F415841
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 344 | 236 | 289 | 251 |
Family's Representative Sequence
| Representative Sequence | 3300005338|Ga0068868_100063842|Ga0068868_1000638424 |
| Length | 283 |
| Sequence | MELHKCIGTDQRIKKLVFNGRWSMVKDNKQATMDNSFYYKFIEPDKSLADFVESLGMFHNPSDKAKEVVVLPDGRIDLFFLQSASTLFRVTLVGLETEPEQRSIEPHTLAFVISFKPLAVEYILHNPIAGLLNTAKDLQDNIWGFNADDLKDFDAFCKKASQKIKELLPGEIDERKRKLFRLIYSSNGEMSVKALSEKVFWSSRQINRYFNQQFGLSLKAYCNILRFRASLQHIAQGKLFPELNFTDQTHFIKEIKKFSGVVPKELSKNKNDRFVLLSVLKQK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2513020052 | Flavobacterium sp. CF136 | Isolate | Rhizosphere |
| 2 | 2582581278 | Chryseobacterium sp. CF365 | Isolate | Rhizosphere |
| 3 | 2585428045 | Chryseobacterium sp. OV705 | Isolate | Rhizosphere |
| 4 | 2585428060 | Chryseobacterium sp. OV715 | Isolate | Rhizosphere |
| 5 | 2585428095 | Chryseobacterium sp. YR005 | Isolate | Rhizosphere |
| 6 | 2585428182 | Chryseobacterium sp. YR477 | Isolate | Rhizosphere |
| 7 | 2585428183 | Chryseobacterium sp. YR485 | Isolate | Rhizosphere |
| 8 | 2585428184 | Chryseobacterium sp. YR480 | Isolate | Rhizosphere |
| 9 | 2585428185 | Chryseobacterium sp. YR459 | Isolate | Rhizosphere |
| 10 | 2588253712 | Chryseobacterium sp. OV279 | Isolate | Rhizosphere |
| 11 | 2588254255 | Chryseobacterium sp. YR221 | Isolate | Rhizosphere |
| 12 | 2588254257 | Chryseobacterium sp. YR203 | Isolate | Rhizosphere |
| 13 | 2599185184 | Mucilaginibacter sp. NFR10 | Isolate | Rhizoplane |
| 14 | 2643221600 | Flavobacterium sp. Root186 | Isolate | Unclassified |
| 15 | 2643221667 | Flavobacterium sp. Root420 | Isolate | Unclassified |
| 16 | 2721755487 | Sphingobacterium sp. B29 | Isolate | Rhizosphere |
| 17 | 2728369107 | Chryseobacterium kwangjuense KJ1R5 | Isolate | Unclassified |
| 18 | 2738541284 | Pedobacter sp. YR016 | Isolate | Unclassified |
| 19 | 2738541302 | Pedobacter sp. CF074 | Isolate | Unclassified |
| 20 | 2739367656 | Pedobacter sp. CF523 | Isolate | Unclassified |
| 21 | 2739367663 | Pedobacter sp. YR510 | Isolate | Unclassified |
| 22 | 2739367857 | Flavobacterium sp. GV029 | Isolate | Unclassified |
| 23 | 2739367858 | Flavobacterium sp. GV028 | Isolate | Unclassified |
| 24 | 2751185877 | Chryseobacterium artocarpi UTM-3 | Isolate | Rhizosphere |
| 25 | 2765235839 | Chryseobacterium indologenes AA5 | Isolate | Unclassified |
| 26 | 2772190705 | Chryseobacterium contaminans C-26 | Isolate | Rhizosphere |
| 27 | 2775506987 | Pedobacter ginsengisoli T01R-27 | Isolate | Unclassified |
| 28 | 2816332188 | Chryseobacterium aquifrigidense 110 (version 2) | Isolate | Unclassified |
| 29 | 2818991437 | Pedobacter terrae 518 | Isolate | Unclassified |
| 30 | 2818991460 | Chitinophaga polysaccharea 1209 | Isolate | Unclassified |
| 31 | 2842083920 | Chryseobacterium lathyri KCTC 22544 | Isolate | Rhizosphere |
| 32 | 2842903701 | Olivibacter sp. R-72191 | Isolate | Unclassified |
| 33 | 2852627209 | Pedobacter sp. AK017 | Isolate | Rhizosphere |
| 34 | 2857618242 | Flavobacterium sp. R-74482 | Isolate | Unclassified |
| 35 | 2857627736 | Pedobacter sp. R-74587 | Isolate | Unclassified |
| 36 | 2871720351 | Chryseobacterium sp. KLBC 52 | Isolate | Nodule |
| 37 | 2881247448 | Flavobacterium beibuense RSKm HC5 | Isolate | Rhizosphere |
| 38 | 2884791551 | Chitinophaga oryzae 1310 | Isolate | Unclassified |
| 39 | 2889290771 | Chryseobacterium sp. PvR013 | Isolate | Rhizosphere |
| 40 | 2890804823 | Fluviicola sp. SGL-29 | Isolate | Rhizosphere |
| 41 | 2905999023 | Chryseobacterium elymi KCTC 22547 | Isolate | Rhizosphere |
| 42 | 2919186247 | Pedobacter africanus 2697 | Isolate | Rhizosphere |
| 43 | 2919191525 | Flavobacterium sp. 2755 | Isolate | Rhizosphere |
| 44 | 2919399522 | Chryseobacterium sp. 2987 | Isolate | Unclassified |
| 45 | 2928078545 | Mucilaginibacter rubeus 1215 | Isolate | Unclassified |
| 46 | 2928147474 | Mucilaginibacter rubeus 2025 | Isolate | Unclassified |
| 47 | 2929150217 | Flavobacterium sp. R-74510 Hybrid assembly | Isolate | Unclassified |
| 48 | 2929154850 | Filimonas sp. R-72421 Hybrid assembly | Isolate | Unclassified |
| 49 | 2932082852 | Mucilaginibacter sp. 3215 | Isolate | Rhizosphere |
| 50 | 2939664404 | Pedobacter africanus 2990 | Isolate | Rhizosphere |
| 51 | 2946019816 | Chryseobacterium sp. W4I1 | Isolate | Rhizosphere |
| 52 | 2958512119 | Flavobacterium sp. Sd200 | Isolate | Rhizosphere |
| 53 | 2977243572 | Chryseobacterium sp. SORGH_AS 447 | Isolate | Unclassified |
| 54 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 55 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 56 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 57 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 58 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 59 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 60 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 61 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 62 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 63 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 64 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 65 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 66 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 67 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 72 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 73 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 74 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 82 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 83 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 84 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 85 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 86 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 87 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 88 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 89 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 90 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 91 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 92 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 93 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 94 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 95 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 96 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 97 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 98 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 99 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 100 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 101 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 103 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 105 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 127 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 130 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 132 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 133 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 134 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 135 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 136 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 137 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 173 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 174 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 175 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 176 | 3300030732 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 | Metagenome | Rhizosphere |
