Bacteria 54326
186 Ga0495606_0000040 3300046507 Bacteria 223500
187 Ga0495608_0000007 3300046511 Bacteria 313495
188 Ga0495608_0000240 3300046511 Bacteria 39700
189 Ga0495618_0000014 3300046514 Bacteria 163136
190 Ga0495620_0000092 3300046515 Bacteria 72050
191 Ga0495628_0000808 3300046516 Bacteria 28939
192 Ga0495628_0011425 3300046516 Bacteria 7510
193 Ga0495630_0000014 3300046517 Bacteria 217229
194 Ga0495630_0000062 3300046517 Bacteria 86140
195 Ga0495630_0006859 3300046517 Bacteria 8116
196 Ga0495630_0041656 3300046517 Bacteria 3430
197 Ga0495644_0000139 3300046523 Bacteria 35023
198 Ga0495652_0000010 3300046529 Bacteria 261584
199 Ga0495652_0038776 3300046529 Bacteria 4125
200 Ga0495586_0000959 3300046535 Bacteria 16343
201 Ga0495587_0027493 3300046536 Bacteria 3463
202 Ga0495622_0001452 3300046557 Bacteria 11937
203 Ga0495667_0000045 3300046559 Bacteria 118562
204 Ga0495656_0002864 3300046615 Bacteria 5781
205 Ga0495634_0000045 3300046642 Bacteria 99087
206 Ga0495625_0000032 3300046660 Bacteria 233135
207 Ga0495635_0000031 3300046663 Bacteria 110244
208 Ga0495635_0022902 3300046663 Bacteria 4354
209 Ga0495588_0000203 3300046674 Bacteria 59454
210 Ga0495657_0000001 3300046675 Bacteria 445641
211 Ga0495657_0002432 3300046675 Bacteria 15683
212 Ga0495647_0000021 3300046681 Bacteria 72778
213 Ga0495658_0000002 3300046683 Bacteria 309651
214 Ga0495669_0000051 3300046684 Bacteria 80128
215 Ga0495613_0000005 3300046689 Bacteria 222558
216 Ga0495613_0000032 3300046689 Bacteria 139806
217 Ga0495624_0000095 3300046690 Bacteria 59791
218 Ga0495624_0000405 3300046690 Bacteria 34290
219 Ga0495670_0012015 3300046691 Bacteria 4262
220 Ga0495604_0000067 3300047317 Bacteria 90345
221 Ga0495604_0000577 3300047317 Bacteria 32087
222 Ga0495674_0000010 3300047319 Bacteria 285794
223 Ga0495676_0000186 3300047321 Bacteria 49054
224 Ga0495676_0000956 3300047321 Bacteria 24242
225 Ga0495680_0000114 3300047322 Bacteria 76486
226 Ga0495680_0000267 3300047322 Bacteria 57953
227 Ga0495680_0000602 3300047322 Bacteria 40540
228 Ga0495675_0000017 3300047444 Bacteria 123394
229 Ga0495686_0000008 3300047472 Bacteria 727479
230 Ga0495686_0008569 3300047472 Bacteria 7490
231 Ga0495602_0000007 3300048088 Bacteria 273212
232 Ga0495602_0000775 3300048088 Bacteria 30490
233 Ga0496100_0000001 3300048903 Bacteria 530179
234 Ga0496100_0000061 3300048903 Bacteria 63790
235 Ga0496101_0000004 3300048904 Bacteria 331599
236 Ga0496101_0000141 3300048904 Bacteria 63790
237 Ga0496102_0000801 3300048905 Bacteria 30565
238 Ga0496102_0001710 3300048905 Bacteria 19219
239 Ga0496102_0045550 3300048905 Bacteria 3983
240 Ga0496103_0000057 3300048906 Bacteria 142223
241 Ga0496104_0000015 3300048907 Bacteria 374530
242 Ga0496104_0000025 3300048907 Bacteria 228519
243 Ga0496104_0000133 3300048907 Bacteria 69099
244 Ga0496104_0005958 3300048907 Bacteria 10677
245 Ga0496104_0060170 3300048907 Bacteria 3598
246 Ga0496105_0000004 3300048908 Bacteria 475798
247 Ga0496105_0000023 3300048908 Bacteria 156126
248 Ga0496105_0000187 3300048908 Bacteria 41418
249 Ga0496106_0000030 3300048909 Bacteria 136804
250 Ga0496106_0000056 3300048909 Bacteria 90682
251 Ga0496106_0000094 3300048909 Bacteria 67511
252 Ga0496107_0000005 3300048910 Bacteria 281747
253 Ga0496107_0000045 3300048910 Bacteria 67420
254 Ga0496107_0010510 3300048910 Bacteria 6433
255 Ga0496107_0026157 3300048910 Bacteria 4136
256 Ga0496107_0052635 3300048910 Bacteria 2936
257 Ga0496108_0000164 3300048911 Bacteria 62669
258 Ga0496108_0000582 3300048911 Bacteria 28516
259 Ga0496108_0002101 3300048911 Bacteria 15953
260 Ga0496108_0028301 3300048911 Bacteria 4636
261 Ga0496109_0000012 3300048912 Bacteria 229699
262 Ga0496109_0000056 3300048912 Bacteria 120835
263 Ga0496109_0000180 3300048912 Bacteria 62669
264 Ga0496109_0000446 3300048912 Bacteria 35477
