F415999

General Info

Members Datasets Scaffolds Average Seq Length
344 230 688 203

Family's Representative Sequence

Representative Sequence 3300025937|Ga0207669_10564168|Ga0207669_105641682
Length 200
Sequence MAYSVPDLGYAFDALEPHIDARTMEIHHDKHHAAYVTNLNAALEGTGLDDQPVEQLIANLGQVPEDKRTAVRNNGGGHANHTLFWEIMAPGGATEPSGALAAAVDGFGGLDALKAAVNDAGVKRFGSGWSWVVRDGDGLSVTSTPNQDSPVMDGQSPVLGVDVWEHAYYLNYQNRRPDYLAAWWNVVNWDVVGAKYDAAG

Samples

Sample ID Description Type Environment
1 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
3 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
23 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
24 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
25 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
26 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
27 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
28 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
35 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
36 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
37 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
38 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
39 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
40 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
41 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
42 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
43 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
44 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
45 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
46 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
47 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
48 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
49 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
50 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
51 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
52 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
53 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
54 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
55 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
56 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
57 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
58 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
59 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
60 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
61 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
62 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
63 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
64 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
65 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
66 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
68 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
69 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
70 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
71 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
72 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
73 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
75 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
76 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
77 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
79 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
80 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
81 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
82 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
83 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
84 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
85 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
86 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
87 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
88 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
89 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
90 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
91 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
92 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
93 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
94 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
95 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
96 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
97 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
98 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
99 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
146 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
147 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
148 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
149 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
150 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
151 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
152 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