| 177 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 178 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 179 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 180 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 181 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 182 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 183 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 184 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 185 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 186 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 187 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 188 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 189 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 190 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 191 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 203 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 204 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 205 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 206 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 207 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 208 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 209 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 210 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 211 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 212 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 213 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 214 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 215 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 216 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 217 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 218 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 219 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 220 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 222 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 223 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 224 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 225 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 226 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 227 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 228 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 229 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 230 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 231 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 232 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 233 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 234 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 235 | 8054307821 | Flavobacterium soyae SCIV07 | Isolate | Rhizosphere |
| 236 | 8056440228 | Flavobacterium hibisci THG-HG1.4 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 83.72 |
| Metatranscriptomes | 0 |
| Isolates | 16.28 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 6.98 |
| Nodule | 0.58 |
| Rhizoplane | 2.33 |
| Rhizosphere | 70.64 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 19.48 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24741J21665_1009434 | 3300001915 | Bacteria | 1791 |
| 2 | JGI24740J21852_10021094 | 3300001979 | Bacteria | 2263 |
| 3 | JGI24739J22299_10022578 | 3300001989 | Bacteria | 2231 |
| 4 | JGI24739J22299_10027105 | 3300001989 | Bacteria | 2005 |
| 5 | JGI24737J22298_10000914 | 3300001990 | Bacteria | 10486 |
| 6 | JGI24737J22298_10001745 | 3300001990 | Bacteria | 7761 |
| 7 | JGI24735J21928_10000027 | 3300002067 | Bacteria | 83494 |
| 8 | rootH2_10038272 | 3300003320 | Bacteria | 20840 |
| 9 | rootH2_10059244 | 3300003320 | Bacteria | 7623 |
| 10 | rootH2_10302698 | 3300003320 | Bacteria | 2940 |
| 11 | rootL2_10044393 | 3300003322 | Bacteria | 18918 |
| 12 | rootL2_10100079 | 3300003322 | Bacteria | 5852 |
| 13 | rootL2_10224518 | 3300003322 | Bacteria | 1459 |
| 14 | rootH1_10006320 | 3300003316 | Bacteria | 10236 |
| 15 | rootH1_10006320 | 3300003323 | Bacteria | 2214 |
| 16 | rootH1_10052802 | 3300003323 | Bacteria | 3407 |
| 17 | rootH1_10054792 | 3300003323 | Bacteria | 4498 |
| 18 | Ga0055536_1000009 | 3300003781 | Bacteria | 311572 |
| 19 | Ga0055534_1005976 | 3300003784 | Bacteria | 3150 |
| 20 | Ga0055530_10006855 | 3300003791 | Bacteria | 4941 |
| 21 | Ga0065714_10002217 | 3300005288 | Bacteria | 49867 |
| 22 | Ga0065714_10007915 | 3300005288 | Bacteria | 3368 |
| 23 | Ga0065714_10068458 | 3300005288 | Bacteria | 4717 |
| 24 | Ga0065704_10075090 | 3300005289 | Bacteria | 5783 |
| 25 | Ga0070658_10003549 | 3300005327 | Bacteria | 12805 |
| 26 | Ga0070658_10126913 | 3300005327 | Bacteria | 2124 |
| 27 | Ga0070676_10030692 | 3300005328 | Bacteria | 3067 |
| 28 | Ga0070670_100412553 | 3300005331 | Bacteria | 1193 |
| 29 | Ga0070666_10001098 | 3300005335 | Bacteria | 16532 |
| 30 | Ga0070680_100744865 | 3300005336 | Bacteria | 844 |
| 31 | Ga0070682_100000063 | 3300005337 | Bacteria | 101553 |
| 32 | Ga0070682_100336312 | 3300005337 | Viruses | 1121 |
| 33 | Ga0068868_100009897 | 3300005338 | Bacteria | 6884 |
| 34 | Ga0068868_100024933 | 3300005338 | Bacteria | 4542 |
| 35 | Ga0068868_100063842 | 3300005338 | Bacteria | 2922 |
| 36 | Ga0068868_100781274 | 3300005338 | Bacteria | 860 |
| 37 | Ga0070660_100051607 | 3300005339 | Bacteria | 3168 |
| 38 | Ga0070661_100411741 | 3300005344 | Bacteria | 1070 |
| 39 | Ga0070668_100000970 | 3300005347 | Bacteria | 20082 |
| 40 | Ga0070668_100168569 | 3300005347 | Bacteria | 1781 |
| 41 | Ga0070674_100294477 | 3300005356 | Bacteria | 1291 |
| 42 | Ga0070673_100004445 | 3300005364 | Bacteria | 8867 |
| 43 | Ga0070673_100012685 | 3300005364 | Bacteria | 5796 |
| 44 | Ga0070667_100005087 | 3300005367 | Bacteria | 11007 |
| 45 | Ga0070667_100030727 | 3300005367 | Bacteria | 4479 |
| 46 | Ga0070667_100147105 | 3300005367 | Bacteria | 2067 |
| 47 | Ga0070678_100058790 | 3300005456 | Bacteria | 2823 |
| 48 | Ga0070662_100219107 | 3300005457 | Bacteria | 1518 |
| 49 | Ga0068867_100030436 | 3300005459 | Bacteria | 3894 |