265 Ga0496110_0000114 3300048913 Bacteria 44437
266 Ga0496110_0007161 3300048913 Bacteria 8881
267 Ga0496110_0018768 3300048913 Bacteria 5804
268 Ga0496111_0000008 3300048914 Bacteria 96148
269 Ga0496111_0011444 3300048914 Bacteria 5975
270 Ga0496111_0026207 3300048914 Bacteria 4116
271 Ga0496112_0000006 3300048915 Bacteria 365227
272 Ga0496112_0001447 3300048915 Bacteria 18224
273 Ga0496113_0000099 3300048916 Bacteria 36270
274 Ga0496113_0010910 3300048916 Bacteria 6030
275 Ga0496114_0000171 3300048917 Bacteria 46036
276 Ga0496114_0004008 3300048917 Bacteria 11381
277 Ga0496114_0042332 3300048917 Bacteria 3775
278 Ga0496115_0000011 3300048918 Bacteria 222529
279 Ga0496115_0001687 3300048918 Bacteria 15870
280 Ga0496115_0009515 3300048918 Bacteria 7219
281 Ga0496116_0000367 3300048919 Bacteria 69349
282 Ga0496117_0006020 3300048920 Bacteria 12473
283 Ga0496118_0000790 3300048921 Bacteria 50676
284 Ga0496119_0003161 3300048922 Bacteria 17290
285 Ga0496119_0011461 3300048922 Bacteria 7336
286 Ga0496120_0002463 3300048923 Bacteria 18648
287 Ga0496121_0014139 3300048924 Bacteria 8503
288 Ga0496121_0054181 3300048924 Bacteria 3354
289 Ga0496125_0017097 3300048928 Bacteria 6930
290 Ga0501031_0000147 3300049568 Bacteria 39718
291 Ga0501031_0046728 3300049568 Bacteria 2823
292 Ga0501032_0000328 3300049569 Bacteria 39724
293 Ga0501033_0000261 3300049570 Bacteria 50442
294 Ga0501034_0007529 3300049571 Bacteria 11586
295 Ga0501034_0021429 3300049571 Bacteria 6589
296 Ga0501034_0027628 3300049571 Bacteria 5770
297 Ga0501036_0002670 3300049572 Bacteria 14071
298 Ga0501037_0000221 3300049573 Bacteria 49689
299 Ga0501038_0000101 3300049574 Bacteria 72459
300 Ga0501040_0020469 3300049576 Bacteria 4409
301 Ga0501042_0010905 3300049578 Bacteria 6117
302 Ga0501043_0000237 3300049579 Bacteria 49809
303 Ga0501046_0000608 3300049580 Bacteria 35208
304 Ga0501047_0000376 3300049581 Bacteria 50385
305 Ga0501048_0002386 3300049582 Bacteria 14347
306 Ga0501068_0032682 3300049584 Bacteria 3094
307 Ga0501070_0000178 3300049586 Bacteria 59157
308 Ga0501070_0009297 3300049586 Bacteria 8313
309 Ga0501073_0000255 3300049589 Bacteria 35173
310 Ga0501074_0006995 3300049590 Bacteria 8149
311 Ga0501075_0001056 3300049591 Bacteria 17694
312 Ga0501079_0033584 3300049741 Bacteria 3946
313 Ga0501083_0001338 3300049744 Bacteria 16699
314 Ga0501083_0023901 3300049744 Bacteria 4237
315 Ga0501035_0000616 3300049822 Bacteria 39216
316 Ga0501044_0000416 3300049823 Bacteria 52684
317 nmdc:mga05p37_22310_c1 3300050507 Bacteria 7677
318 nmdc:mga05p37_78642_c1 3300050507 Bacteria 4061
319 nmdc:mga08y16_69862_c1 3300050511 Bacteria 3661
320 nmdc:mga0n895_32748_c1 3300050512 Bacteria 4990
321 nmdc:mga0n895_77666_c1 3300050512 Bacteria 3303
322 nmdc:mga0a205_13_c1 3300050515 Bacteria 111131
323 nmdc:mga0a205_14130_c2 3300050515 Bacteria 7146
324 nmdc:mga0a205_35959_c1 3300050515 Bacteria 4757
325 Ga0495601_0000038 3300053077 Bacteria 81122
326 Ga0495601_0000071 3300053077 Bacteria 56206
327 Ga0495601_0013366 3300053077 Bacteria 4935
328 Ga0495612_0000110 3300053078 Bacteria 34644
329 Ga0495612_0001018 3300053078 Bacteria 11500
330 Ga0495612_0013553 3300053078 Bacteria 3283
331 Ga0495655_0000002 3300053083 Bacteria 312752
332 Ga0495595_0000002 3300053084 Bacteria 445641
333 Ga0495595_0000157 3300053084 Bacteria 26977
334 Ga0495595_0001559 3300053084 Bacteria 8940
335 Ga0495619_0000008 3300053085 Bacteria 305999
336 Ga0495619_0000053 3300053085 Bacteria 98761
337 Ga0495619_0000081 3300053085 Bacteria 72034
338 Ga0495619_0001401 3300053085 Bacteria 15847
339 Ga0495619_0001798 3300053085 Bacteria 14256
340 Ga0500566_0012133 3300053094 Bacteria 5073
341 Ga0500595_014385 3300053119 Bacteria 3002
342 Ga0500614_000078 3300053123 Bacteria 21505
343 Ga0500628_000001 3300053129 Bacteria 564074
344 Ga0501082_0003986 3300060353 Bacteria 12888

