F416089

General Info

Members Datasets Scaffolds Average Seq Length
344 228 688 280

Family's Representative Sequence

Representative Sequence 3300046460|Ga0495638_0029731|Ga0495638_0029731_2043_3041
Length 332
Sequence MHRMARDTLQIAETGLQYVSGVPAMAHFWERAQNHRRSHKTRGAKGMSEPRSAPTVGQIVLGKRLQDLREKAGLSPEQAARALRVNQTTVRRMEKAEVGLKLLYVEKLLQTYGVDREETDAFLGLAEEANKPGWWHNFRDVVPDWFSVYVSLEGAAKRIRAYEPHWVPGLLQTEGYVRALMAVGFPDACREELDRRVALRMERQALLTRPEDAPQLWAVMDEAVLRRNVGGPDVMRGQIESLLEAVERPNVTLQVVPFDSGPYLGCSGHFQIFRFQIPELPDIVYAEGLTSAVYMDQREEVSAHLQALDRMCEQAATPEGTAAFLRDLLKEI

Samples

Sample ID Description Type Environment
1 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
7 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
8 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
9 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
10 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
11 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
12 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
13 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
14 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
15 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
16 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
17 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
18 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
19 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
20 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
21 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
22 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
23 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
24 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
25 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
26 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
27 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
28 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
29 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
30 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
31 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
32 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
33 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
34 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
35 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
36 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
37 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
38 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
39 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
40 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
41 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
42 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
43 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
44 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
45 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
46 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
47 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
48 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
49 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
50 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
51 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
52 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
53 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
54 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
55 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
56 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
57 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
58 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
59 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
60 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
61 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
62 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
63 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
64 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
65 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
66 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
67 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
68 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
69 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
70 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
71 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
72 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
73 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
74 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
75 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
76 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
77 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
78 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
79 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
80 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
81 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
82 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
83 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
84 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
85 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
86 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
87 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
88 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
89 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
90 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
91 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
92 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
93 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
94 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
95 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
96 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
97 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
98 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
99 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
100 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
101 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
102 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
103 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
104 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
105 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
106 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
107 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
108 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
109 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
110 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
111 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
112 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
113 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
114 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
115 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
116 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
117 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
118 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
119 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
120 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
121 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
122 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
123 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
124 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
125 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
126 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
127 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
128 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
129 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
130 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
131 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
132 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
133 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
134 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
135 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
136 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
137 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
138 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
139 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
140 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
141 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
142 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
143 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
144 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
145 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
146 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
147 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
148 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
149 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
150 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
151 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
152 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
153 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
154 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
155 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
156 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
157 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
158 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
159 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
160 3300053100 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere Metagenome Endosphere
161 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
162 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
163 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
164 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
165 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
166 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
167 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
168 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
169 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
170 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
171 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
172 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
173 3300053732 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere Metagenome Endosphere
174 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
175 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
176 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
177 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
178 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
179 2643221647 Streptomyces sp. Root369 Isolate Unclassified
180 2643221714 Streptomyces sp. Root264 Isolate Unclassified
181 2767802112 Streptomyces avicenniae NRRL B-24776 Isolate Rhizosphere
182 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
183 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
184 2791355406 Streptomyces rhizosphaericus NRRL B-24304 Isolate Unclassified
185 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
186 2808606448 Streptomyces sp. 193411 Isolate Unclassified
187 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
188 2818991463 Streptomyces argenteolus 3259 Isolate Rhizosphere
189 2862290372 Streptomyces triticagri NEAU-YY421 Isolate Rhizosphere
190 2862574272 Streptomyces sp. AcE210 Isolate Nodule
191 2862705112 Streptomyces triticirhizae NEAU-YY642 Isolate Rhizosphere
192 2867346516 Streptomyces radicis AZ1-7 Isolate Unclassified
193 2867369537 Streptomyces sp. Z26 Isolate Unclassified
194 2867428634 Streptomyces sp. RP5T Isolate Unclassified
195 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
196 2912757875 Streptomyces sp. S4.7 Isolate Rhizosphere
197 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
198 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
199 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
200 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
201 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
202 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
203 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
204 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
205 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
206 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
207 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
208 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
209 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
210 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
211 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
212 2990044586 Streptomyces sedi JCM 16909 Isolate Unclassified
213 2990088156 Streptomyces albidus CAP 215 Isolate Unclassified
214 2995463766 Streptacidiphilus fuscans NEAU-YB345 Isolate Unclassified
215 2997600082 Streptomyces coffeae CA1R205 Isolate Unclassified
216 3006393351 Streptomyces sp. SID4985 Isolate Unclassified
217 8008485437 Streptomyces mimosae 3MP-10 Isolate Unclassified
218 8008574985 Streptomyces sp. Jing01 Isolate Rhizosphere
219 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
220 8025524527 Streptomyces sp. 3MP-14 Isolate Unclassified
221 8025530807 Streptomyces sp. 4R-3d Isolate Unclassified
222 8033684223 Streptomyces phytophilus PIP175 Isolate Unclassified
223 8047893842 Streptomyces cangkringensis DSM 41769 Isolate Rhizosphere
224 8048127548 Streptomyces samsunensis DSM 42010 Isolate Rhizosphere
225 8048356638 Streptomyces rhizosphaericus DSM 41760 Isolate Rhizosphere
226 8048369669 Streptomyces indonesiensis DSM 41759 Isolate Rhizoplane
227 8048379754 Streptomyces asiaticus DSM 41761 Isolate Rhizosphere
228 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 81.98
Metatranscriptomes 0
Isolates 18.02