| 50 | Ga0070685_10122242 | 3300005466 | Bacteria | 1618 |
| 51 | Ga0070679_100355893 | 3300005530 | Bacteria | 1411 |
| 52 | Ga0070679_100437757 | 3300005530 | Bacteria | 1252 |
| 53 | Ga0068853_100398339 | 3300005539 | Unclassified | 1288 |
| 54 | Ga0070672_100001914 | 3300005543 | Bacteria | 13057 |
| 55 | Ga0070672_100085789 | 3300005543 | Bacteria | 2531 |
| 56 | Ga0070672_100110312 | 3300005543 | Bacteria | 2242 |
| 57 | Ga0070665_100004105 | 3300005548 | Bacteria | 15317 |
| 58 | Ga0070665_100015766 | 3300005548 | Bacteria | 7591 |
| 59 | Ga0068855_100030654 | 3300005563 | Bacteria | 6430 |
| 60 | Ga0070664_100418943 | 3300005564 | Bacteria | 1226 |
| 61 | Ga0070664_100602762 | 3300005564 | Unclassified | 1019 |
| 62 | Ga0068857_100303972 | 3300005577 | Bacteria | 1471 |
| 63 | Ga0068852_100390845 | 3300005616 | Bacteria | 1366 |
| 64 | Ga0068859_100550450 | 3300005617 | Bacteria | 1248 |
| 65 | Ga0068864_100205780 | 3300005618 | Bacteria | 1810 |
| 66 | Ga0068866_10057723 | 3300005718 | Bacteria | 2001 |
| 67 | Ga0068861_100213142 | 3300005719 | Bacteria | 1628 |
| 68 | Ga0068851_10011294 | 3300005834 | Bacteria | 4186 |
| 69 | Ga0068870_10039746 | 3300005840 | Bacteria | 2435 |
| 70 | Ga0068870_10338051 | 3300005840 | Bacteria | 962 |
| 71 | Ga0068863_100059271 | 3300005841 | Bacteria | 3622 |
| 72 | Ga0068863_100305709 | 3300005841 | Bacteria | 1543 |
| 73 | Ga0068858_100009832 | 3300005842 | Bacteria | 9099 |
| 74 | Ga0068860_100002897 | 3300005843 | Bacteria | 17784 |
| 75 | Ga0068860_100017305 | 3300005843 | Bacteria | 7024 |
| 76 | Ga0097621_100005783 | 3300006237 | Bacteria | 8731 |
| 77 | Ga0097621_100040235 | 3300006237 | Bacteria | 3757 |
| 78 | Ga0068871_100028863 | 3300006358 | Bacteria | 4354 |
| 79 | Ga0068871_100084246 | 3300006358 | Bacteria | 2638 |
| 80 | Ga0097620_100550430 | 3300006931 | Bacteria | 1248 |
| 81 | Ga0079104_1041540 | 3300006946 | Bacteria | 1070 |
| 82 | Ga0105244_10000060 | 3300009036 | Bacteria | 127191 |
| 83 | Ga0105244_10047736 | 3300009036 | Bacteria | 2194 |
| 84 | Ga0105244_10060875 | 3300009036 | Bacteria | 1901 |
| 85 | Ga0105240_10249480 | 3300009093 | Bacteria | 2054 |
| 86 | Ga0105247_10043477 | 3300009101 | Bacteria | 2752 |
| 87 | Ga0105243_10000127 | 3300009148 | Bacteria | 86196 |
| 88 | Ga0105243_10000143 | 3300009148 | Bacteria | 81998 |
| 89 | Ga0105241_10638876 | 3300009174 | Bacteria | 965 |
| 90 | Ga0105242_10047949 | 3300009176 | Bacteria | 3470 |
| 91 | Ga0105242_10138021 | 3300009176 | Bacteria | 2113 |
| 92 | Ga0105237_10179963 | 3300009545 | Bacteria | 2115 |
| 93 | Ga0105237_10454470 | 3300009545 | Bacteria | 1287 |
| 94 | Ga0105237_10494032 | 3300009545 | Bacteria | 1230 |
| 95 | Ga0105238_10261725 | 3300009551 | Bacteria | 1709 |
| 96 | Ga0105249_10017061 | 3300009553 | Bacteria | 6444 |
| 97 | Ga0105249_10026844 | 3300009553 | Bacteria | 5192 |
| 98 | Ga0105239_10060063 | 3300010375 | Bacteria | 4172 |
| 99 | Ga0105239_10191006 | 3300010375 | Bacteria | 2292 |
| 100 | Ga0105239_10775624 | 3300010375 | Bacteria | 1098 |
| 101 | Ga0105246_10015847 | 3300011119 | Bacteria | 4767 |
| 102 | Ga0157373_10000009 | 3300013100 | Bacteria | 201551 |
| 103 | Ga0157371_10000009 | 3300013102 | Bacteria | 392895 |
| 104 | Ga0157371_10001037 | 3300013102 | Bacteria | 30465 |
| 105 | Ga0157371_10026484 | 3300013102 | Bacteria | 4214 |
| 106 | Ga0157371_10321049 | 3300013102 | Bacteria | 1124 |
| 107 | Ga0157370_10001185 | 3300013104 | Bacteria | 32500 |
| 108 | Ga0157370_10041557 | 3300013104 | Bacteria | 4434 |
| 109 | Ga0157370_10048981 | 3300013104 | Bacteria | 4046 |
| 110 | Ga0157370_10061372 | 3300013104 | Bacteria | 3568 |
| 111 | Ga0157370_10206023 | 3300013104 | Unclassified | 1824 |
| 112 | Ga0157370_10224378 | 3300013104 | Bacteria | 1740 |
| 113 | Ga0157370_10268487 | 3300013104 | Bacteria | 1576 |
| 114 | Ga0157370_10482766 | 3300013104 | Bacteria | 1139 |
| 115 | Ga0157369_10479768 | 3300013105 | Bacteria | 1287 |
| 116 | Ga0157374_10003576 | 3300013296 | Bacteria | 13085 |
| 117 | Ga0157374_10311602 | 3300013296 | Bacteria | 1558 |
| 118 | Ga0157378_10003862 | 3300013297 | Bacteria | 13256 |
| 119 | Ga0157378_10017059 | 3300013297 | Bacteria | 6365 |
| 120 | Ga0163162_10003581 | 3300013306 | Bacteria | 14861 |
| 121 | Ga0157372_10009473 | 3300013307 | Bacteria | 10357 |
| 122 | Ga0157372_10087293 | 3300013307 | Bacteria | 3539 |
| 123 | Ga0157375_10002956 | 3300013308 | Bacteria | 14749 |
| 124 | Ga0157375_10197043 | 3300013308 | Bacteria | 2169 |
| 125 | Ga0157375_10945244 | 3300013308 | Bacteria | 1004 |
| 126 | Ga0163163_10003557 | 3300014325 | Bacteria | 13229 |
| 127 | Ga0182008_10000001 | 3300014497 | Bacteria | 540790 |
| 128 | Ga0182008_10000028 | 3300014497 | Bacteria | 176968 |
| 129 | Ga0157379_10003531 | 3300014968 | Bacteria | 13241 |
| 130 | Ga0157379_10236939 | 3300014968 | Bacteria | 1655 |
| 131 | Ga0157376_10006779 | 3300014969 | Bacteria | 8108 |
| 132 | Ga0157376_10893904 | 3300014969 | Bacteria | 906 |
| 133 | Ga0182006_1000344 | 3300015261 | Bacteria | 39571 |
| 134 | Ga0182006_1013870 | 3300015261 | Unclassified | 3485 |
| 135 | Ga0163161_10000097 | 3300017792 | Bacteria | 84842 |
| 136 | Ga0163161_10003013 | 3300017792 | Bacteria | 11904 |
| 137 | Ga0163161_10025892 | 3300017792 | Bacteria | 4153 |
| 138 | Ga0163161_10058729 | 3300017792 | Bacteria | 2796 |
| 139 | Ga0163161_10062178 | 3300017792 | Bacteria | 2719 |
| 140 | Ga0209436_102794 | 3300025208 | Bacteria | 4972 |
| 141 | Ga0209130_1001745 | 3300025284 | Bacteria | 12947 |
| 142 | Ga0209675_1000056 | 3300025291 | Bacteria | 187664 |
| 143 | Ga0209676_1000001 | 3300025292 | Bacteria | 1852142 |
| 144 | Ga0209050_1000018 | 3300025298 | Bacteria | 723263 |
| 145 | Ga0207426_1000310 | 3300025302 | Bacteria | 96036 |
| 146 | Ga0207656_10006839 | 3300025321 | Bacteria | 4127 |
| 147 | Ga0207655_1000259 | 3300025728 | Bacteria | 83295 |
| 148 | Ga0207655_1061070 | 3300025728 | Bacteria | 1457 |
| 149 | Ga0207682_10020312 | 3300025893 | Unclassified | 2607 |
| 150 | Ga0207680_10038084 | 3300025903 | Bacteria | 2781 |
| 151 | Ga0207680_10101445 | 3300025903 | Unclassified | 1850 |
| 152 | Ga0207645_10001839 | 3300025907 | Bacteria | 17100 |
| 153 | Ga0207645_10058546 | 3300025907 | Bacteria | 2460 |
| 154 | Ga0207643_10002794 | 3300025908 | Bacteria | 9424 |
| 155 | Ga0207643_10320836 | 3300025908 | Bacteria | 967 |
| 156 | Ga0207705_10003033 | 3300025909 | Bacteria | 12807 |
| 157 | Ga0207705_10490680 | 3300025909 | Bacteria | 954 |
| 158 | Ga0207654_10430683 | 3300025911 | Bacteria | 922 |
| 159 | Ga0207671_10408236 | 3300025914 | Bacteria | 1080 |
| 160 | Ga0207650_10347323 | 3300025925 | Bacteria | 1220 |
| 161 | Ga0207659_10032948 | 3300025926 | Bacteria | 3561 |