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048924 Ga0496121_0054181 Ga0496121_0054181_955_3330 673
2 3300028563 Ga0265319_1000014 Ga0265319_1000014123 730
3 3300028800 Ga0265338_10000185 Ga0265338_10000185121 730
4 3300044694 Ga0466963_0000004 Ga0466963_0000004_39489_42110 738
5 3300053119 Ga0500595_014385 Ga0500595_014385_484_2985 766
6 3300005365 Ga0070688_100000169 Ga0070688_10000016930 771
7 3300005466 Ga0070685_10000019 Ga0070685_100000197 771
8 3300005329 Ga0070683_100006350 Ga0070683_1000063504 774
9 3300025944 Ga0207661_10000220 Ga0207661_1000022013 774
10 3300005459 Ga0068867_100000750 Ga0068867_1000007505 776
11 3300026089 Ga0207648_10001987 Ga0207648_100019876 776
12 3300046454 Ga0495592_0000078 Ga0495592_0000078_46374_48995 776
13 3300046690 Ga0495624_0000405 Ga0495624_0000405_7905_10541 777
14 3300048903 Ga0496100_0000001 Ga0496100_0000001_299350_301971 777
15 3300048904 Ga0496101_0000004 Ga0496101_0000004_100702_103323 777
16 3300048909 Ga0496106_0000056 Ga0496106_0000056_21675_24296 777
17 3300048910 Ga0496107_0000005 Ga0496107_0000005_228277_230898 777
18 3300006175 Ga0070712_100010956 Ga0070712_1000109562 778
19 3300009098 Ga0105245_10006082 Ga0105245_100060827 778
20 3300025915 Ga0207693_10006680 Ga0207693_100066803 778
21 3300046529 Ga0495652_0038776 Ga0495652_0038776_1186_3813 778
22 3300048910 Ga0496107_0052635 Ga0496107_0052635_155_2761 778
23 3300048913 Ga0496110_0007161 Ga0496110_0007161_3646_6252 778
24 3300048914 Ga0496111_0011444 Ga0496111_0011444_2124_4730 778
25 3300048917 Ga0496114_0042332 Ga0496114_0042332_274_2880 778
26 3300014326 Ga0157380_10001547 Ga0157380_100015475 783
27 3300048911 Ga0496108_0000582 Ga0496108_0000582_22899_25574 783
28 3300048912 Ga0496109_0000446 Ga0496109_0000446_3726_6401 783
29 3300006048 Ga0075363_100017754 Ga0075363_1000177542 787
30 3300005981 Ga0081538_10000189 Ga0081538_1000018915 788
31 3300046459 Ga0495629_0001644 Ga0495629_0001644_9145_11769 788
32 3300048903 Ga0496100_0000061 Ga0496100_0000061_18710_21385 788
33 3300048904 Ga0496101_0000141 Ga0496101_0000141_18710_21385 788
34 3300048909 Ga0496106_0000094 Ga0496106_0000094_18710_21385 788
35 3300048910 Ga0496107_0000045 Ga0496107_0000045_46047_48722 788
36 3300053094 Ga0500566_0012133 Ga0500566_0012133_577_3201 788
37 3300037466 Ga0395898_0008138 Ga0395898_0008138_1232_3838 790
38 3300038443 Ga0395901_0016091 Ga0395901_0016091_2096_4702 790
39 3300048917 Ga0496114_0000171 Ga0496114_0000171_16997_19681 790
40 3300048918 Ga0496115_0001687 Ga0496115_0001687_10716_13400 790
41 3300046499 Ga0495594_0000045 Ga0495594_0000045_36713_39337 791
42 3300005548 Ga0070665_100011747 Ga0070665_1000117476 792
43 3300028379 Ga0268266_10000376 Ga0268266_1000037640 792
44 3300046557 Ga0495622_0001452 Ga0495622_0001452_1634_4318 792
45 3300005618 Ga0068864_100000015 Ga0068864_100000015110 793
46 3300026095 Ga0207676_10000018 Ga0207676_10000018190 793
47 3300005347 Ga0070668_100025920 Ga0070668_1000259203 794
48 3300005844 Ga0068862_100002034 Ga0068862_1000020342 794
49 3300025961 Ga0207712_10005524 Ga0207712_100055246 794
50 3300028380 Ga0268265_10000985 Ga0268265_1000098518 794
51 3300048928 Ga0496125_0017097 Ga0496125_0017097_3725_6337 794
52 3300005937 Ga0081455_10006044 Ga0081455_1000604410 795
53 3300010375 Ga0105239_10052400 Ga0105239_100524003 795
54 3300046517 Ga0495630_0000014 Ga0495630_0000014_31648_34284 795
55 3300048917 Ga0496114_0004008 Ga0496114_0004008_267_2822 795
56 3300049568 Ga0501031_0000147 Ga0501031_0000147_16184_18802 795
57 3300049569 Ga0501032_0000328 Ga0501032_0000328_21001_23619 795
58 3300049570 Ga0501033_0000261 Ga0501033_0000261_21186_23804 795
59 3300049571 Ga0501034_0007529 Ga0501034_0007529_6143_8761 795
60 3300049572 Ga0501036_0002670 Ga0501036_0002670_7902_10520 795
61 3300049573 Ga0501037_0000221 Ga0501037_0000221_26138_28756 795
62 3300049574 Ga0501038_0000101 Ga0501038_0000101_20882_23500 795
63 3300049576 Ga0501040_0020469 Ga0501040_0020469_1044_3662 795
64 3300049579 Ga0501043_0000237 Ga0501043_0000237_20906_23524 795
65 3300049580 Ga0501046_0000608 Ga0501046_0000608_11564_14182 795
66 3300049581 Ga0501047_0000376 Ga0501047_0000376_21129_23747 795
67 3300049582 Ga0501048_0002386 Ga0501048_0002386_46_2673 795
68 3300049584 Ga0501068_0032682 Ga0501068_0032682_328_2946 795