153 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
154 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
155 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
156 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
157 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
158 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
159 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
160 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
161 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
162 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
163 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
164 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
165 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
166 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
167 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
168 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
169 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
170 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
171 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
172 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
173 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
174 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
175 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
176 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
177 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
178 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
179 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
180 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
181 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
182 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
183 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
184 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
185 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
186 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
187 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
188 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
189 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
190 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
191 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
192 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
193 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
194 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
195 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
196 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
197 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
198 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
199 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
200 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
201 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
202 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
203 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
204 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
205 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
206 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
207 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
208 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
209 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
210 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
211 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
212 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
213 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
214 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
215 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
216 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
217 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
218 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
219 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
220 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
221 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
222 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
223 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
224 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
225 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
226 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
227 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
228 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
229 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
230 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.42
Metatranscriptomes 0.58
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.58
Nodule 0
Rhizoplane 10.76
Rhizosphere 88.37
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207669_10564168 3300025937 Bacteria 920
2 JGI24742J22300_10010990 3300002244 Bacteria 1500
3 JGI25407J50210_10000043 3300003373 Bacteria 14036
4 Ga0070690_100105825 3300005330 Bacteria 1871
5 Ga0070670_100004174 3300005331 Bacteria 12089
6 Ga0070670_100814438 3300005331 Bacteria 844
7 Ga0070677_10161704 3300005333 Bacteria 1051
8 Ga0070666_10194590 3300005335 Bacteria 1426
9 Ga0070682_100026853 3300005337 Bacteria 3449
10 Ga0070682_100335614 3300005337 Bacteria 1122
11 Ga0068868_100362051 3300005338 Bacteria 1244
12 Ga0070660_100070622 3300005339 Bacteria 2725
13 Ga0070689_100007213 3300005340 Bacteria 7748
14 Ga0070691_10129224 3300005341 Bacteria 1279
15 Ga0070687_100044273 3300005343 Bacteria 2267
16 Ga0070661_100109748 3300005344 Bacteria 2059
17 Ga0070692_10020006 3300005345 Bacteria 3239
18 Ga0070668_100088341 3300005347 Bacteria 2440
19 Ga0070675_100092459 3300005354 Bacteria 2536
20 Ga0070675_100223649 3300005354 Bacteria 1640
21 Ga0070674_100003701 3300005356 Bacteria 8616
22 Ga0070674_100010742 3300005356 Bacteria 5551
23 Ga0070674_100070944 3300005356 Bacteria 2462
24 Ga0070673_100104507 3300005364 Bacteria 2339
25 Ga0070688_100008854 3300005365 Bacteria 5478
26 Ga0070667_100308094 3300005367 Bacteria 1427
27 Ga0070709_10061317 3300005434 Bacteria 2394
28 Ga0070710_10018004 3300005437 Bacteria 3627
29 Ga0070701_10030499 3300005438 Bacteria 2668
30 Ga0070711_100013012 3300005439 Bacteria 5216
31 Ga0070700_100016978 3300005441 Bacteria 4155
32 Ga0070700_100256167 3300005441 Bacteria 1258
33 Ga0070694_100434354 3300005444 Bacteria 1034
34 Ga0070708_100017760 3300005445 Bacteria 5940
35 Ga0070663_100007401 3300005455 Bacteria 6679
36 Ga0070678_100012084 3300005456 Bacteria 5352
37 Ga0070678_100166118 3300005456 Bacteria 1793
38 Ga0070678_100644569 3300005456 Bacteria 950
39 Ga0070662_100032571 3300005457 Bacteria 3663
40 Ga0070662_100494203 3300005457 Bacteria 1020
41 Ga0070681_10028657 3300005458 Bacteria 5599
42 Ga0068867_100058963 3300005459 Bacteria 2844
43 Ga0068867_100567050 3300005459 Bacteria 986
44 Ga0070685_10022108 3300005466 Bacteria 3463
45 Ga0070706_100009424 3300005467 Bacteria 9090
46 Ga0070707_100820988 3300005468 Bacteria 894
47 Ga0070698_100021357 3300005471 Bacteria 6782
48 Ga0070698_100025410 3300005471 Bacteria 6173
49 Ga0070698_100194111 3300005471 Bacteria 1968
50 Ga0070699_100009403 3300005518 Bacteria 8465
51 Ga0070699_100011259 3300005518 Bacteria 7727
52 Ga0070679_100314456 3300005530 Bacteria 1516
53 Ga0070684_100001231 3300005535 Bacteria 18373
54 Ga0068853_100291699 3300005539 Bacteria 1506
55 Ga0070672_100134672 3300005543 Bacteria 2034
56 Ga0070686_100024340 3300005544 Bacteria 3628
57 Ga0070696_100182235 3300005546 Bacteria 1558
58 Ga0070693_100003202 3300005547 Bacteria 7595
59 Ga0070693_100300100 3300005547 Bacteria 1082
60 Ga0070665_100253193 3300005548 Bacteria 1762
61 Ga0070704_100096454 3300005549 Bacteria 2217
62 Ga0070704_100115843 3300005549 Bacteria 2048
63 Ga0070704_100173353 3300005549 Bacteria 1718
64 Ga0068855_100623503 3300005563 Bacteria 1161
65 Ga0070664_100319325 3300005564 Bacteria 1407
66 Ga0070664_101171988 3300005564 Bacteria 724
67 Ga0068856_100050320 3300005614 Bacteria 4107
68 Ga0070702_100008466 3300005615 Bacteria 4983
69 Ga0068852_100041462 3300005616 Bacteria 3891
70 Ga0068859_100143953 3300005617 Bacteria 2458
71 Ga0068864_100554750 3300005618 Bacteria 1111
72 Ga0068864_101332038 3300005618 Bacteria 719
73 Ga0068866_10004578 3300005718 Bacteria 5665
74 Ga0068866_10024769 3300005718 Bacteria 2813
75 Ga0068870_10059074 3300005840 Bacteria 2055
76 Ga0068860_100174465 3300005843 Bacteria 2077
77 Ga0068862_100416576 3300005844 Bacteria 1260
78 Ga0081455_10045964 3300005937 Bacteria 3794
79 Ga0081539_10003886 3300005985 Bacteria 17436
80 Ga0070717_10041371 3300006028 Bacteria 3757
81 Ga0075365_10608289 3300006038 Bacteria 773
82 Ga0070715_10138992 3300006163 Bacteria 1178
83 Ga0070716_100173855 3300006173 Bacteria 1408
84 Ga0070712_100011833 3300006175 Bacteria 5543
85 Ga0070712_100026250 3300006175 Bacteria 3878
86 Ga0097621_100872588 3300006237 Bacteria 837
87 Ga0075370_10112995 3300006353 Bacteria 1578
88 Ga0068871_100151607 3300006358 Bacteria 1977
89 Ga0075428_100330470 3300006844 Bacteria 1637
90 Ga0075433_10031393 3300006852 Bacteria 4541
91 Ga0075434_100066799 3300006871 Bacteria 3583
92 Ga0075434_100515691 3300006871 Bacteria 1216
93 Ga0068865_100004034 3300006881 Bacteria 8817
94 Ga0097620_100143959 3300006931 Bacteria 2458
95 Ga0075435_100035473 3300007076 Bacteria 3959
96 Ga0105245_10011519 3300009098 Bacteria 7701
97 Ga0105245_10028287 3300009098 Bacteria 4942
98 Ga0105245_10039188 3300009098 Bacteria 4217
99 Ga0105245_10054784 3300009098 Bacteria 3581
100 Ga0105245_10142787 3300009098 Bacteria 2257
101 Ga0105245_10178551 3300009098 Bacteria 2027
102 Ga0105247_10055599 3300009101 Bacteria 2442
103 Ga0114129_10169037 3300009147 Bacteria 2982
104 Ga0114129_10845595 3300009147 Bacteria 1164