| 162 | Ga0207706_10253836 | 3300025933 | Bacteria | 1536 |
| 163 | Ga0207686_10042918 | 3300025934 | Bacteria | 2768 |
| 164 | Ga0207686_10165486 | 3300025934 | Bacteria | 1554 |
| 165 | Ga0207686_10191331 | 3300025934 | Bacteria | 1459 |
| 166 | Ga0207686_10235486 | 3300025934 | Bacteria | 1330 |
| 167 | Ga0207709_10000176 | 3300025935 | Bacteria | 86175 |
| 168 | Ga0207709_10000184 | 3300025935 | Bacteria | 83205 |
| 169 | Ga0207709_10229294 | 3300025935 | Bacteria | 1344 |
| 170 | Ga0207704_10032399 | 3300025938 | Bacteria | 2957 |
| 171 | Ga0207691_10001432 | 3300025940 | Bacteria | 23824 |
| 172 | Ga0207691_10016276 | 3300025940 | Bacteria | 7060 |
| 173 | Ga0207691_10047317 | 3300025940 | Bacteria | 3947 |
| 174 | Ga0207689_10003000 | 3300025942 | Bacteria | 15566 |
| 175 | Ga0207679_10355543 | 3300025945 | Bacteria | 1278 |
| 176 | Ga0207667_10042039 | 3300025949 | Bacteria | 4861 |
| 177 | Ga0207667_10124147 | 3300025949 | Bacteria | 2660 |
| 178 | Ga0207651_10001070 | 3300025960 | Bacteria | 12162 |
| 179 | Ga0207651_10007738 | 3300025960 | Bacteria | 5743 |
| 180 | Ga0207712_10011135 | 3300025961 | Bacteria | 5725 |
| 181 | Ga0207712_10048394 | 3300025961 | Bacteria | 2957 |
| 182 | Ga0207668_10000554 | 3300025972 | Bacteria | 23448 |
| 183 | Ga0207640_10087477 | 3300025981 | Bacteria | 2148 |
| 184 | Ga0207658_10001247 | 3300025986 | Bacteria | 20115 |
| 185 | Ga0207658_10204625 | 3300025986 | Bacteria | 1650 |
| 186 | Ga0207677_10004844 | 3300026023 | Bacteria | 7263 |
| 187 | Ga0207703_10002419 | 3300026035 | Bacteria | 16208 |
| 188 | Ga0207641_10001203 | 3300026088 | Bacteria | 25928 |
| 189 | Ga0207641_10173144 | 3300026088 | Bacteria | 1972 |
| 190 | Ga0207648_10001374 | 3300026089 | Bacteria | 26793 |
| 191 | Ga0207648_10027548 | 3300026089 | Bacteria | 5045 |
| 192 | Ga0207648_10129350 | 3300026089 | Bacteria | 2222 |
| 193 | Ga0207676_10104464 | 3300026095 | Unclassified | 2356 |
| 194 | Ga0207674_10076743 | 3300026116 | Bacteria | 3349 |
| 195 | Ga0207675_100256082 | 3300026118 | Bacteria | 1695 |
| 196 | Ga0207683_10008813 | 3300026121 | Bacteria | 8608 |
| 197 | Ga0207683_10113610 | 3300026121 | Bacteria | 2426 |
| 198 | Ga0207698_10258587 | 3300026142 | Bacteria | 1598 |
| 199 | Ga0207698_10352345 | 3300026142 | Bacteria | 1391 |
| 200 | Ga0268266_10004266 | 3300028379 | Bacteria | 13756 |
| 201 | Ga0268266_10433398 | 3300028379 | Bacteria | 1247 |
| 202 | Ga0268264_10014190 | 3300028381 | Bacteria | 6550 |
| 203 | Ga0268264_10236038 | 3300028381 | Unclassified | 1691 |
| 204 | Ga0268264_10860907 | 3300028381 | Bacteria | 908 |
| 205 | Ga0265334_10023257 | 3300028573 | Bacteria | 2521 |
| 206 | Ga0307517_10009157 | 3300028786 | Bacteria | 14091 |
| 207 | Ga0307515_10000001 | 3300028794 | Bacteria | 4259510 |
| 208 | Ga0307515_10000003 | 3300028794 | Bacteria | 891317 |
| 209 | Ga0307515_10000299 | 3300028794 | Bacteria | 122087 |
| 210 | Ga0307515_10435553 | 3300028794 | Bacteria | 929 |
| 211 | Ga0307511_10000002 | 3300030521 | Bacteria | 199923 |
| 212 | Ga0316176_1002742 | 3300030732 | Bacteria | 81202 |
| 213 | Ga0316183_1188392 | 3300030742 | Bacteria | 20529 |
| 214 | Ga0316181_1284540 | 3300030744 | Bacteria | 22346 |
| 215 | Ga0265327_10012590 | 3300031251 | Bacteria | 5693 |
| 216 | Ga0265327_10061433 | 3300031251 | Bacteria | 1917 |
| 217 | Ga0307513_10131129 | 3300031456 | Bacteria | 2452 |
| 218 | Ga0307514_10130971 | 3300031649 | Bacteria | 1727 |
| 219 | Ga0307516_10000648 | 3300031730 | Bacteria | 47083 |
| 220 | Ga0307412_10000028 | 3300031911 | Bacteria | 213966 |
| 221 | Ga0307416_100000033 | 3300032002 | Bacteria | 156736 |
| 222 | Ga0307414_10014303 | 3300032004 | Bacteria | 4753 |
| 223 | Ga0307414_10044586 | 3300032004 | Bacteria | 3030 |
| 224 | Ga0307414_10290781 | 3300032004 | Bacteria | 1377 |
| 225 | Ga0307510_10285212 | 3300033180 | Bacteria | 1120 |
| 226 | Ga0439447_007797 | 3300041407 | Bacteria | 3362 |
| 227 | Ga0439466_0001856 | 3300041411 | Bacteria | 8281 |
| 228 | Ga0451841_0689466 | 3300041498 | Bacteria | 1426 |
| 229 | Ga0439455_0018126 | 3300042012 | Bacteria | 1649 |
| 230 | Ga0495585_0141706 | 3300046492 | Bacteria | 1259 |
| 231 | Ga0495596_0001481 | 3300046500 | Bacteria | 13424 |
| 232 | Ga0495606_0041527 | 3300046507 | Bacteria | 3084 |
| 233 | Ga0495606_0277141 | 3300046507 | Bacteria | 918 |
| 234 | Ga0495610_0000001 | 3300046512 | Bacteria | 1620061 |
| 235 | Ga0495630_0155963 | 3300046517 | Bacteria | 1738 |
| 236 | Ga0495663_0000224 | 3300046525 | Bacteria | 22602 |
| 237 | Ga0495652_0154564 | 3300046529 | Bacteria | 1788 |
| 238 | Ga0495609_0000025 | 3300046538 | Bacteria | 256898 |
| 239 | Ga0495633_0000333 | 3300046558 | Bacteria | 53039 |
| 240 | Ga0495668_0000154 | 3300046616 | Bacteria | 104449 |
| 241 | Ga0495668_0001543 | 3300046616 | Bacteria | 21852 |
| 242 | Ga0495625_0071930 | 3300046660 | Bacteria | 2426 |
| 243 | Ga0496102_0084767 | 3300048905 | Bacteria | 2925 |
| 244 | Ga0496103_0019856 | 3300048906 | Bacteria | 4035 |
| 245 | Ga0496104_0187945 | 3300048907 | Bacteria | 1977 |
| 246 | Ga0496105_0339895 | 3300048908 | Bacteria | 1200 |
| 247 | Ga0496108_0265749 | 3300048911 | Bacteria | 1493 |
| 248 | Ga0496113_0080925 | 3300048916 | Bacteria | 2489 |
| 249 | Ga0496114_0001472 | 3300048917 | Bacteria | 17864 |
| 250 | Ga0496116_0000012 | 3300048919 | Bacteria | 611365 |
| 251 | Ga0496116_0000032 | 3300048919 | Bacteria | 419997 |
| 252 | Ga0496116_0004879 | 3300048919 | Bacteria | 12652 |
| 253 | Ga0496117_0000139 | 3300048920 | Bacteria | 158612 |
| 254 | Ga0496117_0000897 | 3300048920 | Bacteria | 45839 |
| 255 | Ga0496118_0000129 | 3300048921 | Bacteria | 134056 |
| 256 | Ga0496118_0107312 | 3300048921 | Bacteria | 1865 |
| 257 | Ga0496119_0000002 | 3300048922 | Bacteria | 738385 |
| 258 | Ga0496120_0059682 | 3300048923 | Bacteria | 2137 |
| 259 | Ga0496121_0000008 | 3300048924 | Bacteria | 843593 |
| 260 | Ga0496122_0000090 | 3300048925 | Bacteria | 205886 |
| 261 | Ga0496122_0000207 | 3300048925 | Bacteria | 131493 |
| 262 | Ga0496122_0000294 | 3300048925 | Bacteria | 110530 |
| 263 | Ga0496122_0006679 | 3300048925 | Bacteria | 13139 |
| 264 | Ga0496122_0033010 | 3300048925 | Bacteria | 4265 |
| 265 | Ga0496123_0000496 | 3300048926 | Bacteria | 68245 |
| 266 | Ga0496123_0001908 | 3300048926 | Bacteria | 27193 |
| 267 | Ga0496124_0024657 | 3300048927 | Bacteria | 5463 |
| 268 | Ga0496124_0068579 | 3300048927 | Bacteria | 2947 |
| 269 | Ga0496125_0000208 | 3300048928 | Bacteria | 122812 |
| 270 | Ga0496125_0016515 | 3300048928 | Bacteria | 7084 |
| 271 | Ga0496126_0001670 | 3300048929 | Bacteria | 33301 |
| 272 | Ga0496126_0139389 | 3300048929 | Bacteria | 2089 |
| 273 | Ga0495678_007880 | 3300049459 | Bacteria | 5471 |