69 3300049586 Ga0501070_0000178 Ga0501070_0000178_28159_30777 795
70 3300049589 Ga0501073_0000255 Ga0501073_0000255_20890_23508 795
71 3300049590 Ga0501074_0006995 Ga0501074_0006995_2805_5423 795
72 3300049741 Ga0501079_0033584 Ga0501079_0033584_365_2983 795
73 3300049744 Ga0501083_0001338 Ga0501083_0001338_10614_13232 795
74 3300049822 Ga0501035_0000616 Ga0501035_0000616_8440_11058 795
75 3300049823 Ga0501044_0000416 Ga0501044_0000416_26639_29257 795
76 3300060353 Ga0501082_0003986 Ga0501082_0003986_6137_8755 795
77 3300046511 Ga0495608_0000007 Ga0495608_0000007_223429_226074 796
78 3300046675 Ga0495657_0000001 Ga0495657_0000001_355575_358220 796
79 3300047444 Ga0495675_0000017 Ga0495675_0000017_87428_90073 796
80 3300048907 Ga0496104_0005958 Ga0496104_0005958_6296_8914 796
81 3300048922 Ga0496119_0011461 Ga0496119_0011461_4154_6772 796
82 3300053084 Ga0495595_0000002 Ga0495595_0000002_87422_90067 796
83 3300053085 Ga0495619_0000053 Ga0495619_0000053_41080_43725 796
84 3300005344 Ga0070661_100000145 Ga0070661_10000014524 797
85 3300025920 Ga0207649_10000003 Ga0207649_10000003387 797
86 3300046536 Ga0495587_0027493 Ga0495587_0027493_492_3125 797
87 3300048907 Ga0496104_0000025 Ga0496104_0000025_110894_113515 798
88 3300048908 Ga0496105_0000023 Ga0496105_0000023_110894_113515 798
89 3300053077 Ga0495601_0000038 Ga0495601_0000038_66172_68811 798
90 3300013308 Ga0157375_10003527 Ga0157375_100035272 799
91 3300046514 Ga0495618_0000014 Ga0495618_0000014_27106_29727 799
92 3300047321 Ga0495676_0000186 Ga0495676_0000186_20518_23139 799
93 3300005578 Ga0068854_100000113 Ga0068854_10000011337 800
94 3300006846 Ga0075430_100018768 Ga0075430_1000187684 800
95 3300009148 Ga0105243_10037576 Ga0105243_100375762 800
96 3300013307 Ga0157372_10000060 Ga0157372_1000006071 800
97 3300025981 Ga0207640_10000401 Ga0207640_100004017 800
98 3300037466 Ga0395898_0008295 Ga0395898_0008295_8098_10704 800
99 3300046517 Ga0495630_0041656 Ga0495630_0041656_479_3094 800
100 3300046681 Ga0495647_0000021 Ga0495647_0000021_17578_20199 800
101 3300009148 Ga0105243_10008343 Ga0105243_100083436 801
102 3300048088 Ga0495602_0000775 Ga0495602_0000775_5510_8143 801
103 3300005439 Ga0070711_100004900 Ga0070711_1000049002 802
104 3300005455 Ga0070663_100002374 Ga0070663_1000023745 802
105 3300005530 Ga0070679_100002847 Ga0070679_1000028475 802
106 3300025914 Ga0207671_10047639 Ga0207671_100476392 802
107 3300025916 Ga0207663_10002979 Ga0207663_100029792 802
108 3300025921 Ga0207652_10002784 Ga0207652_100027846 802
109 3300026067 Ga0207678_10000556 Ga0207678_100005563 802
110 3300046523 Ga0495644_0000139 Ga0495644_0000139_4549_7170 802
111 3300046660 Ga0495625_0000032 Ga0495625_0000032_196460_199093 802
112 3300046642 Ga0495634_0000045 Ga0495634_0000045_74239_76863 803
113 3300006038 Ga0075365_10013423 Ga0075365_100134233 804
114 3300046461 Ga0495641_0018672 Ga0495641_0018672_119_2755 804
115 3300046516 Ga0495628_0000808 Ga0495628_0000808_9120_11753 804
116 3300005614 Ga0068856_100004779 Ga0068856_1000047792 805
117 3300013296 Ga0157374_10010565 Ga0157374_100105655 805
118 3300026078 Ga0207702_10002397 Ga0207702_1000239715 805
119 3300047317 Ga0495604_0000577 Ga0495604_0000577_16309_18948 805
120 3300005983 Ga0081540_1000628 Ga0081540_100062811 806
121 3300005337 Ga0070682_100000011 Ga0070682_10000001198 807
122 3300005354 Ga0070675_100000776 Ga0070675_10000077617 807
123 3300025926 Ga0207659_10000013 Ga0207659_10000013165 807
124 3300046674 Ga0495588_0000203 Ga0495588_0000203_48341_50995 807
125 3300053085 Ga0495619_0000081 Ga0495619_0000081_19196_21832 807
126 3300005338 Ga0068868_100000453 Ga0068868_10000045321 808
127 3300026023 Ga0207677_10000203 Ga0207677_1000020321 808
128 3300046689 Ga0495613_0000032 Ga0495613_0000032_38756_41395 808
129 3300046689 Ga0495613_0000005 Ga0495613_0000005_183772_186393 809
130 3300006852 Ga0075433_10040385 Ga0075433_100403852 810
131 3300009098 Ga0105245_10002028 Ga0105245_100020283 810
132 3300046615 Ga0495656_0002864 Ga0495656_0002864_248_2872 810
133 3300048918 Ga0496115_0000011 Ga0496115_0000011_181967_184591 810
134 3300046455 Ga0495603_0001813 Ga0495603_0001813_816_3440 811
135 3300046529 Ga0495652_0000010 Ga0495652_0000010_148058_150763 811
136 3300048914 Ga0496111_0026207 Ga0496111_0026207_524_3148 811
137 3300048923 Ga0496120_0002463 Ga0496120_0002463_4210_6864 811