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.01
Nodule 0.29
Rhizoplane 0.87
Rhizosphere 72.09
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495638_0029731 3300046460 Bacteria 3523
2 JGI24737J22298_10046528 3300001990 Bacteria 1324
3 rootH1_10001651 3300003316 Bacteria 12261
4 rootH1_10064550 3300003316 Bacteria 1694
5 rootH2_10085536 3300003320 Bacteria 6072
6 rootH1_10097480 3300003323 Bacteria 3106
7 Ga0070709_10020388 3300005434 Bacteria 3845
8 Ga0070714_100079167 3300005435 Bacteria 2857
9 Ga0070710_10042647 3300005437 Bacteria 2509
10 Ga0070698_100356235 3300005471 Bacteria 1395
11 Ga0070665_100650137 3300005548 Bacteria 1067
12 Ga0068855_100467111 3300005563 Bacteria 1375
13 Ga0081455_10049536 3300005937 Bacteria 3620
14 Ga0070717_10133937 3300006028 Bacteria 2133
15 Ga0075368_10002461 3300006042 Bacteria 6050
16 Ga0070716_100208082 3300006173 Bacteria 1305
17 Ga0070712_100086516 3300006175 Bacteria 2284
18 Ga0075367_10013777 3300006178 Bacteria 4359
19 Ga0075367_10083342 3300006178 Bacteria 1937
20 Ga0105243_10560404 3300009148 Bacteria 1093
21 Ga0105239_10677194 3300010375 Bacteria 1179
22 Ga0157372_10059929 3300013307 Bacteria 4258
23 Ga0182008_10002020 3300014497 Bacteria 13008
24 Ga0182007_10004658 3300015262 Bacteria 6189
25 Ga0209758_1019610 3300025297 Bacteria 3252
26 Ga0207426_1010446 3300025302 Bacteria 3600
27 Ga0207426_1012973 3300025302 Bacteria 3109
28 Ga0207647_10031197 3300025904 Bacteria 3431
29 Ga0207699_10036602 3300025906 Bacteria 2799
30 Ga0207693_10095418 3300025915 Bacteria 2331
31 Ga0207664_10270742 3300025929 Bacteria 1488
32 Ga0207667_10473116 3300025949 Bacteria 1272
33 Ga0209813_10011753 3300027866 Bacteria 2296
34 Ga0307517_10015901 3300028786 Bacteria 9942
35 Ga0307515_10000050 3300028794 Bacteria 275624
36 Ga0307511_10001424 3300030521 Bacteria 25245
37 Ga0307512_10006731 3300030522 Bacteria 11560
38 Ga0307512_10047852 3300030522 Bacteria 3470
39 Ga0307512_10063306 3300030522 Bacteria 2829
40 Ga0307513_10028095 3300031456 Bacteria 6441
41 Ga0307513_10038716 3300031456 Bacteria 5292
42 Ga0307509_10020962 3300031507 Bacteria 7404
43 Ga0307509_10030132 3300031507 Bacteria 6006
44 Ga0307509_10293431 3300031507 Bacteria 1379
45 Ga0307508_10002850 3300031616 Bacteria 17940
46 Ga0307508_10004862 3300031616 Bacteria 12936
47 Ga0307508_10006190 3300031616 Bacteria 11287
48 Ga0307508_10059051 3300031616 Bacteria 3393
49 Ga0307508_10089407 3300031616 Bacteria 2664
50 Ga0307508_10160739 3300031616 Bacteria 1850
51 Ga0307514_10001221 3300031649 Bacteria 34059
52 Ga0307516_10018053 3300031730 Bacteria 7339
53 Ga0307516_10023519 3300031730 Bacteria 6313
54 Ga0307516_10101209 3300031730 Bacteria 2697
55 Ga0307516_10332817 3300031730 Bacteria 1187
56 Ga0307518_10133268 3300031838 Bacteria 1743
57 Ga0307507_10074126 3300033179 Bacteria 3055
58 Ga0307510_10011612 3300033180 Bacteria 10455
59 Ga0307510_10136904 3300033180 Bacteria 2104
60 Ga0307510_10182210 3300033180 Bacteria 1661
61 Ga0373925_0017635 3300037068 Bacteria 5179
62 Ga0373925_0019651 3300037068 Bacteria 4915
63 Ga0395900_0148702 3300037418 Bacteria 2394
64 Ga0395898_0025178 3300037466 Bacteria 6000
65 Ga0395898_0062189 3300037466 Bacteria 3625
66 Ga0395901_0044551 3300038443 Bacteria 4602
67 Ga0439436_0000440 3300041404 Bacteria 10552
68 Ga0439439_0019688 3300041406 Bacteria 1676
69 Ga0451791_0235017 3300041451 Bacteria 1322
70 Ga0451833_0219312 3300041491 Bacteria 923
71 Ga0451835_0781256 3300041492 Bacteria 1486
72 Ga0451843_0244829 3300041509 Bacteria 1370
73 Ga0451853_0767952 3300041512 Bacteria 5639
74 Ga0451853_3901438 3300041512 Bacteria 1558
75 Ga0439433_0001953 3300041999 Bacteria 4317
76 Ga0439442_018847 3300042002 Bacteria 1427
77 Ga0439448_0008168 3300042005 Bacteria 3057
78 Ga0439448_0046085 3300042005 Bacteria 1420
79 Ga0439449_0026033 3300042007 Bacteria 2184
80 Ga0439455_0004836 3300042012 Bacteria 2696