| 274 | Ga0501249_000001 | 3300049679 | Bacteria | 268580 |
| 275 | nmdc:mga0k408_139768_c1 | 3300050493 | Bacteria | 1440 |
| 276 | nmdc:mga0k408_27660_c1 | 3300050493 | Bacteria | 3222 |
| 277 | Ga0500578_0000303 | 3300053086 | Bacteria | 60307 |
| 278 | Ga0500646_0004705 | 3300053090 | Bacteria | 3451 |
| 279 | Ga0500647_0049839 | 3300053091 | Bacteria | 2014 |
| 280 | Ga0500583_0001109 | 3300053092 | Bacteria | 7670 |
| 281 | Ga0500641_0000018 | 3300053096 | Bacteria | 132142 |
| 282 | Ga0500641_0001847 | 3300053096 | Bacteria | 7513 |
| 283 | Ga0500652_038888 | 3300053131 | Bacteria | 1905 |
| 284 | Ga0500655_003686 | 3300053133 | Bacteria | 2760 |
| 285 | Ga0500658_0000004 | 3300053134 | Bacteria | 457801 |
| 286 | Ga0500573_0161833 | 3300053140 | Bacteria | 1218 |
| 287 | Ga0500588_0124679 | 3300053146 | Bacteria | 912 |
| 288 | Ga0500616_0155405 | 3300053153 | Bacteria | 1054 |
| 289 | Ga0500622_0116372 | 3300053156 | Bacteria | 1301 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300031251 | Ga0265327_10061433 | Ga0265327_100614331 | 238 |
| 2 | 3300046512 | Ga0495610_0000001 | Ga0495610_0000001_1005970_1006728 | 240 |
| 3 | 3300003320 | rootH2_10038272 | rootH2_1003827219 | 241 |
| 4 | 3300005337 | Ga0070682_100336312 | Ga0070682_1003363121 | 241 |
| 5 | 3300025914 | Ga0207671_10408236 | Ga0207671_104082361 | 241 |
| 6 | iso_pu_bacteria | 2818991460 | 2819682089 | 241 |
| 7 | iso_pu_bacteria | 2884791551 | 2884792799 | 243 |
| 8 | 3300003323 | rootH1_10054792 | rootH1_100547923 | 245 |
| 9 | iso_pu_bacteria | 2643221600 | 2644013007 | 245 |
| 10 | iso_pu_bacteria | 2738541302 | 2738855210 | 245 |
| 11 | iso_pu_bacteria | 2739367656 | 2739615608 | 245 |
| 12 | iso_pu_bacteria | 2818991437 | 2819548843 | 245 |
| 13 | iso_pu_bacteria | 2857627736 | 2857630760 | 245 |
| 14 | iso_pu_bacteria | 2919191525 | 2919195248 | 245 |
| 15 | iso_pu_bacteria | 2977243572 | 2977246418 | 245 |
| 16 | iso_pu_bacteria | 8054307821 | 8054310017 | 245 |
| 17 | 3300017792 | Ga0163161_10058729 | Ga0163161_100587292 | 246 |
| 18 | 3300025208 | Ga0209436_102794 | Ga0209436_1027942 | 246 |
| 19 | 3300025284 | Ga0209130_1001745 | Ga0209130_10017458 | 246 |
| 20 | 3300025302 | Ga0207426_1000310 | Ga0207426_100031050 | 246 |
| 21 | 3300053086 | Ga0500578_0000303 | Ga0500578_0000303_16549_17292 | 247 |
| 22 | iso_pu_bacteria | 2513020052 | 2513234891 | 247 |
| 23 | iso_pu_bacteria | 2585428095 | 2587865592 | 247 |
| 24 | iso_pu_bacteria | 2585428182 | 2588208645 | 247 |
| 25 | iso_pu_bacteria | 2585428183 | 2588212845 | 247 |
| 26 | iso_pu_bacteria | 2585428184 | 2588219396 | 247 |
| 27 | iso_pu_bacteria | 2588253712 | 2588445990 | 247 |
| 28 | iso_pu_bacteria | 2588254257 | 2590614111 | 247 |
| 29 | iso_pu_bacteria | 2599185184 | 2599481750 | 247 |
| 30 | iso_pu_bacteria | 2643221667 | 2644370316 | 247 |
| 31 | iso_pu_bacteria | 2721755487 | 2722727941 | 247 |
| 32 | iso_pu_bacteria | 2728369107 | 2729201806 | 247 |
| 33 | iso_pu_bacteria | 2739367857 | 2740003255 | 247 |
| 34 | iso_pu_bacteria | 2739367858 | 2740008072 | 247 |
| 35 | iso_pu_bacteria | 2751185877 | 2753672234 | 247 |
| 36 | iso_pu_bacteria | 2765235839 | 2765572229 | 247 |
| 37 | iso_pu_bacteria | 2772190705 | 2772604258 | 247 |
| 38 | iso_pu_bacteria | 2775506987 | 2776615857 | 247 |
| 39 | iso_pu_bacteria | 2816332188 | 2816872430 | 247 |
| 40 | iso_pu_bacteria | 2842083920 | 2842087637 | 247 |
| 41 | iso_pu_bacteria | 2842903701 | 2842909415 | 247 |
| 42 | iso_pu_bacteria | 2852627209 | 2852629919 | 247 |
| 43 | iso_pu_bacteria | 2857618242 | 2857619541 | 247 |
| 44 | iso_pu_bacteria | 2871720351 | 2871721385 | 247 |
| 45 | iso_pu_bacteria | 2881247448 | 2881250827 | 247 |
| 46 | iso_pu_bacteria | 2889290771 | 2889292137 | 247 |
| 47 | iso_pu_bacteria | 2890804823 | 2890807273 | 247 |
| 48 | iso_pu_bacteria | 2905999023 | 2906002711 | 247 |
| 49 | iso_pu_bacteria | 2919186247 | 2919187178 | 247 |
| 50 | iso_pu_bacteria | 2919399522 | 2919404127 | 247 |
| 51 | iso_pu_bacteria | 2928078545 | 2928082023 | 247 |
| 52 | iso_pu_bacteria | 2928147474 | 2928152043 | 247 |
| 53 | iso_pu_bacteria | 2929150217 | 2929152584 | 247 |
| 54 | iso_pu_bacteria | 2929154850 | 2929155462 | 247 |
| 55 | iso_pu_bacteria | 2932082852 | 2932088078 | 247 |
| 56 | iso_pu_bacteria | 2939664404 | 2939665554 | 247 |
| 57 | iso_pu_bacteria | 2946019816 | 2946020930 | 247 |
| 58 | iso_pu_bacteria | 2958512119 | 2958512681 | 247 |
| 59 | iso_pu_bacteria | 8056440228 | 8056442438 | 247 |
| 60 | iso_pu_bacteria | 2738541284 | 2738761164 | 248 |
| 61 | 3300001979 | JGI24740J21852_10021094 | JGI24740J21852_100210943 | 249 |
| 62 | 3300003322 | rootL2_10044393 | rootL2_100443937 | 249 |
| 63 | 3300003322 | rootL2_10100079 | rootL2_101000794 | 249 |
| 64 | 3300005288 | Ga0065714_10002217 | Ga0065714_1000221730 | 249 |
| 65 | 3300005338 | Ga0068868_100009897 | Ga0068868_1000098976 | 249 |
| 66 | 3300005338 | Ga0068868_100781274 | Ga0068868_1007812741 | 249 |
| 67 | 3300005344 | Ga0070661_100411741 | Ga0070661_1004117412 | 249 |
| 68 | 3300005347 | Ga0070668_100168569 | Ga0070668_1001685691 | 249 |
| 69 | 3300005356 | Ga0070674_100294477 | Ga0070674_1002944772 | 249 |
| 70 | 3300005364 | Ga0070673_100004445 | Ga0070673_1000044457 | 249 |
| 71 | 3300005367 | Ga0070667_100030727 | Ga0070667_1000307275 | 249 |
| 72 | 3300005466 | Ga0070685_10122242 | Ga0070685_101222422 | 249 |
| 73 | 3300005539 | Ga0068853_100398339 | Ga0068853_1003983392 | 249 |
| 74 | 3300005543 | Ga0070672_100110312 | Ga0070672_1001103122 | 249 |
| 75 | 3300005548 | Ga0070665_100015766 | Ga0070665_1000157662 | 249 |
| 76 | 3300005564 | Ga0070664_100602762 | Ga0070664_1006027622 | 249 |
| 77 | 3300005718 | Ga0068866_10057723 | Ga0068866_100577232 | 249 |
| 78 | 3300005719 | Ga0068861_100213142 | Ga0068861_1002131421 | 249 |
| 79 | 3300005841 | Ga0068863_100305709 | Ga0068863_1003057091 | 249 |
| 80 | 3300005843 | Ga0068860_100017305 | Ga0068860_1000173057 | 249 |
| 81 | 3300006237 | Ga0097621_100040235 | Ga0097621_1000402352 | 249 |
| 82 | 3300006358 | Ga0068871_100028863 | Ga0068871_1000288632 | 249 |
| 83 | 3300009036 | Ga0105244_10060875 | Ga0105244_100608753 | 249 |
| 84 | 3300009174 | Ga0105241_10638876 | Ga0105241_106388761 | 249 |
| 85 | 3300009176 | Ga0105242_10138021 | Ga0105242_101380212 | 249 |
| 86 | 3300009545 | Ga0105237_10494032 | Ga0105237_104940323 | 249 |
| 87 | 3300013100 | Ga0157373_10000009 | Ga0157373_10000009105 | 249 |
| 88 | 3300013102 | Ga0157371_10000009 | Ga0157371_10000009162 | 249 |
| 89 | 3300013104 | Ga0157370_10001185 | Ga0157370_100011854 | 249 |
| 90 | 3300013104 | Ga0157370_10048981 | Ga0157370_100489811 | 249 |
| 91 | 3300013296 | Ga0157374_10311602 | Ga0157374_103116022 | 249 |
| 92 | 3300013297 | Ga0157378_10017059 | Ga0157378_100170595 | 249 |