138 3300049578 Ga0501042_0010905 Ga0501042_0010905_1697_4324 811
139 3300005985 Ga0081539_10003342 Ga0081539_100033429 812
140 3300006038 Ga0075365_10012463 Ga0075365_100124633 812
141 3300014968 Ga0157379_10013172 Ga0157379_100131724 813
142 3300047321 Ga0495676_0000956 Ga0495676_0000956_13531_16206 813
143 3300048909 Ga0496106_0000030 Ga0496106_0000030_84813_87437 813
144 3300048910 Ga0496107_0026157 Ga0496107_0026157_1347_3971 813
145 3300048912 Ga0496109_0000056 Ga0496109_0000056_103070_105703 813
146 3300049571 Ga0501034_0021429 Ga0501034_0021429_3131_5758 813
147 3300025915 Ga0207693_10007008 Ga0207693_100070087 814
148 3300026023 Ga0207677_10000379 Ga0207677_1000037910 814
149 3300046515 Ga0495620_0000092 Ga0495620_0000092_46990_49635 815
150 3300046691 Ga0495670_0012015 Ga0495670_0012015_161_2857 815
151 3300048905 Ga0496102_0001710 Ga0496102_0001710_15527_18157 815
152 3300048920 Ga0496117_0006020 Ga0496117_0006020_6144_8774 815
153 3300048921 Ga0496118_0000790 Ga0496118_0000790_22545_25175 815
154 3300053077 Ga0495601_0000071 Ga0495601_0000071_21491_24112 815
155 3300005333 Ga0070677_10000044 Ga0070677_1000004430 816
156 3300005337 Ga0070682_100000078 Ga0070682_10000007843 816
157 3300005530 Ga0070679_100000129 Ga0070679_10000012941 816
158 3300009553 Ga0105249_10000076 Ga0105249_10000076110 816
159 3300025893 Ga0207682_10000497 Ga0207682_1000049712 816
160 3300025921 Ga0207652_10000211 Ga0207652_1000021141 816
161 3300046473 Ga0495582_0000009 Ga0495582_0000009_118824_121445 816
162 3300046683 Ga0495658_0000002 Ga0495658_0000002_118819_121440 816
163 3300048913 Ga0496110_0000114 Ga0496110_0000114_34327_36963 816
164 3300048914 Ga0496111_0000008 Ga0496111_0000008_44057_46693 816
165 3300049744 Ga0501083_0023901 Ga0501083_0023901_866_3493 816
166 3300005364 Ga0070673_100002354 Ga0070673_1000023546 817
167 3300005548 Ga0070665_100000141 Ga0070665_10000014145 817
168 3300005842 Ga0068858_100001913 Ga0068858_10000191315 817
169 3300009098 Ga0105245_10000315 Ga0105245_1000031526 817
170 3300025903 Ga0207680_10021371 Ga0207680_100213711 817
171 3300025927 Ga0207687_10000112 Ga0207687_1000011236 817
172 3300025944 Ga0207661_10013614 Ga0207661_100136144 817
173 3300026035 Ga0207703_10000061 Ga0207703_1000006115 817
174 3300028379 Ga0268266_10000056 Ga0268266_1000005654 817
175 3300028379 Ga0268266_10000160 Ga0268266_1000016051 817
176 3300046461 Ga0495641_0000005 Ga0495641_0000005_56010_58631 817
177 3300053085 Ga0495619_0001798 Ga0495619_0001798_3345_6044 817
178 3300053123 Ga0500614_000078 Ga0500614_000078_14128_16749 817
179 3300005981 Ga0081538_10004164 Ga0081538_100041646 818
180 3300025960 Ga0207651_10001628 Ga0207651_100016284 818
181 3300046517 Ga0495630_0000062 Ga0495630_0000062_10420_13140 818
182 3300046675 Ga0495657_0002432 Ga0495657_0002432_11498_14119 818
183 3300048911 Ga0496108_0000164 Ga0496108_0000164_19120_21795 818
184 3300048912 Ga0496109_0000180 Ga0496109_0000180_40875_43550 818
185 3300048918 Ga0496115_0009515 Ga0496115_0009515_2253_4877 818
186 3300048919 Ga0496116_0000367 Ga0496116_0000367_38343_40967 818
187 3300048922 Ga0496119_0003161 Ga0496119_0003161_14022_16646 818
188 3300048924 Ga0496121_0014139 Ga0496121_0014139_3331_6009 818
189 3300050511 nmdc:mga08y16_69862_c1 nmdc:mga08y16_69862_c1_732_3365 818
190 3300050515 nmdc:mga0a205_35959_c1 nmdc:mga0a205_35959_c1_820_3453 818
191 3300005457 Ga0070662_100000002 Ga0070662_100000002150 819
192 3300025933 Ga0207706_10000001 Ga0207706_10000001332 819
193 3300037466 Ga0395898_0035692 Ga0395898_0035692_288_2903 819
194 3300048088 Ga0495602_0000007 Ga0495602_0000007_57199_59835 819
195 3300048907 Ga0496104_0000133 Ga0496104_0000133_16121_18745 819
196 3300048908 Ga0496105_0000187 Ga0496105_0000187_22514_25138 819
197 3300005356 Ga0070674_100000002 Ga0070674_100000002253 820
198 3300005718 Ga0068866_10000020 Ga0068866_1000002028 820
199 3300005937 Ga0081455_10051084 Ga0081455_100510842 820
200 3300025899 Ga0207642_10002332 Ga0207642_100023323 820
201 3300025937 Ga0207669_10000003 Ga0207669_1000000342 820
202 3300025961 Ga0207712_10000052 Ga0207712_1000005221 820
203 3300046476 Ga0495662_0000001 Ga0495662_0000001_89863_92484 820
204 3300005539 Ga0068853_100016808 Ga0068853_1000168084 821
205 3300026041 Ga0207639_10012864 Ga0207639_100128642 821
206 3300046511 Ga0495608_0000240 Ga0495608_0000240_19124_21745 821