81 Ga0439457_000684 3300042014 Bacteria 10022
82 Ga0439462_0028255 3300042015 Bacteria 1482
83 Ga0450903_000915 3300042138 Bacteria 5659
84 Ga0439458_0000543 3300042157 Bacteria 9696
85 Ga0466972_0204321 3300044658 Bacteria 925
86 Ga0466965_0039948 3300044683 Bacteria 2308
87 Ga0466966_0002645 3300044684 Bacteria 11733
88 Ga0466966_0015767 3300044684 Bacteria 4994
89 Ga0466961_0004975 3300044693 Bacteria 8357
90 Ga0466961_0109608 3300044693 Bacteria 1738
91 Ga0466963_0002064 3300044694 Bacteria 11084
92 Ga0466963_0047751 3300044694 Bacteria 2826
93 Ga0466964_0039026 3300044706 Bacteria 1911
94 Ga0466970_0049055 3300044765 Bacteria 2252
95 Ga0466970_0059349 3300044765 Bacteria 2049
96 Ga0466959_0065037 3300045049 Bacteria 2647
97 Ga0466967_0007341 3300045976 Bacteria 7938
98 Ga0466967_0224758 3300045976 Bacteria 1785
99 Ga0466967_0258681 3300045976 Bacteria 1665
100 Ga0495603_0006824 3300046455 Bacteria 6847
101 Ga0495629_0006420 3300046459 Bacteria 8715
102 Ga0495629_0012723 3300046459 Bacteria 6092
103 Ga0495638_0318571 3300046460 Bacteria 832
104 Ga0495651_0140160 3300046462 Bacteria 1754
105 Ga0495653_0028276 3300046463 Bacteria 4483
106 Ga0495580_0068408 3300046472 Bacteria 2484
107 Ga0495582_0023819 3300046473 Bacteria 3347
108 Ga0495662_0003452 3300046476 Bacteria 8007
109 Ga0495662_0028931 3300046476 Bacteria 2675
110 Ga0495664_0002139 3300046477 Bacteria 10556
111 Ga0495664_0073760 3300046477 Bacteria 2040
112 Ga0495585_0100780 3300046492 Bacteria 1545
113 Ga0495607_0158073 3300046501 Bacteria 1154
114 Ga0495608_0000765 3300046511 Bacteria 22487
115 Ga0495620_0076351 3300046515 Bacteria 1362
116 Ga0495628_0011245 3300046516 Bacteria 7575
117 Ga0495628_0055359 3300046516 Bacteria 3124
118 Ga0495632_0015059 3300046519 Bacteria 4350
119 Ga0495643_0001095 3300046522 Bacteria 26955
120 Ga0495644_0167828 3300046523 Bacteria 842
121 Ga0495666_0002941 3300046526 Bacteria 8540
122 Ga0495652_0063430 3300046529 Bacteria 3110
123 Ga0495652_0120811 3300046529 Bacteria 2090
124 Ga0495665_0002333 3300046531 Bacteria 10255
125 Ga0495640_0024148 3300046533 Bacteria 4422
126 Ga0495587_0004935 3300046536 Bacteria 8742
127 Ga0495587_0033794 3300046536 Bacteria 3085
128 Ga0495597_0059126 3300046542 Bacteria 1674
129 Ga0495645_0005614 3300046543 Bacteria 8629
130 Ga0495645_0070168 3300046543 Bacteria 2528
131 Ga0495667_0061866 3300046559 Bacteria 2453
132 Ga0495667_0259150 3300046559 Bacteria 1106
133 Ga0495634_0001638 3300046642 Bacteria 19488
134 Ga0495634_0073886 3300046642 Bacteria 2241
135 Ga0495611_0151639 3300046648 Bacteria 1082
136 Ga0495625_0002120 3300046660 Bacteria 22135
137 Ga0495625_0081471 3300046660 Bacteria 2253
138 Ga0495635_0006507 3300046663 Bacteria 8147
139 Ga0495635_0257894 3300046663 Bacteria 1174
140 Ga0495588_0008336 3300046674 Bacteria 4751
141 Ga0495588_0055135 3300046674 Bacteria 2051
142 Ga0495657_0001317 3300046675 Bacteria 21612
143 Ga0495599_0090633 3300046678 Bacteria 1908
144 Ga0495623_0089815 3300046679 Bacteria 1887
145 Ga0495646_0015492 3300046680 Bacteria 4837
146 Ga0495646_0176523 3300046680 Bacteria 1174
147 Ga0495658_0030645 3300046683 Bacteria 2923
148 Ga0495658_0181652 3300046683 Bacteria 1305
149 Ga0495613_0002493 3300046689 Bacteria 13883
150 Ga0495613_0015001 3300046689 Bacteria 5750
151 Ga0495613_0110405 3300046689 Bacteria 1982
152 Ga0495624_0133568 3300046690 Bacteria 1521
153 Ga0495670_0139675 3300046691 Bacteria 1266
154 Ga0495671_0003423 3300046692 Bacteria 9752
155 Ga0495589_0047922 3300046794 Bacteria 2116
156 Ga0495589_0054264 3300046794 Bacteria 1976
157 Ga0495600_0041643 3300046809 Bacteria 2993
158 Ga0495660_0006058 3300046810 Bacteria 7182
159 Ga0495581_0013154 3300047315 Bacteria 4799
160 Ga0495604_0004104 3300047317 Bacteria 11572
161 Ga0495604_0017640 3300047317 Bacteria 5714
162 Ga0495674_0088198 3300047319 Bacteria 2653
163 Ga0495676_0006047 3300047321 Bacteria 11122
164 Ga0495676_0018743 3300047321 Bacteria 6100
165 Ga0495676_0060495 3300047321 Bacteria 2967
166 Ga0495687_024497 3300047443 Bacteria 2867
167 Ga0495685_000740 3300047447 Bacteria 9997
168 Ga0495685_001188 3300047447 Bacteria 7970
169 Ga0495685_004383 3300047447 Bacteria 4557
170 Ga0495685_051808 3300047447 Bacteria 1391
171 Ga0495681_0004682 3300047470 Bacteria 9276
172 Ga0495681_0005787 3300047470 Bacteria 8215
173 Ga0495684_0051566 3300047471 Bacteria 3140
174 Ga0495686_0008436 3300047472 Bacteria 7557
175 Ga0495686_0013732 3300047472 Bacteria 5612
176 Ga0495593_0015478 3300047673 Bacteria 4318
177 Ga0495602_0039274 3300048088 Bacteria 4362
178 Ga0495602_0193829 3300048088 Bacteria 1555
179 Ga0495614_0002316 3300048089 Bacteria 8468
180 Ga0501031_0005687 3300049568 Bacteria 8126
181 Ga0501031_0077315 3300049568 Bacteria 2167
182 Ga0501031_0078718 3300049568 Bacteria 2148
183 Ga0501032_0007957 3300049569 Bacteria 7724
184 Ga0501032_0044616 3300049569 Bacteria 3000
185 Ga0501032_0307444 3300049569 Bacteria 1024
186 Ga0501033_0000844 3300049570 Bacteria 27960
187 Ga0501033_0003465 3300049570 Bacteria 12950
188 Ga0501033_0003893 3300049570 Bacteria 12134
189 Ga0501034_0002462 3300049571 Bacteria 22323
190 Ga0501034_0005100 3300049571 Bacteria 14417
191 Ga0501034_0048693 3300049571 Bacteria 4277
192 Ga0501034_0074873 3300049571 Bacteria 3393
193 Ga0501034_0145070 3300049571 Bacteria 2351
194 Ga0501036_0003489 3300049572 Bacteria 12566
195 Ga0501036_0023498 3300049572 Bacteria 5193
196 Ga0501036_0156544 3300049572 Bacteria 1921
197 Ga0501036_0598891 3300049572 Bacteria 914
198 Ga0501037_0005969 3300049573 Bacteria 8897
199 Ga0501037_0017001 3300049573 Bacteria 5352
200 Ga0501037_0022936 3300049573 Bacteria 4616
201 Ga0501037_0068416 3300049573 Bacteria 2585
202 Ga0501037_0129236 3300049573 Bacteria 1812
203 Ga0501038_0006063 3300049574 Bacteria 11181
204 Ga0501038_0387303 3300049574 Bacteria 1083
205 Ga0501039_0004318 3300049575 Bacteria 10718
206 Ga0501042_0203231 3300049578 Bacteria 1428
207 Ga0501042_0221130 3300049578 Bacteria 1366
208 Ga0501043_0005075 3300049579 Bacteria 10652
209 Ga0501043_0036376 3300049579 Bacteria 3872
210 Ga0501043_0046022 3300049579 Bacteria 3430
211 Ga0501043_0142913 3300049579 Bacteria 1874
212 Ga0501043_0398722 3300049579 Bacteria 1040
213 Ga0501046_0001238 3300049580 Bacteria 24703
214 Ga0501046_0015115 3300049580 Bacteria 6489
215 Ga0501046_0018101 3300049580 Bacteria 5868
216 Ga0501046_0228027 3300049580 Bacteria 1377
217 Ga0501046_0274106 3300049580 Bacteria 1237
218 Ga0501047_0000118 3300049581 Bacteria 96347
219 Ga0501047_0005685 3300049581 Bacteria 11733
220 Ga0501047_0008831 3300049581 Bacteria 9508
221 Ga0501047_0010483 3300049581 Bacteria 8772
222 Ga0501047_0014573 3300049581 Bacteria 7479
223 Ga0501048_0002985 3300049582 Bacteria 12917
224 Ga0501048_0025396 3300049582 Bacteria 4317
225 Ga0501068_0009451 3300049584 Bacteria 5458
226 Ga0501069_0304612 3300049585 Bacteria 935
227 Ga0501070_0000906 3300049586 Bacteria 27001
228 Ga0501070_0096195 3300049586 Bacteria 2450
229 Ga0501071_0004001 3300049587 Bacteria 9301
230 Ga0501072_0002087 3300049588 Bacteria 14886
231 Ga0501073_0129570 3300049589 Bacteria 1748
232 Ga0501073_0192269 3300049589 Bacteria 1412
233 Ga0501074_0056903 3300049590 Bacteria 2817
234 Ga0501076_0083226 3300049592 Bacteria 2569
235 Ga0501077_0045539 3300049593 Bacteria 2787
236 Ga0501080_0113628 3300049742 Bacteria 2510
237 Ga0501083_0005115 3300049744 Bacteria 9285
238 Ga0501035_0005903 3300049822 Bacteria 11528
239 Ga0501035_0020942 3300049822 Bacteria 6009
240 Ga0501035_0060630 3300049822 Bacteria 3368
241 Ga0501035_0072768 3300049822 Bacteria 3041
242 Ga0501035_0079924 3300049822 Bacteria 2887
243 Ga0501035_0362461 3300049822 Bacteria 1211
244 Ga0501044_0000324 3300049823 Bacteria 60304
245 Ga0501044_0003161 3300049823 Bacteria 18611
246 Ga0501044_0005012 3300049823 Bacteria 14787
247 Ga0501044_0013186 3300049823 Bacteria 8950
248 Ga0501044_0019699 3300049823 Bacteria 7210
249 Ga0501044_0041191 3300049823 Bacteria 4808
250 Ga0501044_0099915 3300049823 Bacteria 2920
251 Ga0501044_0118041 3300049823 Bacteria 2656
252 Ga0501045_0016282 3300049824 Bacteria 5279
253 Ga0501045_0051634 3300049824 Bacteria 3001
254 nmdc:mga06z11_7843_c1 3300050494 Bacteria 4417
255 nmdc:mga06z11_81584_c1 3300050494 Bacteria 1736
256 nmdc:mga04h51_8224_c1 3300050495 Bacteria 2786
257 Ga0495612_0079497 3300053078 Bacteria 1377
258 Ga0500610_0083496 3300053079 Bacteria 1664
259 Ga0495655_0046171 3300053083 Bacteria 1134
260 Ga0495619_0100047 3300053085 Bacteria 1972
261 Ga0500578_0015706 3300053086 Bacteria 4860
262 Ga0500578_0277007 3300053086 Bacteria 1002
263 Ga0500654_024388 3300053099 Bacteria 3791
264 Ga0500660_039653 3300053100 Bacteria 2404
265 Ga0500560_019338 3300053107 Bacteria 1915
266 Ga0500569_005856 3300053109 Bacteria 2662
267 Ga0500572_008410 3300053111 Bacteria 2412
268 Ga0500614_047347 3300053123 Bacteria 1116
269 Ga0500628_003692 3300053129 Bacteria 2526
270 Ga0500652_012216 3300053131 Bacteria 3006
271 Ga0500658_0003595 3300053134 Bacteria 5847
272 Ga0500573_0078973 3300053140 Bacteria 1872
273 Ga0500573_0099485 3300053140 Bacteria 1638
274 Ga0500600_0061136 3300053149 Bacteria 2100
275 Ga0500600_0068126 3300053149 Bacteria 1959
276 Ga0500616_0018315 3300053153 Bacteria 3961
277 Ga0500633_0001158 3300053160 Bacteria 4796
278 Ga0500634_0019002 3300053161 Bacteria 3696
279 Ga0500656_000404 3300053732 Bacteria 3129
280 Ga0500587_000530 3300053739 Bacteria 4665
281 Ga0501084_0002817 3300054114 Bacteria 14038
282 Ga0501082_0053276 3300060353 Bacteria 3487
283 2585308081 2582581313 Bacteria 10042643
284 2585313931 2582581314 Bacteria 11452267
285 2644266287 2643221647 Bacteria 10741251
286 2644627191 2643221714 Bacteria 9015452
287 2768644931 2767802112 Bacteria 6465194
288 2785366039 2784746768 Bacteria 10036182
289 2786667021 2786546132 Bacteria 10419719
290 2793982118 2791355406 Bacteria 11364898
291 2793982304 2791355406 Bacteria 11364898
292 2808917818 2808606375 Bacteria 9466072
293 2809229154 2808606448 Bacteria 8656184
294 2812359070 2811994879 Bacteria 9313447
295 2819696310 2818991463 Bacteria 7948711
296 2862291331 2862290372 Bacteria 7471434
297 2862575435 2862574272 Bacteria 10567477
298 2862708519 2862705112 Bacteria 6563286
299 2867351740 2867346516 Bacteria 7608576
300 2867371793 2867369537 Bacteria 6501581
301 2867374593 2867369537 Bacteria 6501581
302 2867431642 2867428634 Bacteria 9590268
303 2877684460 2877676314 Bacteria 9512378
304 2912764363 2912757875 Bacteria 7940295
305 2919474528 2919468124 Bacteria 9133025
306 2946066809 2946064051 Bacteria 8957905
307 2946079712 2946072368 Bacteria 8999607
308 2947230419 2947224130 Bacteria 9938529
309 2954381371 2954380949 Bacteria 10050426
310 2954389973 2954380949 Bacteria 10050426
311 2954682106 2954673503 Bacteria 9685905
312 2954690818 2954682443 Bacteria 9862841
313 2954691668 2954691527 Bacteria 10720516
314 2954700675 2954691527 Bacteria 10720516
315 2954701555 2954701450 Bacteria 10834262
316 2954719314 2954711539 Bacteria 10867210
317 2954729285 2954721474 Bacteria 10456478
318 2954732524 2954731030 Bacteria 10243860
319 2954748186 2954740390 Bacteria 10229294
320 2954751403 2954749733 Bacteria 10366972
321 2954767310 2954759201 Bacteria 9358192
322 2990047154 2990044586 Bacteria 6603797
323 2990093744 2990088156 Bacteria 6657676
324 2995468159 2995463766 Bacteria 8577691
325 2997600701 2997600082 Bacteria 9896405
326 3006397010 3006393351 Bacteria 6615579
327 8008486767 8008485437 Bacteria 7198341
328 8008579966 8008574985 Bacteria 7815457
329 8023629028 8023623736 Bacteria 8593882
330 8025525943 8025524527 Bacteria 7197316
331 8025537148 8025530807 Bacteria 8495698