| 93 | 3300013308 | Ga0157375_10197043 | Ga0157375_101970432 | 249 |
| 94 | 3300014497 | Ga0182008_10000028 | Ga0182008_1000002892 | 249 |
| 95 | 3300014968 | Ga0157379_10236939 | Ga0157379_102369391 | 249 |
| 96 | 3300014969 | Ga0157376_10893904 | Ga0157376_108939042 | 249 |
| 97 | 3300025728 | Ga0207655_1061070 | Ga0207655_10610703 | 249 |
| 98 | 3300025893 | Ga0207682_10020312 | Ga0207682_100203122 | 249 |
| 99 | 3300025903 | Ga0207680_10101445 | Ga0207680_101014452 | 249 |
| 100 | 3300025907 | Ga0207645_10001839 | Ga0207645_100018398 | 249 |
| 101 | 3300025911 | Ga0207654_10430683 | Ga0207654_104306831 | 249 |
| 102 | 3300025926 | Ga0207659_10032948 | Ga0207659_100329484 | 249 |
| 103 | 3300025934 | Ga0207686_10165486 | Ga0207686_101654862 | 249 |
| 104 | 3300025934 | Ga0207686_10235486 | Ga0207686_102354862 | 249 |
| 105 | 3300025938 | Ga0207704_10032399 | Ga0207704_100323992 | 249 |
| 106 | 3300025940 | Ga0207691_10016276 | Ga0207691_100162767 | 249 |
| 107 | 3300025949 | Ga0207667_10124147 | Ga0207667_101241472 | 249 |
| 108 | 3300025960 | Ga0207651_10007738 | Ga0207651_100077385 | 249 |
| 109 | 3300025981 | Ga0207640_10087477 | Ga0207640_100874772 | 249 |
| 110 | 3300026088 | Ga0207641_10173144 | Ga0207641_101731443 | 249 |
| 111 | 3300026089 | Ga0207648_10001374 | Ga0207648_1000137421 | 249 |
| 112 | 3300026089 | Ga0207648_10129350 | Ga0207648_101293502 | 249 |
| 113 | 3300026118 | Ga0207675_100256082 | Ga0207675_1002560821 | 249 |
| 114 | 3300026121 | Ga0207683_10008813 | Ga0207683_100088138 | 249 |
| 115 | 3300028379 | Ga0268266_10433398 | Ga0268266_104333982 | 249 |
| 116 | 3300028381 | Ga0268264_10236038 | Ga0268264_102360382 | 249 |
| 117 | 3300028381 | Ga0268264_10860907 | Ga0268264_108609071 | 249 |
| 118 | 3300028794 | Ga0307515_10000003 | Ga0307515_10000003261 | 249 |
| 119 | 3300031456 | Ga0307513_10131129 | Ga0307513_101311292 | 249 |
| 120 | 3300031649 | Ga0307514_10130971 | Ga0307514_101309712 | 249 |
| 121 | 3300046517 | Ga0495630_0155963 | Ga0495630_0155963_326_1081 | 249 |
| 122 | 3300046525 | Ga0495663_0000224 | Ga0495663_0000224_10402_11151 | 249 |
| 123 | 3300046538 | Ga0495609_0000025 | Ga0495609_0000025_227355_228104 | 249 |
| 124 | 3300046558 | Ga0495633_0000333 | Ga0495633_0000333_8097_8846 | 249 |
| 125 | 3300046616 | Ga0495668_0001543 | Ga0495668_0001543_5843_6592 | 249 |
| 126 | 3300048919 | Ga0496116_0000032 | Ga0496116_0000032_90847_91602 | 249 |
| 127 | 3300048921 | Ga0496118_0107312 | Ga0496118_0107312_741_1496 | 249 |
| 128 | 3300053133 | Ga0500655_003686 | Ga0500655_003686_1193_1945 | 249 |
| 129 | 3300053146 | Ga0500588_0124679 | Ga0500588_0124679_42_791 | 249 |
| 130 | 3300053153 | Ga0500616_0155405 | Ga0500616_0155405_59_823 | 249 |
| 131 | 3300003320 | rootH2_10059244 | rootH2_100592445 | 250 |
| 132 | 3300009036 | Ga0105244_10047736 | Ga0105244_100477361 | 250 |
| 133 | 3300026142 | Ga0207698_10258587 | Ga0207698_102585872 | 250 |
| 134 | 3300041407 | Ga0439447_007797 | Ga0439447_007797_2559_3311 | 250 |
| 135 | 3300041411 | Ga0439466_0001856 | Ga0439466_0001856_2424_3176 | 250 |
| 136 | 3300048924 | Ga0496121_0000008 | Ga0496121_0000008_338276_339097 | 250 |
| 137 | 3300053134 | Ga0500658_0000004 | Ga0500658_0000004_14167_14919 | 250 |
| 138 | 3300053140 | Ga0500573_0161833 | Ga0500573_0161833_170_922 | 250 |
| 139 | 3300001915 | JGI24741J21665_1009434 | JGI24741J21665_10094343 | 251 |
| 140 | 3300001989 | JGI24739J22299_10022578 | JGI24739J22299_100225781 | 251 |
| 141 | 3300001989 | JGI24739J22299_10027105 | JGI24739J22299_100271052 | 251 |
| 142 | 3300001990 | JGI24737J22298_10000914 | JGI24737J22298_100009142 | 251 |
| 143 | 3300001990 | JGI24737J22298_10001745 | JGI24737J22298_100017455 | 251 |
| 144 | 3300002067 | JGI24735J21928_10000027 | JGI24735J21928_1000002735 | 251 |
| 145 | 3300003320 | rootH2_10302698 | rootH2_103026982 | 251 |
| 146 | 3300003322 | rootL2_10224518 | rootL2_102245182 | 251 |
| 147 | 3300003323 | rootH1_10006320 | rootH1_100063201 | 251 |
| 148 | 3300003323 | rootH1_10052802 | rootH1_100528022 | 251 |
| 149 | 3300003781 | Ga0055536_1000009 | Ga0055536_10000093 | 251 |
| 150 | 3300003784 | Ga0055534_1005976 | Ga0055534_10059762 | 251 |
| 151 | 3300003791 | Ga0055530_10006855 | Ga0055530_100068553 | 251 |
| 152 | 3300005288 | Ga0065714_10007915 | Ga0065714_100079152 | 251 |
| 153 | 3300005288 | Ga0065714_10068458 | Ga0065714_100684583 | 251 |
| 154 | 3300005289 | Ga0065704_10075090 | Ga0065704_100750906 | 251 |
| 155 | 3300005327 | Ga0070658_10003549 | Ga0070658_100035499 | 251 |
| 156 | 3300005327 | Ga0070658_10126913 | Ga0070658_101269131 | 251 |
| 157 | 3300005328 | Ga0070676_10030692 | Ga0070676_100306922 | 251 |
| 158 | 3300005331 | Ga0070670_100412553 | Ga0070670_1004125531 | 251 |
| 159 | 3300005335 | Ga0070666_10001098 | Ga0070666_100010986 | 251 |
| 160 | 3300005336 | Ga0070680_100744865 | Ga0070680_1007448651 | 251 |
| 161 | 3300005337 | Ga0070682_100000063 | Ga0070682_10000006375 | 251 |
| 162 | 3300005338 | Ga0068868_100024933 | Ga0068868_1000249335 | 251 |
| 163 | 3300005338 | Ga0068868_100063842 | Ga0068868_1000638424 | 251 |
| 164 | 3300005339 | Ga0070660_100051607 | Ga0070660_1000516073 | 251 |
| 165 | 3300005347 | Ga0070668_100000970 | Ga0070668_1000009705 | 251 |
| 166 | 3300005364 | Ga0070673_100012685 | Ga0070673_1000126852 | 251 |
| 167 | 3300005367 | Ga0070667_100005087 | Ga0070667_1000050872 | 251 |
| 168 | 3300005367 | Ga0070667_100147105 | Ga0070667_1001471051 | 251 |
| 169 | 3300005456 | Ga0070678_100058790 | Ga0070678_1000587902 | 251 |
| 170 | 3300005457 | Ga0070662_100219107 | Ga0070662_1002191072 | 251 |
| 171 | 3300005459 | Ga0068867_100030436 | Ga0068867_1000304362 | 251 |
| 172 | 3300005530 | Ga0070679_100355893 | Ga0070679_1003558932 | 251 |
| 173 | 3300005530 | Ga0070679_100437757 | Ga0070679_1004377571 | 251 |
| 174 | 3300005543 | Ga0070672_100001914 | Ga0070672_10000191413 | 251 |
| 175 | 3300005543 | Ga0070672_100085789 | Ga0070672_1000857893 | 251 |
| 176 | 3300005548 | Ga0070665_100004105 | Ga0070665_1000041059 | 251 |
| 177 | 3300005563 | Ga0068855_100030654 | Ga0068855_1000306542 | 251 |
| 178 | 3300005564 | Ga0070664_100418943 | Ga0070664_1004189432 | 251 |
| 179 | 3300005577 | Ga0068857_100303972 | Ga0068857_1003039721 | 251 |
| 180 | 3300005616 | Ga0068852_100390845 | Ga0068852_1003908452 | 251 |
| 181 | 3300005617 | Ga0068859_100550450 | Ga0068859_1005504502 | 251 |
| 182 | 3300005618 | Ga0068864_100205780 | Ga0068864_1002057802 | 251 |
| 183 | 3300005834 | Ga0068851_10011294 | Ga0068851_100112943 | 251 |
| 184 | 3300005840 | Ga0068870_10039746 | Ga0068870_100397462 | 251 |
| 185 | 3300005840 | Ga0068870_10338051 | Ga0068870_103380511 | 251 |
| 186 | 3300005841 | Ga0068863_100059271 | Ga0068863_1000592713 | 251 |