207 3300049571 Ga0501034_0027628 Ga0501034_0027628_363_2987 821
208 3300053078 Ga0495612_0001018 Ga0495612_0001018_7932_10580 821
209 3300005366 Ga0070659_100006296 Ga0070659_1000062967 822
210 3300005841 Ga0068863_100000129 Ga0068863_10000012951 822
211 3300006852 Ga0075433_10000002 Ga0075433_1000000224 822
212 3300017792 Ga0163161_10000022 Ga0163161_1000002280 822
213 3300026088 Ga0207641_10000016 Ga0207641_1000001671 822
214 3300046517 Ga0495630_0006859 Ga0495630_0006859_1172_3793 822
215 3300046559 Ga0495667_0000045 Ga0495667_0000045_27731_30373 822
216 3300047322 Ga0495680_0000114 Ga0495680_0000114_17704_20325 822
217 3300047322 Ga0495680_0000602 Ga0495680_0000602_27718_30360 822
218 3300049568 Ga0501031_0046728 Ga0501031_0046728_94_2718 822
219 3300009551 Ga0105238_10000048 Ga0105238_1000004839 823
220 3300025924 Ga0207694_10000056 Ga0207694_1000005639 823
221 3300026121 Ga0207683_10022226 Ga0207683_100222263 823
222 3300046690 Ga0495624_0000095 Ga0495624_0000095_185_2806 823
223 3300048915 Ga0496112_0001447 Ga0496112_0001447_9895_12543 823
224 3300048916 Ga0496113_0000099 Ga0496113_0000099_21919_24567 823
225 3300049591 Ga0501075_0001056 Ga0501075_0001056_7109_9727 823
226 3300050515 nmdc:mga0a205_13_c1 nmdc:mga0a205_13_c1_22496_25120 823
227 3300053084 Ga0495595_0000157 Ga0495595_0000157_2974_5595 823
228 3300006881 Ga0068865_100000094 Ga0068865_10000009439 824
229 3300025938 Ga0207704_10000088 Ga0207704_1000008813 824
230 3300046459 Ga0495629_0000106 Ga0495629_0000106_9853_12489 824
231 3300046663 Ga0495635_0022902 Ga0495635_0022902_1296_3989 824
232 3300048905 Ga0496102_0000801 Ga0496102_0000801_591_3242 824
233 3300048906 Ga0496103_0000057 Ga0496103_0000057_7129_9780 824
234 3300048912 Ga0496109_0000012 Ga0496109_0000012_110316_112952 824
235 3300049586 Ga0501070_0009297 Ga0501070_0009297_3753_6413 824
236 3300005841 Ga0068863_100025421 Ga0068863_1000254212 825
237 3300025321 Ga0207656_10001014 Ga0207656_100010147 825
238 3300026088 Ga0207641_10005756 Ga0207641_100057566 825
239 3300044694 Ga0466963_0038757 Ga0466963_0038757_101_2737 825
240 3300047322 Ga0495680_0000267 Ga0495680_0000267_19750_22374 825
241 3300006163 Ga0070715_10000029 Ga0070715_1000002979 826
242 3300009176 Ga0105242_10000059 Ga0105242_1000005945 826
243 3300025905 Ga0207685_10000031 Ga0207685_1000003111 826
244 3300025934 Ga0207686_10000116 Ga0207686_100001162 826
245 3300005843 Ga0068860_100002215 Ga0068860_10000221516 827
246 3300009098 Ga0105245_10001571 Ga0105245_100015716 827
247 3300013308 Ga0157375_10000171 Ga0157375_1000017142 827
248 3300025927 Ga0207687_10004413 Ga0207687_100044136 827
249 3300028381 Ga0268264_10001600 Ga0268264_1000160016 827
250 3300032126 Ga0307415_100000776 Ga0307415_10000077610 827
251 3300046507 Ga0495606_0000040 Ga0495606_0000040_181032_183680 827
252 3300050515 nmdc:mga0a205_14130_c2 nmdc:mga0a205_14130_c2_3120_5744 827
253 3300053084 Ga0495595_0001559 Ga0495595_0001559_5532_8168 827
254 3300053085 Ga0495619_0001401 Ga0495619_0001401_7192_9819 827
255 3300005341 Ga0070691_10000002 Ga0070691_1000000227 828
256 3300006846 Ga0075430_100041396 Ga0075430_1000413963 828
257 3300021388 Ga0213875_10005171 Ga0213875_100051715 829
258 3300037853 Ga0436364_1521721 Ga0436364_1521721_4500_7142 829
259 3300046455 Ga0495603_0000128 Ga0495603_0000128_26289_28916 829
260 3300048907 Ga0496104_0000015 Ga0496104_0000015_125412_128057 829
261 3300048908 Ga0496105_0000004 Ga0496105_0000004_347742_350387 829
262 3300053077 Ga0495601_0013366 Ga0495601_0013366_133_2781 829
263 3300005337 Ga0070682_100001072 Ga0070682_1000010723 830
264 3300005439 Ga0070711_100026045 Ga0070711_1000260452 830
265 3300005842 Ga0068858_100000120 Ga0068858_1000001204 830
266 3300006175 Ga0070712_100010993 Ga0070712_1000109932 830
267 3300006847 Ga0075431_100020953 Ga0075431_1000209533 830
268 3300009147 Ga0114129_10029330 Ga0114129_100293306 830
269 3300010375 Ga0105239_10075197 Ga0105239_100751972 830
270 3300013104 Ga0157370_10005610 Ga0157370_100056107 830
271 3300013307 Ga0157372_10035599 Ga0157372_100355992 830
272 3300014326 Ga0157380_10000439 Ga0157380_1000043923 830
273 3300014745 Ga0157377_10018369 Ga0157377_100183691 830
274 3300025901 Ga0207688_10001625 Ga0207688_1000162510 830
275 3300025915 Ga0207693_10022874 Ga0207693_100228742 830