332 8033686737 8033684223 Bacteria 6906479
333 8033689658 8033684223 Bacteria 6906479
334 8047893889 8047893842 Bacteria 11723082
335 8047894248 8047893842 Bacteria 11723082
336 8048130258 8048127548 Bacteria 11053136
337 8048135288 8048127548 Bacteria 11053136
338 8048364906 8048356638 Bacteria 11044339
339 8048365268 8048356638 Bacteria 11044339
340 8048370906 8048369669 Bacteria 11666822
341 8048371265 8048369669 Bacteria 11666822
342 8048380066 8048379754 Bacteria 11877923
343 8048388516 8048379754 Bacteria 11877923
344 8056834421 8056829672 Bacteria 9045328
345 Ga0495638_0029731
346 JGI24737J22298_10046528
347 rootH1_10001651
348 rootH1_10064550
349 rootH2_10085536
350 rootH1_10097480
351 Ga0070709_10020388
352 Ga0070714_100079167
353 Ga0070710_10042647
354 Ga0070698_100356235
355 Ga0070665_100650137
356 Ga0068855_100467111
357 Ga0081455_10049536
358 Ga0070717_10133937
359 Ga0075368_10002461
360 Ga0070716_100208082
361 Ga0070712_100086516
362 Ga0075367_10013777
363 Ga0075367_10083342
364 Ga0105243_10560404
365 Ga0105239_10677194
366 Ga0157372_10059929
367 Ga0182008_10002020
368 Ga0182007_10004658
369 Ga0209758_1019610
370 Ga0207426_1010446
371 Ga0207426_1012973
372 Ga0207647_10031197
373 Ga0207699_10036602
374 Ga0207693_10095418
375 Ga0207664_10270742
376 Ga0207667_10473116
377 Ga0209813_10011753
378 Ga0307517_10015901
379 Ga0307515_10000050
380 Ga0307511_10001424
381 Ga0307512_10006731
382 Ga0307512_10047852
383 Ga0307512_10063306
384 Ga0307513_10028095
385 Ga0307513_10038716
386 Ga0307509_10020962
387 Ga0307509_10030132
388 Ga0307509_10293431
389 Ga0307508_10002850
390 Ga0307508_10004862
391 Ga0307508_10006190
392 Ga0307508_10059051
393 Ga0307508_10089407
394 Ga0307508_10160739
395 Ga0307514_10001221
396 Ga0307516_10018053
397 Ga0307516_10023519
398 Ga0307516_10101209
399 Ga0307516_10332817
400 Ga0307518_10133268
401 Ga0307507_10074126
402 Ga0307510_10011612
403 Ga0307510_10136904
404 Ga0307510_10182210
405 Ga0373925_0017635
406 Ga0373925_0019651
407 Ga0395900_0148702
408 Ga0395898_0025178
409 Ga0395898_0062189
410 Ga0395901_0044551
411 Ga0439436_0000440
412 Ga0439439_0019688
413 Ga0451791_0235017
414 Ga0451833_0219312
415 Ga0451835_0781256
416 Ga0451843_0244829
417 Ga0451853_0767952
418 Ga0451853_3901438
419 Ga0439433_0001953
420 Ga0439442_018847
421 Ga0439448_0008168
422 Ga0439448_0046085
423 Ga0439449_0026033
424 Ga0439455_0004836
425 Ga0439457_000684
426 Ga0439462_0028255
427 Ga0450903_000915
428 Ga0439458_0000543
429 Ga0466972_0204321
430 Ga0466965_0039948
431 Ga0466966_0002645
432 Ga0466966_0015767
433 Ga0466961_0004975
434 Ga0466961_0109608
435 Ga0466963_0002064
436 Ga0466963_0047751
437 Ga0466964_0039026
438 Ga0466970_0049055
439 Ga0466970_0059349
440 Ga0466959_0065037
441 Ga0466967_0007341
442 Ga0466967_0224758
443 Ga0466967_0258681
444 Ga0495603_0006824
445 Ga0495629_0006420
446 Ga0495629_0012723
447 Ga0495638_0318571
448 Ga0495651_0140160
449 Ga0495653_0028276
450 Ga0495580_0068408
451 Ga0495582_0023819
452 Ga0495662_0003452
453 Ga0495662_0028931
454 Ga0495664_0002139
455 Ga0495664_0073760
456 Ga0495585_0100780
457 Ga0495607_0158073
458 Ga0495608_0000765
459 Ga0495620_0076351
460 Ga0495628_0011245
461 Ga0495628_0055359
462 Ga0495632_0015059
463 Ga0495643_0001095
464 Ga0495644_0167828
465 Ga0495666_0002941
466 Ga0495652_0063430
467 Ga0495652_0120811
468 Ga0495665_0002333
469 Ga0495640_0024148
470 Ga0495587_0004935
471 Ga0495587_0033794
472 Ga0495597_0059126
473 Ga0495645_0005614
474 Ga0495645_0070168
475 Ga0495667_0061866
476 Ga0495667_0259150
477 Ga0495634_0001638
478 Ga0495634_0073886
479 Ga0495611_0151639
480 Ga0495625_0002120
481 Ga0495625_0081471
482 Ga0495635_0006507
483 Ga0495635_0257894
484 Ga0495588_0008336
485 Ga0495588_0055135
486 Ga0495657_0001317
487 Ga0495599_0090633
488 Ga0495623_0089815
489 Ga0495646_0015492
490 Ga0495646_0176523
491 Ga0495658_0030645
492 Ga0495658_0181652
493 Ga0495613_0002493
494 Ga0495613_0015001
495 Ga0495613_0110405
496 Ga0495624_0133568
497 Ga0495670_0139675
498 Ga0495671_0003423
499 Ga0495589_0047922
500 Ga0495589_0054264
501 Ga0495600_0041643
502 Ga0495660_0006058
503 Ga0495581_0013154
504 Ga0495604_0004104
505 Ga0495604_0017640
506 Ga0495674_0088198
507 Ga0495676_0006047
508 Ga0495676_0018743
509 Ga0495676_0060495
510 Ga0495687_024497
511 Ga0495685_000740
512 Ga0495685_001188
513 Ga0495685_004383
514 Ga0495685_051808
515 Ga0495681_0004682
516 Ga0495681_0005787
517 Ga0495684_0051566
518 Ga0495686_0008436
519 Ga0495686_0013732
520 Ga0495593_0015478
521 Ga0495602_0039274
522 Ga0495602_0193829
523 Ga0495614_0002316
524 Ga0501031_0005687
525 Ga0501031_0077315
526 Ga0501031_0078718
527 Ga0501032_0007957
528 Ga0501032_0044616
529 Ga0501032_0307444
530 Ga0501033_0000844
531 Ga0501033_0003465
532 Ga0501033_0003893
533 Ga0501034_0002462
534 Ga0501034_0005100
535 Ga0501034_0048693
536 Ga0501034_0074873
537 Ga0501034_0145070
538 Ga0501036_0003489
539 Ga0501036_0023498
540 Ga0501036_0156544
541 Ga0501036_0598891
542 Ga0501037_0005969
543 Ga0501037_0017001
544 Ga0501037_0022936
545 Ga0501037_0068416
546 Ga0501037_0129236
547 Ga0501038_0006063
548 Ga0501038_0387303
549 Ga0501039_0004318
550 Ga0501042_0203231
551 Ga0501042_0221130
552 Ga0501043_0005075
553 Ga0501043_0036376
554 Ga0501043_0046022
555 Ga0501043_0142913
556 Ga0501043_0398722
557 Ga0501046_0001238
558 Ga0501046_0015115
559 Ga0501046_0018101
560 Ga0501046_0228027
561 Ga0501046_0274106
562 Ga0501047_0000118
563 Ga0501047_0005685
564 Ga0501047_0008831
565 Ga0501047_0010483
566 Ga0501047_0014573
567 Ga0501048_0002985
568 Ga0501048_0025396
569 Ga0501068_0009451
570 Ga0501069_0304612
571 Ga0501070_0000906
572 Ga0501070_0096195
573 Ga0501071_0004001
574 Ga0501072_0002087
575 Ga0501073_0129570
576 Ga0501073_0192269
577 Ga0501074_0056903
578 Ga0501076_0083226
579 Ga0501077_0045539
580 Ga0501080_0113628
581 Ga0501083_0005115
582 Ga0501035_0005903
583 Ga0501035_0020942
584 Ga0501035_0060630
585 Ga0501035_0072768
586 Ga0501035_0079924
587 Ga0501035_0362461
588 Ga0501044_0000324
589 Ga0501044_0003161
590 Ga0501044_0005012
591 Ga0501044_0013186
592 Ga0501044_0019699
593 Ga0501044_0041191
594 Ga0501044_0099915
595 Ga0501044_0118041
596 Ga0501045_0016282
597 Ga0501045_0051634
598 nmdc:mga06z11_7843_c1
599 nmdc:mga06z11_81584_c1
600 nmdc:mga04h51_8224_c1
601 Ga0495612_0079497
602 Ga0500610_0083496
603 Ga0495655_0046171
604 Ga0495619_0100047
605 Ga0500578_0015706
606 Ga0500578_0277007
607 Ga0500654_024388
608 Ga0500660_039653
609 Ga0500560_019338
610 Ga0500569_005856
611 Ga0500572_008410
612 Ga0500614_047347
613 Ga0500628_003692
614 Ga0500652_012216
615 Ga0500658_0003595
616 Ga0500573_0078973
617 Ga0500573_0099485
618 Ga0500600_0061136
619 Ga0500600_0068126
620 Ga0500616_0018315
621 Ga0500633_0001158
622 Ga0500634_0019002
623 Ga0500656_000404
624 Ga0500587_000530
625 Ga0501084_0002817
626 Ga0501082_0053276
627 2585308081
628 2585313931
629 2644266287
630 2644627191
631 2768644931
632 2785366039
633 2786667021
634 2793982118
635 2793982304
636 2808917818
637 2809229154
638 2812359070
639 2819696310
640 2862291331
641 2862575435
642 2862708519
643 2867351740
644 2867371793
645 2867374593
646 2867431642
647 2877684460
648 2912764363
649 2919474528
650 2946066809
651 2946079712
652 2947230419
653 2954381371
654 2954389973
655 2954682106
656 2954690818
657 2954691668
658 2954700675
659 2954701555
660 2954719314
661 2954729285
662 2954732524
663 2954748186
664 2954751403
665 2954767310
666 2990047154
667 2990093744
668 2995468159
669 2997600701
670 3006397010
671 8008486767
672 8008579966
673 8023629028
674 8025525943
675 8025537148
676 8033686737
677 8033689658
678 8047893889
679 8047894248
680 8048130258
681 8048135288
682 8048364906
683 8048365268
684 8048370906
685 8048371265
686 8048380066
687 8048388516
688 8056834421

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13560

HTH_31

Helix-turn-helix domain

60

122

0.98

PF19054

DUF5753

Domain of unknown function (DUF5753)

146

327

0.98

PF01381

HTH_3

Helix-turn-helix

65

118

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
7xi5-assembly1.cif.gz_A anti-crispr-associated aca10 0.8942 24 74
1y7y-assembly1.cif.gz_A high-resolution crystal structure of the restriction-modification controller protein c.ahdi from aeromonas hydrophila 0.8737 21 81
3bs3-assembly1.cif.gz_A-2 crystal structure of a putative dna-binding protein from bacteroides fragilis 0.8736 26 80
2bnn-assembly1.cif.gz_B-2 the structure of hydroxypropylphosphonic acid epoxidase from s. wedmorenis in complex with fosfomycin 0.8716 20 77
6rnz-assembly2.cif.gz_B crystal structure of the n-terminal hth dna-binding domain of the essential repressor ddro from radiation-resistant deinococcus bacteria (deinococcus deserti) 0.8711 23 81
ID Description Score Start End Superfamily
1y7yA00 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.8737 21 81 1.10.260.40
1y7yB00 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.8673 21 81 1.10.260.40
2gzuA00 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.8663 26 80 1.10.260.40
3u3wB01 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.8566 21 87 1.10.260.40
2gzuB00 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.8562 27 80 1.10.260.40
ID Description Score Start End GO Terms
AF-A0A6B3I5M7-F1-model_v4 Transcriptional regulator 0.9455 130 293
AF-A0A0C2JQP8-F1-model_v4 DUF5753 domain-containing protein 0.9424 113 292
AF-A0A6V8K0W6-F1-model_v4 DUF5753 domain-containing protein 0.9384 114 293
AF-U5E6M1-F1-model_v4 Putative transcriptional regulator 0.9377 163 292
AF-F4FG91-F1-model_v4 deleted 0.9351 115 293

Map