| 187 | 3300005842 | Ga0068858_100009832 | Ga0068858_1000098329 | 251 |
| 188 | 3300005843 | Ga0068860_100002897 | Ga0068860_1000028975 | 251 |
| 189 | 3300006237 | Ga0097621_100005783 | Ga0097621_1000057835 | 251 |
| 190 | 3300006358 | Ga0068871_100084246 | Ga0068871_1000842462 | 251 |
| 191 | 3300006931 | Ga0097620_100550430 | Ga0097620_1005504302 | 251 |
| 192 | 3300006946 | Ga0079104_1041540 | Ga0079104_10415402 | 251 |
| 193 | 3300009036 | Ga0105244_10000060 | Ga0105244_1000006076 | 251 |
| 194 | 3300009093 | Ga0105240_10249480 | Ga0105240_102494802 | 251 |
| 195 | 3300009101 | Ga0105247_10043477 | Ga0105247_100434772 | 251 |
| 196 | 3300009148 | Ga0105243_10000127 | Ga0105243_100001274 | 251 |
| 197 | 3300009148 | Ga0105243_10000143 | Ga0105243_100001435 | 251 |
| 198 | 3300009176 | Ga0105242_10047949 | Ga0105242_100479492 | 251 |
| 199 | 3300009545 | Ga0105237_10179963 | Ga0105237_101799632 | 251 |
| 200 | 3300009545 | Ga0105237_10454470 | Ga0105237_104544701 | 251 |
| 201 | 3300009551 | Ga0105238_10261725 | Ga0105238_102617252 | 251 |
| 202 | 3300009553 | Ga0105249_10017061 | Ga0105249_100170616 | 251 |
| 203 | 3300009553 | Ga0105249_10026844 | Ga0105249_100268442 | 251 |
| 204 | 3300010375 | Ga0105239_10060063 | Ga0105239_100600634 | 251 |
| 205 | 3300010375 | Ga0105239_10191006 | Ga0105239_101910062 | 251 |
| 206 | 3300010375 | Ga0105239_10775624 | Ga0105239_107756242 | 251 |
| 207 | 3300011119 | Ga0105246_10015847 | Ga0105246_100158474 | 251 |
| 208 | 3300013102 | Ga0157371_10001037 | Ga0157371_100010377 | 251 |
| 209 | 3300013102 | Ga0157371_10026484 | Ga0157371_100264842 | 251 |
| 210 | 3300013102 | Ga0157371_10321049 | Ga0157371_103210491 | 251 |
| 211 | 3300013104 | Ga0157370_10041557 | Ga0157370_100415571 | 251 |
| 212 | 3300013104 | Ga0157370_10061372 | Ga0157370_100613721 | 251 |
| 213 | 3300013104 | Ga0157370_10206023 | Ga0157370_102060232 | 251 |
| 214 | 3300013104 | Ga0157370_10224378 | Ga0157370_102243782 | 251 |
| 215 | 3300013104 | Ga0157370_10268487 | Ga0157370_102684873 | 251 |
| 216 | 3300013104 | Ga0157370_10482766 | Ga0157370_104827661 | 251 |
| 217 | 3300013105 | Ga0157369_10479768 | Ga0157369_104797682 | 251 |
| 218 | 3300013296 | Ga0157374_10003576 | Ga0157374_100035763 | 251 |
| 219 | 3300013297 | Ga0157378_10003862 | Ga0157378_100038627 | 251 |
| 220 | 3300013306 | Ga0163162_10003581 | Ga0163162_100035815 | 251 |
| 221 | 3300013307 | Ga0157372_10009473 | Ga0157372_100094735 | 251 |
| 222 | 3300013307 | Ga0157372_10087293 | Ga0157372_100872935 | 251 |
| 223 | 3300013308 | Ga0157375_10002956 | Ga0157375_100029565 | 251 |
| 224 | 3300013308 | Ga0157375_10945244 | Ga0157375_109452441 | 251 |
| 225 | 3300014325 | Ga0163163_10003557 | Ga0163163_100035573 | 251 |
| 226 | 3300014497 | Ga0182008_10000001 | Ga0182008_10000001316 | 251 |
| 227 | 3300014968 | Ga0157379_10003531 | Ga0157379_1000353111 | 251 |
| 228 | 3300014969 | Ga0157376_10006779 | Ga0157376_100067795 | 251 |
| 229 | 3300015261 | Ga0182006_1000344 | Ga0182006_100034435 | 251 |
| 230 | 3300015261 | Ga0182006_1013870 | Ga0182006_10138702 | 251 |
| 231 | 3300017792 | Ga0163161_10000097 | Ga0163161_1000009739 | 251 |
| 232 | 3300017792 | Ga0163161_10003013 | Ga0163161_100030135 | 251 |
| 233 | 3300017792 | Ga0163161_10025892 | Ga0163161_100258925 | 251 |
| 234 | 3300017792 | Ga0163161_10062178 | Ga0163161_100621781 | 251 |
| 235 | 3300025291 | Ga0209675_1000056 | Ga0209675_100005666 | 251 |
| 236 | 3300025292 | Ga0209676_1000001 | Ga0209676_10000011341 | 251 |
| 237 | 3300025298 | Ga0209050_1000018 | Ga0209050_1000018242 | 251 |
| 238 | 3300025321 | Ga0207656_10006839 | Ga0207656_100068392 | 251 |
| 239 | 3300025728 | Ga0207655_1000259 | Ga0207655_100025936 | 251 |
| 240 | 3300025903 | Ga0207680_10038084 | Ga0207680_100380843 | 251 |
| 241 | 3300025907 | Ga0207645_10058546 | Ga0207645_100585462 | 251 |
| 242 | 3300025908 | Ga0207643_10002794 | Ga0207643_100027946 | 251 |
| 243 | 3300025908 | Ga0207643_10320836 | Ga0207643_103208361 | 251 |
| 244 | 3300025909 | Ga0207705_10003033 | Ga0207705_100030336 | 251 |
| 245 | 3300025909 | Ga0207705_10490680 | Ga0207705_104906801 | 251 |
| 246 | 3300025925 | Ga0207650_10347323 | Ga0207650_103473232 | 251 |
| 247 | 3300025933 | Ga0207706_10253836 | Ga0207706_102538362 | 251 |
| 248 | 3300025934 | Ga0207686_10042918 | Ga0207686_100429182 | 251 |
| 249 | 3300025934 | Ga0207686_10191331 | Ga0207686_101913312 | 251 |
| 250 | 3300025935 | Ga0207709_10000176 | Ga0207709_100001764 | 251 |
| 251 | 3300025935 | Ga0207709_10000184 | Ga0207709_100001846 | 251 |
| 252 | 3300025935 | Ga0207709_10229294 | Ga0207709_102292942 | 251 |
| 253 | 3300025940 | Ga0207691_10001432 | Ga0207691_1000143212 | 251 |
| 254 | 3300025940 | Ga0207691_10047317 | Ga0207691_100473173 | 251 |
| 255 | 3300025942 | Ga0207689_10003000 | Ga0207689_100030009 | 251 |
| 256 | 3300025945 | Ga0207679_10355543 | Ga0207679_103555432 | 251 |
| 257 | 3300025949 | Ga0207667_10042039 | Ga0207667_100420393 | 251 |
| 258 | 3300025960 | Ga0207651_10001070 | Ga0207651_100010705 | 251 |
| 259 | 3300025961 | Ga0207712_10011135 | Ga0207712_100111356 | 251 |
| 260 | 3300025961 | Ga0207712_10048394 | Ga0207712_100483945 | 251 |
| 261 | 3300025972 | Ga0207668_10000554 | Ga0207668_1000055418 | 251 |
| 262 | 3300025986 | Ga0207658_10001247 | Ga0207658_100012476 | 251 |
| 263 | 3300025986 | Ga0207658_10204625 | Ga0207658_102046253 | 251 |
| 264 | 3300026023 | Ga0207677_10004844 | Ga0207677_100048444 | 251 |
| 265 | 3300026035 | Ga0207703_10002419 | Ga0207703_100024198 | 251 |
| 266 | 3300026088 | Ga0207641_10001203 | Ga0207641_100012033 | 251 |
| 267 | 3300026089 | Ga0207648_10027548 | Ga0207648_100275482 | 251 |
| 268 | 3300026095 | Ga0207676_10104464 | Ga0207676_101044643 | 251 |
| 269 | 3300026116 | Ga0207674_10076743 | Ga0207674_100767432 | 251 |
| 270 | 3300026121 | Ga0207683_10113610 | Ga0207683_101136102 | 251 |
| 271 | 3300026142 | Ga0207698_10352345 | Ga0207698_103523451 | 251 |
| 272 | 3300028379 | Ga0268266_10004266 | Ga0268266_1000426612 | 251 |
| 273 | 3300028381 | Ga0268264_10014190 | Ga0268264_100141903 | 251 |
| 274 | 3300028573 | Ga0265334_10023257 | Ga0265334_100232572 | 251 |
| 275 | 3300028786 | Ga0307517_10009157 | Ga0307517_1000915711 | 251 |
| 276 | 3300028794 | Ga0307515_10000001 | Ga0307515_10000001983 | 251 |
| 277 | 3300028794 | Ga0307515_10000299 | Ga0307515_1000029917 | 251 |
| 278 | 3300028794 | Ga0307515_10435553 | Ga0307515_104355531 | 251 |
| 279 | 3300030521 | Ga0307511_10000002 | Ga0307511_10000002154 | 251 |
| 280 | 3300030732 | Ga0316176_1002742 | Ga0316176_10027424 | 251 |
| 281 | 3300030742 | Ga0316183_1188392 | Ga0316183_11883928 | 251 |
| 282 | 3300030744 | Ga0316181_1284540 | Ga0316181_128454011 | 251 |