276 3300026035 Ga0207703_10000018 Ga0207703_10000018247 830
277 3300026075 Ga0207708_10001138 Ga0207708_1000113816 830
278 3300048905 Ga0496102_0045550 Ga0496102_0045550_1112_3748 830
279 3300048907 Ga0496104_0060170 Ga0496104_0060170_842_3478 830
280 3300048910 Ga0496107_0010510 Ga0496107_0010510_3140_5776 830
281 3300048911 Ga0496108_0028301 Ga0496108_0028301_1010_3646 830
282 3300048913 Ga0496110_0018768 Ga0496110_0018768_491_3127 830
283 3300048916 Ga0496113_0010910 Ga0496113_0010910_3022_5658 830
284 3300050507 nmdc:mga05p37_78642_c1 nmdc:mga05p37_78642_c1_296_2902 830
285 3300050512 nmdc:mga0n895_77666_c1 nmdc:mga0n895_77666_c1_128_2734 830
286 3300053078 Ga0495612_0013553 Ga0495612_0013553_222_2867 830
287 3300005356 Ga0070674_100000007 Ga0070674_10000000771 831
288 3300005436 Ga0070713_100001073 Ga0070713_1000010739 831
289 3300005718 Ga0068866_10000003 Ga0068866_10000003212 831
290 3300025899 Ga0207642_10000002 Ga0207642_10000002463 831
291 3300025928 Ga0207700_10000033 Ga0207700_10000033115 831
292 3300025937 Ga0207669_10000001 Ga0207669_1000000179 831
293 3300047317 Ga0495604_0000067 Ga0495604_0000067_31264_33984 831
294 3300009101 Ga0105247_10000347 Ga0105247_100003478 832
295 3300009176 Ga0105242_10001472 Ga0105242_1000147217 832
296 3300025900 Ga0207710_10000631 Ga0207710_1000063111 832
297 3300025934 Ga0207686_10000888 Ga0207686_100008884 832
298 3300046684 Ga0495669_0000051 Ga0495669_0000051_24838_27513 832
299 3300048911 Ga0496108_0002101 Ga0496108_0002101_11779_14418 832
300 3300005985 Ga0081539_10011125 Ga0081539_100111252 833
301 3300028556 Ga0265337_1000007 Ga0265337_100000727 833
302 3300028558 Ga0265326_10000019 Ga0265326_1000001925 833
303 3300028654 Ga0265322_10000011 Ga0265322_1000001125 833
304 3300029957 Ga0265324_10000997 Ga0265324_100009973 833
305 3300031240 Ga0265320_10000011 Ga0265320_1000001125 833
306 3300031250 Ga0265331_10004136 Ga0265331_100041363 833
307 3300031251 Ga0265327_10000015 Ga0265327_10000015133 833
308 3300031711 Ga0265314_10000119 Ga0265314_10000119102 833
309 3300046535 Ga0495586_0000959 Ga0495586_0000959_3197_5818 833
310 3300047472 Ga0495686_0000008 Ga0495686_0000008_268195_270861 833
311 3300047472 Ga0495686_0008569 Ga0495686_0008569_3376_6030 833
312 3300053085 Ga0495619_0000008 Ga0495619_0000008_85353_87977 833
313 3300005543 Ga0070672_100000001 Ga0070672_100000001198 834
314 3300009177 Ga0105248_10000020 Ga0105248_10000020228 834
315 3300025940 Ga0207691_10000017 Ga0207691_10000017123 834
316 3300025941 Ga0207711_10000006 Ga0207711_10000006150 834
317 3300045976 Ga0466967_0002279 Ga0466967_0002279_581_3256 834
318 3300046461 Ga0495641_0000111 Ga0495641_0000111_20904_23570 834
319 3300053078 Ga0495612_0000110 Ga0495612_0000110_16403_19027 836
320 3300005616 Ga0068852_100000002 Ga0068852_100000002123 837
321 3300006847 Ga0075431_100045799 Ga0075431_1000457992 837
322 3300006871 Ga0075434_100016456 Ga0075434_1000164562 837
323 3300009147 Ga0114129_10021452 Ga0114129_100214527 837
324 3300026142 Ga0207698_10000004 Ga0207698_10000004162 837
325 3300046463 Ga0495653_0010945 Ga0495653_0010945_2467_5106 837
326 3300050507 nmdc:mga05p37_22310_c1 nmdc:mga05p37_22310_c1_1735_4377 837
327 3300050512 nmdc:mga0n895_32748_c1 nmdc:mga0n895_32748_c1_1939_4581 837
328 3300046663 Ga0495635_0000031 Ga0495635_0000031_27466_30087 838
329 3300047319 Ga0495674_0000010 Ga0495674_0000010_54693_57317 838
330 3300046516 Ga0495628_0011425 Ga0495628_0011425_1491_4151 839
331 3300048915 Ga0496112_0000006 Ga0496112_0000006_32182_34815 839
332 3300053083 Ga0495655_0000002 Ga0495655_0000002_29150_31798 840
333 3300053129 Ga0500628_000001 Ga0500628_000001_117820_120468 840
334 3300005614 Ga0068856_100001668 Ga0068856_10000166815 843
335 3300026078 Ga0207702_10000076 Ga0207702_1000007660 843
336 3300026078 Ga0207702_10008407 Ga0207702_100084074 843
337 3300044842 Ga0466957_0008131 Ga0466957_0008131_1142_3775 843
338 3300005365 Ga0070688_100002791 Ga0070688_1000027913 844
339 3300009098 Ga0105245_10000026 Ga0105245_1000002694 844
340 3300013105 Ga0157369_10000014 Ga0157369_1000001425 844
341 3300025927 Ga0207687_10000017 Ga0207687_1000001788 844
342 3300045976 Ga0466967_0000001 Ga0466967_0000001_205731_208382 844
343 3300013102 Ga0157371_10009163 Ga0157371_100091635 847
344 3300001977 JGI24746J21847_1001074 JGI24746J21847_10010743 848

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07973

tRNA_SAD

Threonyl and Alanyl tRNA synthetase second additional domain

649

692

0.97

PF01411

tRNA-synt_2c

tRNA synthetases class II (A)

5

531

0.94

PF02272

DHHA1

DHHA1 domain

727

876

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
1v4p-assembly3.cif.gz_C crystal structure of alanyl-trna synthetase from pyrococcus horikoshii ot3 0.9196 546 685
4xem-assembly1.cif.gz_A crystal structure of wild type human alars catalytic domain 0.9104 1 354
5v59-assembly1.cif.gz_A crystal structure of catalytic fragment of human alars in complex with aze-sa 0.9077 1 354
4xeo-assembly2.cif.gz_B crystal structure of human alars catalytic domain with r329h mutation 0.9045 1 357
3htz-assembly1.cif.gz_A crystal structure of the catalytic fragment of alanyl-trna synthetase in complex with l-serine: re-refined 0.9018 1 433
ID Description Score Start End Superfamily
af_Q8ID31_1067_1217_3.30.980.10 Alpha Beta;2-Layer Sandwich;Threonyl-tRNA Synthetase; Chain A, domain 2;Threonyl-trna Synthetase; Chain A, domain 2 0.9564 569 696 3.30.980.10
af_A0A2R8QSU7_595_766_3.30.980.10 Alpha Beta;2-Layer Sandwich;Threonyl-tRNA Synthetase; Chain A, domain 2;Threonyl-trna Synthetase; Chain A, domain 2 0.9465 540 692 3.30.980.10
af_P40825_614_789_3.30.980.10 Alpha Beta;2-Layer Sandwich;Threonyl-tRNA Synthetase; Chain A, domain 2;Threonyl-trna Synthetase; Chain A, domain 2 0.9446 540 697 3.30.980.10
af_Q9VRJ1_645_810_3.30.980.10 Alpha Beta;2-Layer Sandwich;Threonyl-tRNA Synthetase; Chain A, domain 2;Threonyl-trna Synthetase; Chain A, domain 2 0.9402 540 696 3.30.980.10
af_Q4DQ33_587_768_3.30.980.10 Alpha Beta;2-Layer Sandwich;Threonyl-tRNA Synthetase; Chain A, domain 2;Threonyl-trna Synthetase; Chain A, domain 2 0.9273 540 696 3.30.980.10

Feature Viewer

pLDDT pTM Quality
84.87 0.63 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map