105 Ga0105243_10080965 3300009148 Bacteria 2650
106 Ga0105243_10095197 3300009148 Bacteria 2461
107 Ga0105241_10064109 3300009174 Bacteria 2836
108 Ga0105242_10485639 3300009176 Bacteria 1172
109 Ga0105242_11121365 3300009176 Bacteria 802
110 Ga0105248_10095300 3300009177 Bacteria 3351
111 Ga0105248_10117597 3300009177 Bacteria 2998
112 Ga0105238_10142058 3300009551 Bacteria 2377
113 Ga0105238_11182680 3300009551 Bacteria 789
114 Ga0105249_10505725 3300009553 Bacteria 1254
115 Ga0105249_11236409 3300009553 Bacteria 818
116 Ga0105239_10018124 3300010375 Bacteria 7783
117 Ga0105239_10200027 3300010375 Bacteria 2238
118 Ga0105246_10090662 3300011119 Bacteria 2201
119 Ga0105246_10468471 3300011119 Bacteria 1063
120 Ga0157373_10499112 3300013100 Bacteria 879
121 Ga0157371_10154023 3300013102 Bacteria 1640
122 Ga0157374_10050353 3300013296 Bacteria 3871
123 Ga0157374_10077371 3300013296 Bacteria 3148
124 Ga0157378_10047988 3300013297 Bacteria 3797
125 Ga0163162_10012177 3300013306 Bacteria 8395
126 Ga0157375_10099964 3300013308 Bacteria 2980
127 Ga0157375_10105253 3300013308 Bacteria 2911
128 Ga0157380_10129375 3300014326 Bacteria 2151
129 Ga0157380_10292828 3300014326 Bacteria 1495
130 Ga0157377_10013240 3300014745 Bacteria 4171
131 Ga0157377_10315230 3300014745 Bacteria 1037
132 Ga0157376_10022913 3300014969 Bacteria 4877
133 Ga0157376_10118811 3300014969 Bacteria 2340
134 Ga0157376_10307042 3300014969 Bacteria 1504
135 Ga0163161_10270852 3300017792 Bacteria 1329
136 Ga0206356_10865017 3300020070 Bacteria 702
137 Ga0206354_10496455 3300020081 Bacteria 649
138 Ga0213871_10020660 3300021441 Bacteria 1634
139 Ga0207692_10036547 3300025898 Bacteria 2396
140 Ga0207692_10598694 3300025898 Bacteria 708
141 Ga0207642_10010084 3300025899 Bacteria 3313
142 Ga0207642_10021069 3300025899 Bacteria 2559
143 Ga0207688_10067801 3300025901 Bacteria 2019
144 Ga0207680_10197620 3300025903 Bacteria 1368
145 Ga0207699_10016428 3300025906 Bacteria 3872
146 Ga0207643_10012890 3300025908 Bacteria 4520
147 Ga0207684_10011311 3300025910 Bacteria 7814
148 Ga0207654_10025575 3300025911 Bacteria 3185
149 Ga0207707_10020338 3300025912 Bacteria 5796
150 Ga0207693_10061917 3300025915 Bacteria 2931
151 Ga0207693_10089564 3300025915 Bacteria 2412
152 Ga0207663_10042646 3300025916 Bacteria 2773
153 Ga0207660_10014371 3300025917 Bacteria 5205
154 Ga0207660_10067371 3300025917 Bacteria 2593
155 Ga0207662_10100820 3300025918 Bacteria 1789
156 Ga0207662_10775814 3300025918 Bacteria 675
157 Ga0207657_10166839 3300025919 Bacteria 1785
158 Ga0207649_10042612 3300025920 Bacteria 2770
159 Ga0207652_10170046 3300025921 Bacteria 1955
160 Ga0207646_10589117 3300025922 Bacteria 999
161 Ga0207646_10878197 3300025922 Bacteria 796
162 Ga0207681_10381922 3300025923 Bacteria 1134
163 Ga0207694_10414398 3300025924 Bacteria 1122
164 Ga0207650_10003682 3300025925 Bacteria 10478
165 Ga0207659_10105381 3300025926 Bacteria 2134
166 Ga0207659_10204825 3300025926 Bacteria 1578
167 Ga0207687_10002562 3300025927 Bacteria 12349
168 Ga0207687_10043962 3300025927 Bacteria 3080
169 Ga0207687_10064368 3300025927 Bacteria 2600
170 Ga0207687_10115547 3300025927 Bacteria 1999
171 Ga0207687_10140019 3300025927 Bacteria 1834
172 Ga0207687_10142997 3300025927 Bacteria 1817
173 Ga0207690_10189188 3300025932 Bacteria 1556
174 Ga0207706_10596362 3300025933 Bacteria 949
175 Ga0207706_10649225 3300025933 Bacteria 904
176 Ga0207686_10017671 3300025934 Bacteria 4022
177 Ga0207686_10282537 3300025934 Bacteria 1226
178 Ga0207709_10001948 3300025935 Bacteria 13509
179 Ga0207709_10048737 3300025935 Bacteria 2582
180 Ga0207670_10045330 3300025936 Bacteria 2914
181 Ga0207669_10001022 3300025937 Bacteria 11950
182 Ga0207669_10038176 3300025937 Bacteria 2763
183 Ga0207669_10079405 3300025937 Bacteria 2094
184 Ga0207704_10000430 3300025938 Bacteria 18740
185 Ga0207704_10105305 3300025938 Bacteria 1892
186 Ga0207704_10557311 3300025938 Bacteria 932
187 Ga0207665_10159052 3300025939 Bacteria 1624
188 Ga0207691_10025065 3300025940 Bacteria 5603
189 Ga0207691_10074032 3300025940 Bacteria 3072
190 Ga0207691_10501956 3300025940 Bacteria 1030
191 Ga0207711_10250483 3300025941 Bacteria 1626
192 Ga0207661_10002828 3300025944 Bacteria 11986
193 Ga0207667_10737390 3300025949 Bacteria 985
194 Ga0207651_10402737 3300025960 Bacteria 1164
195 Ga0207712_10194395 3300025961 Bacteria 1604
196 Ga0207668_10100805 3300025972 Bacteria 2145
197 Ga0207639_10478791 3300026041 Bacteria 1134
198 Ga0207678_10012909 3300026067 Bacteria 7332
199 Ga0207678_10044074 3300026067 Bacteria 3860
200 Ga0207708_10000352 3300026075 Bacteria 36059
201 Ga0207708_10268416 3300026075 Bacteria 1379
202 Ga0207702_10053447 3300026078 Bacteria 3419
203 Ga0207648_10000454 3300026089 Bacteria 45454
204 Ga0207648_10063886 3300026089 Bacteria 3208
205 Ga0207648_10627821 3300026089 Bacteria 992
206 Ga0207676_10231285 3300026095 Bacteria 1653
207 Ga0207676_11257662 3300026095 Bacteria 734
208 Ga0207674_10076874 3300026116 Bacteria 3345
209 Ga0207674_10530982 3300026116 Bacteria 1137
210 Ga0207675_100078193 3300026118 Bacteria 3099
211 Ga0207683_10001930 3300026121 Bacteria 18362
212 Ga0207683_10011557 3300026121 Bacteria 7538
213 Ga0207698_10808431 3300026142 Bacteria 940
214 Ga0307408_100571386 3300031548 Bacteria 1000
215 Ga0307408_100723394 3300031548 Bacteria 897
216 Ga0307408_100845210 3300031548 Bacteria 834
217 Ga0307405_10062886 3300031731 Bacteria 2352
218 Ga0307413_10076426 3300031824 Bacteria 2128
219 Ga0307413_10537317 3300031824 Bacteria 946
220 Ga0307407_10088872 3300031903 Bacteria 1888
221 Ga0307409_100340911 3300031995 Bacteria 1410
222 Ga0307409_100760944 3300031995 Bacteria 973
223 Ga0307416_100015649 3300032002 Bacteria 5245
224 Ga0307416_100016128 3300032002 Bacteria 5181
225 Ga0307416_100139280 3300032002 Bacteria 2202
226 Ga0307416_100330974 3300032002 Bacteria 1531
227 Ga0307414_10149606 3300032004 Bacteria 1840
228 Ga0307411_10115402 3300032005 Bacteria 1931
229 Ga0307415_100010076 3300032126 Bacteria 5333
230 Ga0307415_100010635 3300032126 Bacteria 5220
231 Ga0436360_0921741 3300039438 Bacteria 2787
232 Ga0436362_0694027 3300039453 Bacteria 1932
233 Ga0439438_103443 3300041405 Bacteria 690
234 Ga0439461_0009621 3300041410 Bacteria 1756
235 Ga0451853_2306675 3300041512 Bacteria 1283
236 Ga0439437_006115 3300042000 Bacteria 1330
237 Ga0439441_011337 3300042001 Bacteria 1511
238 Ga0450920_004303 3300042122 Bacteria 2496
239 Ga0450894_025217 3300042131 Bacteria 814
240 Ga0450906_022833 3300042145 Bacteria 1115
241 Ga0439446_0034958 3300042156 Bacteria 1464
242 Ga0439434_0022200 3300042435 Bacteria 1908
243 Ga0450918_010670 3300042531 Bacteria 1603
244 Ga0466972_0139670 3300044658 Bacteria 1140
245 Ga0466957_0461084 3300044842 Bacteria 877
246 Ga0466967_0380400 3300045976 Bacteria 1370
247 Ga0495592_0219094 3300046454 Bacteria 1273
248 Ga0495582_0175595 3300046473 Bacteria 1220
249 Ga0495639_0133687 3300046475 Bacteria 1189
250 Ga0495664_0063520 3300046477 Bacteria 2201
251 Ga0495664_0497286 3300046477 Bacteria 728
252 Ga0495584_0072860 3300046491 Bacteria 1726
253 Ga0495584_0132199 3300046491 Bacteria 1266
254 Ga0495594_0126010 3300046499 Bacteria 1449
255 Ga0495620_0127716 3300046515 Bacteria 999
256 Ga0495630_0688347 3300046517 Bacteria 782
257 Ga0495632_0338529 3300046519 Bacteria 663
258 Ga0495644_0103105 3300046523 Bacteria 1080
259 Ga0495663_0014503 3300046525 Bacteria 2210
260 Ga0495652_0401851 3300046529 Bacteria 970
261 Ga0495587_0091969 3300046536 Bacteria 1752
262 Ga0495656_0068538 3300046615 Bacteria 1569
263 Ga0495668_0056101 3300046616 Bacteria 2175
264 Ga0495668_0216896 3300046616 Bacteria 1048
265 Ga0495635_0096129 3300046663 Bacteria 2025
266 Ga0495659_0024285 3300046664 Bacteria 2067
267 Ga0495646_0094642 3300046680 Bacteria 1720
268 Ga0495624_0256656 3300046690 Bacteria 1057
269 Ga0495589_0232410 3300046794 Bacteria 864
270 Ga0495589_0328739 3300046794 Bacteria 706
271 Ga0495581_0026455 3300047315 Bacteria 3363
272 Ga0495581_0124845 3300047315 Bacteria 1499
273 Ga0495604_0219065 3300047317 Bacteria 1311
274 Ga0495604_0715810 3300047317 Bacteria 635
275 Ga0495674_0146685 3300047319 Bacteria 1980
276 Ga0495677_0120608 3300047445 Bacteria 1000
277 Ga0495685_186723 3300047447 Bacteria 667
278 Ga0495614_0095882 3300048089 Bacteria 1293
279 Ga0495615_0058872 3300048090 Bacteria 1009
280 Ga0495615_0120135 3300048090 Bacteria 759
281 Ga0496100_0022678 3300048903 Bacteria 3801
282 Ga0496100_0025620 3300048903 Bacteria 3609
283 Ga0496101_0021654 3300048904 Bacteria 4417
284 Ga0496102_0003505 3300048905 Bacteria 13306
285 Ga0496102_0038532 3300048905 Bacteria 4314
286 Ga0496102_0249444 3300048905 Bacteria 1673
287 Ga0496103_0002452 3300048906 Bacteria 11663
288 Ga0496103_0006910 3300048906 Bacteria 6778
289 Ga0496103_0038937 3300048906 Bacteria 2920
290 Ga0496104_0004087 3300048907 Bacteria 12665
291 Ga0496104_0013994 3300048907 Bacteria 7238
292 Ga0496105_0030876 3300048908 Bacteria 4393
293 Ga0496105_0077903 3300048908 Bacteria 2737
294 Ga0496105_0259612 3300048908 Bacteria 1405
295 Ga0496106_0003849 3300048909 Bacteria 11188
296 Ga0496106_0220344 3300048909 Bacteria 1513
297 Ga0496106_0544036 3300048909 Bacteria 932
298 Ga0496107_0162560 3300048910 Bacteria 1655
299 Ga0496107_0339778 3300048910 Bacteria 1117
300 Ga0496108_0027385 3300048911 Bacteria 4706
301 Ga0496108_0053208 3300048911 Bacteria 3394
302 Ga0496108_0419094 3300048911 Bacteria 1169
303 Ga0496109_0002799 3300048912 Bacteria 14605
304 Ga0496109_0006032 3300048912 Bacteria 10183
305 Ga0496110_0000958 3300048913 Bacteria 20207
306 Ga0496110_0145333 3300048913 Bacteria 2145
307 Ga0496110_0181092 3300048913 Bacteria 1913
308 Ga0496110_0661674 3300048913 Bacteria 945
309 Ga0496111_0012316 3300048914 Bacteria 5786
310 Ga0496111_0524540 3300048914 Bacteria 871
311 Ga0496112_0040108 3300048915 Bacteria 4577
312 Ga0496112_0556789 3300048915 Bacteria 1080
313 Ga0496113_0599370 3300048916 Bacteria 882
314 Ga0496114_0000293 3300048917 Bacteria 36652
315 Ga0496114_0198515 3300048917 Bacteria 1756
316 Ga0496115_0005265 3300048918 Bacteria 9402
317 Ga0496115_0091616 3300048918 Bacteria 2484
318 Ga0501031_0332977 3300049568 Bacteria 983
319 Ga0501040_0033014 3300049576 Bacteria 3505
320 Ga0501040_0330888 3300049576 Bacteria 1090
321 Ga0501040_0889421 3300049576 Bacteria 645
322 Ga0501041_0240887 3300049577 Bacteria 1137
323 Ga0501067_0040448 3300049583 Bacteria 2589
324 Ga0501067_0158686 3300049583 Bacteria 1260
325 Ga0501068_0013838 3300049584 Bacteria 4598
326 Ga0501071_0181782 3300049587 Bacteria 1576
327 Ga0501075_0748587 3300049591 Bacteria 744
328 Ga0501076_0525367 3300049592 Bacteria 976
329 Ga0501076_0578570 3300049592 Bacteria 926
330 Ga0501079_0273266 3300049741 Bacteria 1321
331 Ga0501045_0186521 3300049824 Bacteria 1546
332 nmdc:mga05p37_263578_c1 3300050507 Bacteria 2061
333 nmdc:mga05p37_300406_c1 3300050507 Bacteria 1908
334 nmdc:mga09592_977210_c1 3300050508 Bacteria 709
335 nmdc:mga0n895_18138_c1 3300050512 Bacteria 6506
336 nmdc:mga0n895_581340_c1 3300050512 Bacteria 1124
337 nmdc:mga0a205_75285_c1 3300050515 Bacteria 3262
338 Ga0495601_0321593 3300053077 Bacteria 1007
339 Ga0495619_0083834 3300053085 Bacteria 2150
340 Ga0495619_0128970 3300053085 Bacteria 1737
341 Ga0495619_0149418 3300053085 Bacteria 1611
342 Ga0495619_0287855 3300053085 Bacteria 1138
343 Ga0501082_0080800 3300060353 Bacteria 2806
344 Ga0530510_0270826 3300061734 Bacteria 1267
345 Ga0207669_10564168
346 JGI24742J22300_10010990
347 JGI25407J50210_10000043
348 Ga0070690_100105825
349 Ga0070670_100004174
350 Ga0070670_100814438
351 Ga0070677_10161704
352 Ga0070666_10194590
353 Ga0070682_100026853
354 Ga0070682_100335614
355 Ga0068868_100362051
356 Ga0070660_100070622
357 Ga0070689_100007213
358 Ga0070691_10129224
359 Ga0070687_100044273
360 Ga0070661_100109748
361 Ga0070692_10020006
362 Ga0070668_100088341
363 Ga0070675_100092459
364 Ga0070675_100223649
365 Ga0070674_100003701
366 Ga0070674_100010742
367 Ga0070674_100070944
368 Ga0070673_100104507
369 Ga0070688_100008854
370 Ga0070667_100308094
371 Ga0070709_10061317
372 Ga0070710_10018004
373 Ga0070701_10030499
374 Ga0070711_100013012
375 Ga0070700_100016978
376 Ga0070700_100256167
377 Ga0070694_100434354
378 Ga0070708_100017760
379 Ga0070663_100007401
380 Ga0070678_100012084
381 Ga0070678_100166118
382 Ga0070678_100644569
383 Ga0070662_100032571
384 Ga0070662_100494203
385 Ga0070681_10028657
386 Ga0068867_100058963
387 Ga0068867_100567050
388 Ga0070685_10022108
389 Ga0070706_100009424
390 Ga0070707_100820988
391 Ga0070698_100021357
392 Ga0070698_100025410
393 Ga0070698_100194111
394 Ga0070699_100009403
395 Ga0070699_100011259
396 Ga0070679_100314456
397 Ga0070684_100001231
398 Ga0068853_100291699
399 Ga0070672_100134672
400 Ga0070686_100024340
401 Ga0070696_100182235
402 Ga0070693_100003202
403 Ga0070693_100300100
404 Ga0070665_100253193
405 Ga0070704_100096454
406 Ga0070704_100115843
407 Ga0070704_100173353
408 Ga0068855_100623503
409 Ga0070664_100319325
410 Ga0070664_101171988
411 Ga0068856_100050320
412 Ga0070702_100008466
413 Ga0068852_100041462
414 Ga0068859_100143953
415 Ga0068864_100554750
416 Ga0068864_101332038
417 Ga0068866_10004578
418 Ga0068866_10024769
419 Ga0068870_10059074
420 Ga0068860_100174465
421 Ga0068862_100416576
422 Ga0081455_10045964
423 Ga0081539_10003886
424 Ga0070717_10041371
425 Ga0075365_10608289
426 Ga0070715_10138992
427 Ga0070716_100173855
428 Ga0070712_100011833
429 Ga0070712_100026250
430 Ga0097621_100872588
431 Ga0075370_10112995
432 Ga0068871_100151607
433 Ga0075428_100330470
434 Ga0075433_10031393
435 Ga0075434_100066799
436 Ga0075434_100515691
437 Ga0068865_100004034
438 Ga0097620_100143959
439 Ga0075435_100035473
440 Ga0105245_10011519
441 Ga0105245_10028287
442 Ga0105245_10039188
443 Ga0105245_10054784
444 Ga0105245_10142787
445 Ga0105245_10178551
446 Ga0105247_10055599
447 Ga0114129_10169037
448 Ga0114129_10845595
449 Ga0105243_10080965
450 Ga0105243_10095197
451 Ga0105241_10064109
452 Ga0105242_10485639
453 Ga0105242_11121365
454 Ga0105248_10095300
455 Ga0105248_10117597
456 Ga0105238_10142058
457 Ga0105238_11182680
458 Ga0105249_10505725
459 Ga0105249_11236409
460 Ga0105239_10018124
461 Ga0105239_10200027
462 Ga0105246_10090662
463 Ga0105246_10468471
464 Ga0157373_10499112
465 Ga0157371_10154023
466 Ga0157374_10050353
467 Ga0157374_10077371
468 Ga0157378_10047988
469 Ga0163162_10012177
470 Ga0157375_10099964
471 Ga0157375_10105253
472 Ga0157380_10129375
473 Ga0157380_10292828
474 Ga0157377_10013240
475 Ga0157377_10315230
476 Ga0157376_10022913
477 Ga0157376_10118811
478 Ga0157376_10307042
479 Ga0163161_10270852
480 Ga0206356_10865017
481 Ga0206354_10496455
482 Ga0213871_10020660
483 Ga0207692_10036547
484 Ga0207692_10598694
485 Ga0207642_10010084
486 Ga0207642_10021069
487 Ga0207688_10067801
488 Ga0207680_10197620
489 Ga0207699_10016428
490 Ga0207643_10012890
491 Ga0207684_10011311
492 Ga0207654_10025575
493 Ga0207707_10020338
494 Ga0207693_10061917
495 Ga0207693_10089564
496 Ga0207663_10042646
497 Ga0207660_10014371
498 Ga0207660_10067371
499 Ga0207662_10100820
500 Ga0207662_10775814
501 Ga0207657_10166839
502 Ga0207649_10042612
503 Ga0207652_10170046
504 Ga0207646_10589117
505 Ga0207646_10878197
506 Ga0207681_10381922
507 Ga0207694_10414398
508 Ga0207650_10003682
509 Ga0207659_10105381
510 Ga0207659_10204825
511 Ga0207687_10002562
512 Ga0207687_10043962
513 Ga0207687_10064368
514 Ga0207687_10115547
515 Ga0207687_10140019
516 Ga0207687_10142997
517 Ga0207690_10189188
518 Ga0207706_10596362
519 Ga0207706_10649225
520 Ga0207686_10017671
521 Ga0207686_10282537
522 Ga0207709_10001948
523 Ga0207709_10048737
524 Ga0207670_10045330
525 Ga0207669_10001022
526 Ga0207669_10038176
527 Ga0207669_10079405
528 Ga0207704_10000430
529 Ga0207704_10105305
530 Ga0207704_10557311
531 Ga0207665_10159052
532 Ga0207691_10025065
533 Ga0207691_10074032
534 Ga0207691_10501956
535 Ga0207711_10250483
536 Ga0207661_10002828
537 Ga0207667_10737390
538 Ga0207651_10402737
539 Ga0207712_10194395
540 Ga0207668_10100805
541 Ga0207639_10478791
542 Ga0207678_10012909
543 Ga0207678_10044074
544 Ga0207708_10000352
545 Ga0207708_10268416
546 Ga0207702_10053447
547 Ga0207648_10000454
548 Ga0207648_10063886
549 Ga0207648_10627821
550 Ga0207676_10231285
551 Ga0207676_11257662
552 Ga0207674_10076874
553 Ga0207674_10530982
554 Ga0207675_100078193
555 Ga0207683_10001930
556 Ga0207683_10011557
557 Ga0207698_10808431
558 Ga0307408_100571386
559 Ga0307408_100723394
560 Ga0307408_100845210
561 Ga0307405_10062886
562 Ga0307413_10076426
563 Ga0307413_10537317
564 Ga0307407_10088872
565 Ga0307409_100340911
566 Ga0307409_100760944
567 Ga0307416_100015649
568 Ga0307416_100016128
569 Ga0307416_100139280
570 Ga0307416_100330974
571 Ga0307414_10149606
572 Ga0307411_10115402
573 Ga0307415_100010076
574 Ga0307415_100010635
575 Ga0436360_0921741
576 Ga0436362_0694027
577 Ga0439438_103443
578 Ga0439461_0009621
579 Ga0451853_2306675
580 Ga0439437_006115
581 Ga0439441_011337
582 Ga0450920_004303
583 Ga0450894_025217
584 Ga0450906_022833
585 Ga0439446_0034958
586 Ga0439434_0022200
587 Ga0450918_010670
588 Ga0466972_0139670
589 Ga0466957_0461084
590 Ga0466967_0380400
591 Ga0495592_0219094
592 Ga0495582_0175595
593 Ga0495639_0133687
594 Ga0495664_0063520
595 Ga0495664_0497286
596 Ga0495584_0072860
597 Ga0495584_0132199
598 Ga0495594_0126010
599 Ga0495620_0127716
600 Ga0495630_0688347
601 Ga0495632_0338529
602 Ga0495644_0103105
603 Ga0495663_0014503
604 Ga0495652_0401851
605 Ga0495587_0091969
606 Ga0495656_0068538
607 Ga0495668_0056101
608 Ga0495668_0216896
609 Ga0495635_0096129
610 Ga0495659_0024285
611 Ga0495646_0094642
612 Ga0495624_0256656
613 Ga0495589_0232410
614 Ga0495589_0328739
615 Ga0495581_0026455
616 Ga0495581_0124845
617 Ga0495604_0219065
618 Ga0495604_0715810
619 Ga0495674_0146685
620 Ga0495677_0120608
621 Ga0495685_186723
622 Ga0495614_0095882
623 Ga0495615_0058872
624 Ga0495615_0120135
625 Ga0496100_0022678
626 Ga0496100_0025620
627 Ga0496101_0021654
628 Ga0496102_0003505
629 Ga0496102_0038532
630 Ga0496102_0249444
631 Ga0496103_0002452
632 Ga0496103_0006910
633 Ga0496103_0038937
634 Ga0496104_0004087
635 Ga0496104_0013994
636 Ga0496105_0030876
637 Ga0496105_0077903
638 Ga0496105_0259612
639 Ga0496106_0003849
640 Ga0496106_0220344
641 Ga0496106_0544036
642 Ga0496107_0162560
643 Ga0496107_0339778
644 Ga0496108_0027385
645 Ga0496108_0053208
646 Ga0496108_0419094
647 Ga0496109_0002799
648 Ga0496109_0006032
649 Ga0496110_0000958
650 Ga0496110_0145333
651 Ga0496110_0181092
652 Ga0496110_0661674
653 Ga0496111_0012316
654 Ga0496111_0524540
655 Ga0496112_0040108
656 Ga0496112_0556789
657 Ga0496113_0599370
658 Ga0496114_0000293
659 Ga0496114_0198515
660 Ga0496115_0005265
661 Ga0496115_0091616
662 Ga0501031_0332977
663 Ga0501040_0033014
664 Ga0501040_0330888
665 Ga0501040_0889421
666 Ga0501041_0240887
667 Ga0501067_0040448
668 Ga0501067_0158686
669 Ga0501068_0013838
670 Ga0501071_0181782
671 Ga0501075_0748587
672 Ga0501076_0525367
673 Ga0501076_0578570
674 Ga0501079_0273266
675 Ga0501045_0186521
676 nmdc:mga05p37_263578_c1
677 nmdc:mga05p37_300406_c1
678 nmdc:mga09592_977210_c1
679 nmdc:mga0n895_18138_c1
680 nmdc:mga0n895_581340_c1
681 nmdc:mga0a205_75285_c1
682 Ga0495601_0321593
683 Ga0495619_0083834
684 Ga0495619_0128970
685 Ga0495619_0149418
686 Ga0495619_0287855
687 Ga0501082_0080800
688 Ga0530510_0270826

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00081

Sod_Fe_N

Iron/manganese superoxide dismutases, alpha-hairpin domain

2

89

0.98

PF02777

Sod_Fe_C

Iron/manganese superoxide dismutases, C-terminal domain

96

195

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
6bej-assembly1.cif.gz_A crystal structure of manganese superoxide dismutase from xanthomonas citri 0.9677 3 200
2rcv-assembly4.cif.gz_F crystal structure of the bacillus subtilis superoxide dismutase 0.9665 3 198
1xuq-assembly1.cif.gz_B crystal structure of soda-1 (ba4499) from bacillus anthracis at 1.8a resolution. 0.9658 3 200
2rcv-assembly3.cif.gz_D crystal structure of the bacillus subtilis superoxide dismutase 0.9652 3 198
2rcv-assembly2.cif.gz_H crystal structure of the bacillus subtilis superoxide dismutase 0.9626 3 198
ID Description Score Start End Superfamily
3kkyB01 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Fe,Mn superoxide dismutase (SOD) domain 0.9941 20 89 1.10.287.990
2ce4B01 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Fe,Mn superoxide dismutase (SOD) domain 0.9929 20 89 1.10.287.990
2cdyC01 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Fe,Mn superoxide dismutase (SOD) domain 0.9917 20 89 1.10.287.990
2cdyD01 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Fe,Mn superoxide dismutase (SOD) domain 0.9891 20 89 1.10.287.990
2cdyB01 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Fe,Mn superoxide dismutase (SOD) domain 0.9886 20 89 1.10.287.990
ID Description Score Start End GO Terms
AF-A0A7V8XIS2-F1-model_v4 superoxide dismutase (EC 1.15.1.1) 1.004 1 89 GO:0004784
GO:0005737
GO:0046872
AF-A0A7W0ZGA3-F1-model_v4 superoxide dismutase (EC 1.15.1.1) 0.9936 1 102 GO:0004784
GO:0005737
GO:0046872
AF-A0A7V8XIS2-F1-model_v4 superoxide dismutase (EC 1.15.1.1) 0.9928 1 89 GO:0004784
GO:0005737
GO:0046872
AF-A0A356X3L0-F1-model_v4 superoxide dismutase (EC 1.15.1.1) 0.9921 1 107 GO:0004784
GO:0005737
GO:0046872
AF-A0A348NPZ5-F1-model_v4 superoxide dismutase (EC 1.15.1.1) 0.9913 1 116 GO:0004784
GO:0005737
GO:0046872

Map