| 283 | 3300031251 | Ga0265327_10012590 | Ga0265327_100125905 | 251 |
| 284 | 3300031730 | Ga0307516_10000648 | Ga0307516_1000064834 | 251 |
| 285 | 3300031911 | Ga0307412_10000028 | Ga0307412_10000028121 | 251 |
| 286 | 3300032002 | Ga0307416_100000033 | Ga0307416_1000000334 | 251 |
| 287 | 3300032004 | Ga0307414_10014303 | Ga0307414_100143033 | 251 |
| 288 | 3300032004 | Ga0307414_10044586 | Ga0307414_100445863 | 251 |
| 289 | 3300032004 | Ga0307414_10290781 | Ga0307414_102907812 | 251 |
| 290 | 3300033180 | Ga0307510_10285212 | Ga0307510_102852121 | 251 |
| 291 | 3300041498 | Ga0451841_0689466 | Ga0451841_0689466_204_962 | 251 |
| 292 | 3300042012 | Ga0439455_0018126 | Ga0439455_0018126_450_1205 | 251 |
| 293 | 3300046492 | Ga0495585_0141706 | Ga0495585_0141706_438_1193 | 251 |
| 294 | 3300046500 | Ga0495596_0001481 | Ga0495596_0001481_2908_3663 | 251 |
| 295 | 3300046507 | Ga0495606_0041527 | Ga0495606_0041527_1249_2007 | 251 |
| 296 | 3300046507 | Ga0495606_0277141 | Ga0495606_0277141_107_862 | 251 |
| 297 | 3300046529 | Ga0495652_0154564 | Ga0495652_0154564_453_1211 | 251 |
| 298 | 3300046616 | Ga0495668_0000154 | Ga0495668_0000154_28837_29595 | 251 |
| 299 | 3300046660 | Ga0495625_0071930 | Ga0495625_0071930_294_1049 | 251 |
| 300 | 3300048905 | Ga0496102_0084767 | Ga0496102_0084767_1505_2260 | 251 |
| 301 | 3300048906 | Ga0496103_0019856 | Ga0496103_0019856_2975_3730 | 251 |
| 302 | 3300048907 | Ga0496104_0187945 | Ga0496104_0187945_123_878 | 251 |
| 303 | 3300048908 | Ga0496105_0339895 | Ga0496105_0339895_164_919 | 251 |
| 304 | 3300048911 | Ga0496108_0265749 | Ga0496108_0265749_144_899 | 251 |
| 305 | 3300048916 | Ga0496113_0080925 | Ga0496113_0080925_873_1628 | 251 |
| 306 | 3300048917 | Ga0496114_0001472 | Ga0496114_0001472_14487_15248 | 251 |
| 307 | 3300048919 | Ga0496116_0000012 | Ga0496116_0000012_348743_349498 | 251 |
| 308 | 3300048919 | Ga0496116_0004879 | Ga0496116_0004879_7256_8017 | 251 |
| 309 | 3300048920 | Ga0496117_0000139 | Ga0496117_0000139_74008_74763 | 251 |
| 310 | 3300048920 | Ga0496117_0000897 | Ga0496117_0000897_41815_42576 | 251 |
| 311 | 3300048921 | Ga0496118_0000129 | Ga0496118_0000129_81276_82031 | 251 |
| 312 | 3300048922 | Ga0496119_0000002 | Ga0496119_0000002_653936_654691 | 251 |
| 313 | 3300048923 | Ga0496120_0059682 | Ga0496120_0059682_945_1700 | 251 |
| 314 | 3300048925 | Ga0496122_0000090 | Ga0496122_0000090_147457_148272 | 251 |
| 315 | 3300048925 | Ga0496122_0000207 | Ga0496122_0000207_72990_73745 | 251 |
| 316 | 3300048925 | Ga0496122_0000294 | Ga0496122_0000294_37897_38652 | 251 |
| 317 | 3300048925 | Ga0496122_0006679 | Ga0496122_0006679_101_856 | 251 |
| 318 | 3300048925 | Ga0496122_0033010 | Ga0496122_0033010_3349_4110 | 251 |
| 319 | 3300048926 | Ga0496123_0000496 | Ga0496123_0000496_57617_58372 | 251 |
| 320 | 3300048926 | Ga0496123_0001908 | Ga0496123_0001908_20908_21723 | 251 |
| 321 | 3300048927 | Ga0496124_0024657 | Ga0496124_0024657_2269_3024 | 251 |
| 322 | 3300048927 | Ga0496124_0068579 | Ga0496124_0068579_601_1362 | 251 |
| 323 | 3300048928 | Ga0496125_0000208 | Ga0496125_0000208_50029_50784 | 251 |
| 324 | 3300048928 | Ga0496125_0016515 | Ga0496125_0016515_2285_3040 | 251 |
| 325 | 3300048929 | Ga0496126_0001670 | Ga0496126_0001670_24796_25551 | 251 |
| 326 | 3300048929 | Ga0496126_0139389 | Ga0496126_0139389_1027_1782 | 251 |
| 327 | 3300049459 | Ga0495678_007880 | Ga0495678_007880_4540_5298 | 251 |
| 328 | 3300049679 | Ga0501249_000001 | Ga0501249_000001_11405_12160 | 251 |
| 329 | 3300050493 | nmdc:mga0k408_139768_c1 | nmdc:mga0k408_139768_c1_121_876 | 251 |
| 330 | 3300050493 | nmdc:mga0k408_27660_c1 | nmdc:mga0k408_27660_c1_1418_2173 | 251 |
| 331 | 3300053090 | Ga0500646_0004705 | Ga0500646_0004705_973_1728 | 251 |
| 332 | 3300053091 | Ga0500647_0049839 | Ga0500647_0049839_242_1000 | 251 |
| 333 | 3300053092 | Ga0500583_0001109 | Ga0500583_0001109_3050_3808 | 251 |
| 334 | 3300053096 | Ga0500641_0000018 | Ga0500641_0000018_11724_12479 | 251 |
| 335 | 3300053096 | Ga0500641_0001847 | Ga0500641_0001847_2789_3544 | 251 |
| 336 | 3300053131 | Ga0500652_038888 | Ga0500652_038888_301_1059 | 251 |
| 337 | 3300053156 | Ga0500622_0116372 | Ga0500622_0116372_172_930 | 251 |
| 338 | iso_pu_bacteria | 2582581278 | 2585142735 | 251 |
| 339 | iso_pu_bacteria | 2585428045 | 2587679511 | 251 |
| 340 | iso_pu_bacteria | 2585428060 | 2587748415 | 251 |
| 341 | iso_pu_bacteria | 2585428060 | 2587748543 | 251 |
| 342 | iso_pu_bacteria | 2585428185 | 2588224248 | 251 |
| 343 | iso_pu_bacteria | 2588254255 | 2590601116 | 251 |
| 344 | iso_pu_bacteria | 2739367663 | 2739645497 | 251 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3oio-assembly1.cif.gz_A | crystal structure of transcriptional regulator (arac-type dna-binding domain-containing proteins) from chromobacterium violaceum | 0.8585 | 142 | 239 |
| 3lsg-assembly1.cif.gz_A | the crystal structure of the c-terminal domain of the two-component response regulator yesn from fusobacterium nucleatum subsp. nucleatum atcc 25586 | 0.7952 | 141 | 235 |
| 6swi-assembly1.cif.gz_A | the c-terminal domain of arat, a response regulator from geobacillus stearothermophilus | 0.7659 | 137 | 238 |
| 4fe7-assembly1.cif.gz_A-2 | structure of xylose-binding transcription activator xylr | 0.7547 | 137 | 236 |
| 3oio-assembly1.cif.gz_A | crystal structure of transcriptional regulator (arac-type dna-binding domain-containing proteins) from chromobacterium violaceum | 0.7534 | 142 | 239 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P77379_178_282_1.10.10.60 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like | 0.8446 | 146 | 237 | 1.10.10.60 |
| 3oioA00 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like | 0.8434 | 142 | 239 | 1.10.10.60 |
| af_P76241_154_259_1.10.10.60 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like | 0.8427 | 147 | 237 | 1.10.10.60 |
| af_P31449_179_288_1.10.10.60 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like | 0.8367 | 142 | 239 | 1.10.10.60 |
| af_Q2FY65_11_117_1.10.10.60 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like | 0.8176 | 142 | 239 | 1.10.10.60 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A316WNP5-F1-model_v4 | Transcriptional regulator | 0.996 | 1 | 251 |
GO:0003700
GO:0043565 |
| AF-A0A0Q1BB88-F1-model_v4 | DNA-binding domain-containing protein, AraC-type | 0.9896 | 35 | 251 |
GO:0003700
GO:0043565 |
| AF-A0A0Q5N4Y7-F1-model_v4 | Transcriptional regulator | 0.9874 | 4 | 251 |
GO:0003700
GO:0043565 |
| AF-A0A558C4L4-F1-model_v4 | Helix-turn-helix transcriptional regulator | 0.9851 | 3 | 246 |
GO:0003700
GO:0043565 |
| AF-A0A5B8VJA6-F1-model_v4 | AraC family transcriptional regulator | 0.982 | 1 | 246 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar