F415841

General Info

Members Datasets Scaffolds Average Seq Length
344 236 289 251

Family's Representative Sequence

Representative Sequence 3300005338|Ga0068868_100063842|Ga0068868_1000638424
Length 283
Sequence MELHKCIGTDQRIKKLVFNGRWSMVKDNKQATMDNSFYYKFIEPDKSLADFVESLGMFHNPSDKAKEVVVLPDGRIDLFFLQSASTLFRVTLVGLETEPEQRSIEPHTLAFVISFKPLAVEYILHNPIAGLLNTAKDLQDNIWGFNADDLKDFDAFCKKASQKIKELLPGEIDERKRKLFRLIYSSNGEMSVKALSEKVFWSSRQINRYFNQQFGLSLKAYCNILRFRASLQHIAQGKLFPELNFTDQTHFIKEIKKFSGVVPKELSKNKNDRFVLLSVLKQK

Samples

Sample ID Description Type Environment
1 2513020052 Flavobacterium sp. CF136 Isolate Rhizosphere
2 2582581278 Chryseobacterium sp. CF365 Isolate Rhizosphere
3 2585428045 Chryseobacterium sp. OV705 Isolate Rhizosphere
4 2585428060 Chryseobacterium sp. OV715 Isolate Rhizosphere
5 2585428095 Chryseobacterium sp. YR005 Isolate Rhizosphere
6 2585428182 Chryseobacterium sp. YR477 Isolate Rhizosphere
7 2585428183 Chryseobacterium sp. YR485 Isolate Rhizosphere
8 2585428184 Chryseobacterium sp. YR480 Isolate Rhizosphere
9 2585428185 Chryseobacterium sp. YR459 Isolate Rhizosphere
10 2588253712 Chryseobacterium sp. OV279 Isolate Rhizosphere
11 2588254255 Chryseobacterium sp. YR221 Isolate Rhizosphere
12 2588254257 Chryseobacterium sp. YR203 Isolate Rhizosphere
13 2599185184 Mucilaginibacter sp. NFR10 Isolate Rhizoplane
14 2643221600 Flavobacterium sp. Root186 Isolate Unclassified
15 2643221667 Flavobacterium sp. Root420 Isolate Unclassified
16 2721755487 Sphingobacterium sp. B29 Isolate Rhizosphere
17 2728369107 Chryseobacterium kwangjuense KJ1R5 Isolate Unclassified
18 2738541284 Pedobacter sp. YR016 Isolate Unclassified
19 2738541302 Pedobacter sp. CF074 Isolate Unclassified
20 2739367656 Pedobacter sp. CF523 Isolate Unclassified
21 2739367663 Pedobacter sp. YR510 Isolate Unclassified
22 2739367857 Flavobacterium sp. GV029 Isolate Unclassified
23 2739367858 Flavobacterium sp. GV028 Isolate Unclassified
24 2751185877 Chryseobacterium artocarpi UTM-3 Isolate Rhizosphere
25 2765235839 Chryseobacterium indologenes AA5 Isolate Unclassified
26 2772190705 Chryseobacterium contaminans C-26 Isolate Rhizosphere
27 2775506987 Pedobacter ginsengisoli T01R-27 Isolate Unclassified
28 2816332188 Chryseobacterium aquifrigidense 110 (version 2) Isolate Unclassified
29 2818991437 Pedobacter terrae 518 Isolate Unclassified
30 2818991460 Chitinophaga polysaccharea 1209 Isolate Unclassified
31 2842083920 Chryseobacterium lathyri KCTC 22544 Isolate Rhizosphere
32 2842903701 Olivibacter sp. R-72191 Isolate Unclassified
33 2852627209 Pedobacter sp. AK017 Isolate Rhizosphere
34 2857618242 Flavobacterium sp. R-74482 Isolate Unclassified
35 2857627736 Pedobacter sp. R-74587 Isolate Unclassified
36 2871720351 Chryseobacterium sp. KLBC 52 Isolate Nodule
37 2881247448 Flavobacterium beibuense RSKm HC5 Isolate Rhizosphere
38 2884791551 Chitinophaga oryzae 1310 Isolate Unclassified
39 2889290771 Chryseobacterium sp. PvR013 Isolate Rhizosphere
40 2890804823 Fluviicola sp. SGL-29 Isolate Rhizosphere
41 2905999023 Chryseobacterium elymi KCTC 22547 Isolate Rhizosphere
42 2919186247 Pedobacter africanus 2697 Isolate Rhizosphere
43 2919191525 Flavobacterium sp. 2755 Isolate Rhizosphere
44 2919399522 Chryseobacterium sp. 2987 Isolate Unclassified
45 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
46 2928147474 Mucilaginibacter rubeus 2025 Isolate Unclassified
47 2929150217 Flavobacterium sp. R-74510 Hybrid assembly Isolate Unclassified
48 2929154850 Filimonas sp. R-72421 Hybrid assembly Isolate Unclassified
49 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere
50 2939664404 Pedobacter africanus 2990 Isolate Rhizosphere
51 2946019816 Chryseobacterium sp. W4I1 Isolate Rhizosphere
52 2958512119 Flavobacterium sp. Sd200 Isolate Rhizosphere
53 2977243572 Chryseobacterium sp. SORGH_AS 447 Isolate Unclassified
54 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
55 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
56 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
57 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
58 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
59 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
60 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
61 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
62 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
63 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
64 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
65 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
66 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
67 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
68 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
69 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
70 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
71 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
72 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
73 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
74 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
75 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
76 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
77 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
78 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
79 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
80 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
81 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
82 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
83 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
84 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
85 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
86 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
87 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
88 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
89 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
90 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
91 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
92 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
93 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
94 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
95 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
96 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
97 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
98 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
99 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
100 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
101 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
102 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
103 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
104 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
105 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
106 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
107 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
108 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
109 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
110 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
111 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
112 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
113 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
114 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
115 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
116 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
117 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
118 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
119 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
120 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
121 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
122 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
123 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
124 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
125 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
126 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
127 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
128 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
129 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
130 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
131 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
132 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
133 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
134 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
135 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
136 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
137 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
173 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
174 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
175 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
176 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
177 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
178 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
179 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
180 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
181 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
182 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
183 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
184 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
185 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
186 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
187 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
188 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
189 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
190 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
191 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
192 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
193 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
194 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
195 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
196 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
197 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
198 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
199 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
200 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
201 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
202 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
203 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
204 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
205 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
206 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
207 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
208 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
209 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
210 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
211 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
212 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
213 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
214 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
215 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
216 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
217 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
218 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
219 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
220 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
221 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
222 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
223 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
224 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
225 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
226 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
227 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
228 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
229 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
230 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
231 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
232 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
233 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
234 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
235 8054307821 Flavobacterium soyae SCIV07 Isolate Rhizosphere
236 8056440228 Flavobacterium hibisci THG-HG1.4 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 83.72
Metatranscriptomes 0
Isolates 16.28

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.98
Nodule 0.58
Rhizoplane 2.33
Rhizosphere 70.64
Stem 0
Stem Tuber 0
Unclassified 19.48

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24741J21665_1009434 3300001915 Bacteria 1791
2 JGI24740J21852_10021094 3300001979 Bacteria 2263
3 JGI24739J22299_10022578 3300001989 Bacteria 2231
4 JGI24739J22299_10027105 3300001989 Bacteria 2005
5 JGI24737J22298_10000914 3300001990 Bacteria 10486
6 JGI24737J22298_10001745 3300001990 Bacteria 7761
7 JGI24735J21928_10000027 3300002067 Bacteria 83494
8 rootH2_10038272 3300003320 Bacteria 20840
9 rootH2_10059244 3300003320 Bacteria 7623
10 rootH2_10302698 3300003320 Bacteria 2940
11 rootL2_10044393 3300003322 Bacteria 18918
12 rootL2_10100079 3300003322 Bacteria 5852
13 rootL2_10224518 3300003322 Bacteria 1459
14 rootH1_10006320 3300003316 Bacteria 10236
15 rootH1_10006320 3300003323 Bacteria 2214
16 rootH1_10052802 3300003323 Bacteria 3407
17 rootH1_10054792 3300003323 Bacteria 4498
18 Ga0055536_1000009 3300003781 Bacteria 311572
19 Ga0055534_1005976 3300003784 Bacteria 3150
20 Ga0055530_10006855 3300003791 Bacteria 4941
21 Ga0065714_10002217 3300005288 Bacteria 49867
22 Ga0065714_10007915 3300005288 Bacteria 3368
23 Ga0065714_10068458 3300005288 Bacteria 4717
24 Ga0065704_10075090 3300005289 Bacteria 5783
25 Ga0070658_10003549 3300005327 Bacteria 12805
26 Ga0070658_10126913 3300005327 Bacteria 2124
27 Ga0070676_10030692 3300005328 Bacteria 3067
28 Ga0070670_100412553 3300005331 Bacteria 1193
29 Ga0070666_10001098 3300005335 Bacteria 16532
30 Ga0070680_100744865 3300005336 Bacteria 844
31 Ga0070682_100000063 3300005337 Bacteria 101553
32 Ga0070682_100336312 3300005337 Viruses 1121
33 Ga0068868_100009897 3300005338 Bacteria 6884
34 Ga0068868_100024933 3300005338 Bacteria 4542
35 Ga0068868_100063842 3300005338 Bacteria 2922
36 Ga0068868_100781274 3300005338 Bacteria 860
37 Ga0070660_100051607 3300005339 Bacteria 3168
38 Ga0070661_100411741 3300005344 Bacteria 1070
39 Ga0070668_100000970 3300005347 Bacteria 20082
40 Ga0070668_100168569 3300005347 Bacteria 1781
41 Ga0070674_100294477 3300005356 Bacteria 1291
42 Ga0070673_100004445 3300005364 Bacteria 8867
43 Ga0070673_100012685 3300005364 Bacteria 5796
44 Ga0070667_100005087 3300005367 Bacteria 11007
45 Ga0070667_100030727 3300005367 Bacteria 4479
46 Ga0070667_100147105 3300005367 Bacteria 2067
47 Ga0070678_100058790 3300005456 Bacteria 2823
48 Ga0070662_100219107 3300005457 Bacteria 1518
49 Ga0068867_100030436 3300005459 Bacteria 3894
50 Ga0070685_10122242 3300005466 Bacteria 1618
51 Ga0070679_100355893 3300005530 Bacteria 1411
52 Ga0070679_100437757 3300005530 Bacteria 1252
53 Ga0068853_100398339 3300005539 Unclassified 1288
54 Ga0070672_100001914 3300005543 Bacteria 13057
55 Ga0070672_100085789 3300005543 Bacteria 2531
56 Ga0070672_100110312 3300005543 Bacteria 2242
57 Ga0070665_100004105 3300005548 Bacteria 15317
58 Ga0070665_100015766 3300005548 Bacteria 7591
59 Ga0068855_100030654 3300005563 Bacteria 6430
60 Ga0070664_100418943 3300005564 Bacteria 1226
61 Ga0070664_100602762 3300005564 Unclassified 1019
62 Ga0068857_100303972 3300005577 Bacteria 1471
63 Ga0068852_100390845 3300005616 Bacteria 1366
64 Ga0068859_100550450 3300005617 Bacteria 1248
65 Ga0068864_100205780 3300005618 Bacteria 1810
66 Ga0068866_10057723 3300005718 Bacteria 2001
67 Ga0068861_100213142 3300005719 Bacteria 1628
68 Ga0068851_10011294 3300005834 Bacteria 4186
69 Ga0068870_10039746 3300005840 Bacteria 2435
70 Ga0068870_10338051 3300005840 Bacteria 962
71 Ga0068863_100059271 3300005841 Bacteria 3622
72 Ga0068863_100305709 3300005841 Bacteria 1543
73 Ga0068858_100009832 3300005842 Bacteria 9099
74 Ga0068860_100002897 3300005843 Bacteria 17784
75 Ga0068860_100017305 3300005843 Bacteria 7024
76 Ga0097621_100005783 3300006237 Bacteria 8731
77 Ga0097621_100040235 3300006237 Bacteria 3757
78 Ga0068871_100028863 3300006358 Bacteria 4354
79 Ga0068871_100084246 3300006358 Bacteria 2638
80 Ga0097620_100550430 3300006931 Bacteria 1248
81 Ga0079104_1041540 3300006946 Bacteria 1070
82 Ga0105244_10000060 3300009036 Bacteria 127191
83 Ga0105244_10047736 3300009036 Bacteria 2194
84 Ga0105244_10060875 3300009036 Bacteria 1901
85 Ga0105240_10249480 3300009093 Bacteria 2054
86 Ga0105247_10043477 3300009101 Bacteria 2752
87 Ga0105243_10000127 3300009148 Bacteria 86196
88 Ga0105243_10000143 3300009148 Bacteria 81998
89 Ga0105241_10638876 3300009174 Bacteria 965
90 Ga0105242_10047949 3300009176 Bacteria 3470
91 Ga0105242_10138021 3300009176 Bacteria 2113
92 Ga0105237_10179963 3300009545 Bacteria 2115
93 Ga0105237_10454470 3300009545 Bacteria 1287
94 Ga0105237_10494032 3300009545 Bacteria 1230
95 Ga0105238_10261725 3300009551 Bacteria 1709
96 Ga0105249_10017061 3300009553 Bacteria 6444
97 Ga0105249_10026844 3300009553 Bacteria 5192
98 Ga0105239_10060063 3300010375 Bacteria 4172
99 Ga0105239_10191006 3300010375 Bacteria 2292
100 Ga0105239_10775624 3300010375 Bacteria 1098
101 Ga0105246_10015847 3300011119 Bacteria 4767
102 Ga0157373_10000009 3300013100 Bacteria 201551
103 Ga0157371_10000009 3300013102 Bacteria 392895
104 Ga0157371_10001037 3300013102 Bacteria 30465
105 Ga0157371_10026484 3300013102 Bacteria 4214
106 Ga0157371_10321049 3300013102 Bacteria 1124
107 Ga0157370_10001185 3300013104 Bacteria 32500
108 Ga0157370_10041557 3300013104 Bacteria 4434
109 Ga0157370_10048981 3300013104 Bacteria 4046
110 Ga0157370_10061372 3300013104 Bacteria 3568
111 Ga0157370_10206023 3300013104 Unclassified 1824
112 Ga0157370_10224378 3300013104 Bacteria 1740
113 Ga0157370_10268487 3300013104 Bacteria 1576
114 Ga0157370_10482766 3300013104 Bacteria 1139
115 Ga0157369_10479768 3300013105 Bacteria 1287
116 Ga0157374_10003576 3300013296 Bacteria 13085
117 Ga0157374_10311602 3300013296 Bacteria 1558
118 Ga0157378_10003862 3300013297 Bacteria 13256
119 Ga0157378_10017059 3300013297 Bacteria 6365
120 Ga0163162_10003581 3300013306 Bacteria 14861
121 Ga0157372_10009473 3300013307 Bacteria 10357
122 Ga0157372_10087293 3300013307 Bacteria 3539
123 Ga0157375_10002956 3300013308 Bacteria 14749
124 Ga0157375_10197043 3300013308 Bacteria 2169
125 Ga0157375_10945244 3300013308 Bacteria 1004
126 Ga0163163_10003557 3300014325 Bacteria 13229
127 Ga0182008_10000001 3300014497 Bacteria 540790
128 Ga0182008_10000028 3300014497 Bacteria 176968
129 Ga0157379_10003531 3300014968 Bacteria 13241
130 Ga0157379_10236939 3300014968 Bacteria 1655
131 Ga0157376_10006779 3300014969 Bacteria 8108
132 Ga0157376_10893904 3300014969 Bacteria 906
133 Ga0182006_1000344 3300015261 Bacteria 39571
134 Ga0182006_1013870 3300015261 Unclassified 3485
135 Ga0163161_10000097 3300017792 Bacteria 84842
136 Ga0163161_10003013 3300017792 Bacteria 11904
137 Ga0163161_10025892 3300017792 Bacteria 4153
138 Ga0163161_10058729 3300017792 Bacteria 2796
139 Ga0163161_10062178 3300017792 Bacteria 2719
140 Ga0209436_102794 3300025208 Bacteria 4972
141 Ga0209130_1001745 3300025284 Bacteria 12947
142 Ga0209675_1000056 3300025291 Bacteria 187664
143 Ga0209676_1000001 3300025292 Bacteria 1852142
144 Ga0209050_1000018 3300025298 Bacteria 723263
145 Ga0207426_1000310 3300025302 Bacteria 96036
146 Ga0207656_10006839 3300025321 Bacteria 4127
147 Ga0207655_1000259 3300025728 Bacteria 83295
148 Ga0207655_1061070 3300025728 Bacteria 1457
149 Ga0207682_10020312 3300025893 Unclassified 2607
150 Ga0207680_10038084 3300025903 Bacteria 2781
151 Ga0207680_10101445 3300025903 Unclassified 1850
152 Ga0207645_10001839 3300025907 Bacteria 17100
153 Ga0207645_10058546 3300025907 Bacteria 2460
154 Ga0207643_10002794 3300025908 Bacteria 9424
155 Ga0207643_10320836 3300025908 Bacteria 967
156 Ga0207705_10003033 3300025909 Bacteria 12807
157 Ga0207705_10490680 3300025909 Bacteria 954
158 Ga0207654_10430683 3300025911 Bacteria 922
159 Ga0207671_10408236 3300025914 Bacteria 1080
160 Ga0207650_10347323 3300025925 Bacteria 1220
161 Ga0207659_10032948 3300025926 Bacteria 3561
162 Ga0207706_10253836 3300025933 Bacteria 1536
163 Ga0207686_10042918 3300025934 Bacteria 2768
164 Ga0207686_10165486 3300025934 Bacteria 1554
165 Ga0207686_10191331 3300025934 Bacteria 1459
166 Ga0207686_10235486 3300025934 Bacteria 1330
167 Ga0207709_10000176 3300025935 Bacteria 86175
168 Ga0207709_10000184 3300025935 Bacteria 83205
169 Ga0207709_10229294 3300025935 Bacteria 1344
170 Ga0207704_10032399 3300025938 Bacteria 2957
171 Ga0207691_10001432 3300025940 Bacteria 23824
172 Ga0207691_10016276 3300025940 Bacteria 7060
173 Ga0207691_10047317 3300025940 Bacteria 3947
174 Ga0207689_10003000 3300025942 Bacteria 15566
175 Ga0207679_10355543 3300025945 Bacteria 1278
176 Ga0207667_10042039 3300025949 Bacteria 4861
177 Ga0207667_10124147 3300025949 Bacteria 2660
178 Ga0207651_10001070 3300025960 Bacteria 12162
179 Ga0207651_10007738 3300025960 Bacteria 5743
180 Ga0207712_10011135 3300025961 Bacteria 5725
181 Ga0207712_10048394 3300025961 Bacteria 2957
182 Ga0207668_10000554 3300025972 Bacteria 23448
183 Ga0207640_10087477 3300025981 Bacteria 2148
184 Ga0207658_10001247 3300025986 Bacteria 20115
185 Ga0207658_10204625 3300025986 Bacteria 1650
186 Ga0207677_10004844 3300026023 Bacteria 7263
187 Ga0207703_10002419 3300026035 Bacteria 16208
188 Ga0207641_10001203 3300026088 Bacteria 25928
189 Ga0207641_10173144 3300026088 Bacteria 1972
190 Ga0207648_10001374 3300026089 Bacteria 26793
191 Ga0207648_10027548 3300026089 Bacteria 5045
192 Ga0207648_10129350 3300026089 Bacteria 2222
193 Ga0207676_10104464 3300026095 Unclassified 2356
194 Ga0207674_10076743 3300026116 Bacteria 3349
195 Ga0207675_100256082 3300026118 Bacteria 1695
196 Ga0207683_10008813 3300026121 Bacteria 8608
197 Ga0207683_10113610 3300026121 Bacteria 2426
198 Ga0207698_10258587 3300026142 Bacteria 1598
199 Ga0207698_10352345 3300026142 Bacteria 1391
200 Ga0268266_10004266 3300028379 Bacteria 13756
201 Ga0268266_10433398 3300028379 Bacteria 1247
202 Ga0268264_10014190 3300028381 Bacteria 6550
203 Ga0268264_10236038 3300028381 Unclassified 1691
204 Ga0268264_10860907 3300028381 Bacteria 908
205 Ga0265334_10023257 3300028573 Bacteria 2521
206 Ga0307517_10009157 3300028786 Bacteria 14091
207 Ga0307515_10000001 3300028794 Bacteria 4259510
208 Ga0307515_10000003 3300028794 Bacteria 891317
209 Ga0307515_10000299 3300028794 Bacteria 122087
210 Ga0307515_10435553 3300028794 Bacteria 929
211 Ga0307511_10000002 3300030521 Bacteria 199923
212 Ga0316176_1002742 3300030732 Bacteria 81202
213 Ga0316183_1188392 3300030742 Bacteria 20529
214 Ga0316181_1284540 3300030744 Bacteria 22346
215 Ga0265327_10012590 3300031251 Bacteria 5693
216 Ga0265327_10061433 3300031251 Bacteria 1917
217 Ga0307513_10131129 3300031456 Bacteria 2452
218 Ga0307514_10130971 3300031649 Bacteria 1727
219 Ga0307516_10000648 3300031730 Bacteria 47083
220 Ga0307412_10000028 3300031911 Bacteria 213966
221 Ga0307416_100000033 3300032002 Bacteria 156736
222 Ga0307414_10014303 3300032004 Bacteria 4753
223 Ga0307414_10044586 3300032004 Bacteria 3030
224 Ga0307414_10290781 3300032004 Bacteria 1377
225 Ga0307510_10285212 3300033180 Bacteria 1120
226 Ga0439447_007797 3300041407 Bacteria 3362
227 Ga0439466_0001856 3300041411 Bacteria 8281
228 Ga0451841_0689466 3300041498 Bacteria 1426
229 Ga0439455_0018126 3300042012 Bacteria 1649
230 Ga0495585_0141706 3300046492 Bacteria 1259
231 Ga0495596_0001481 3300046500 Bacteria 13424
232 Ga0495606_0041527 3300046507 Bacteria 3084
233 Ga0495606_0277141 3300046507 Bacteria 918
234 Ga0495610_0000001 3300046512 Bacteria 1620061
235 Ga0495630_0155963 3300046517 Bacteria 1738
236 Ga0495663_0000224 3300046525 Bacteria 22602
237 Ga0495652_0154564 3300046529 Bacteria 1788
238 Ga0495609_0000025 3300046538 Bacteria 256898
239 Ga0495633_0000333 3300046558 Bacteria 53039
240 Ga0495668_0000154 3300046616 Bacteria 104449
241 Ga0495668_0001543 3300046616 Bacteria 21852
242 Ga0495625_0071930 3300046660 Bacteria 2426
243 Ga0496102_0084767 3300048905 Bacteria 2925
244 Ga0496103_0019856 3300048906 Bacteria 4035
245 Ga0496104_0187945 3300048907 Bacteria 1977
246 Ga0496105_0339895 3300048908 Bacteria 1200
247 Ga0496108_0265749 3300048911 Bacteria 1493
248 Ga0496113_0080925 3300048916 Bacteria 2489
249 Ga0496114_0001472 3300048917 Bacteria 17864
250 Ga0496116_0000012 3300048919 Bacteria 611365
251 Ga0496116_0000032 3300048919 Bacteria 419997
252 Ga0496116_0004879 3300048919 Bacteria 12652
253 Ga0496117_0000139 3300048920 Bacteria 158612
254 Ga0496117_0000897 3300048920 Bacteria 45839
255 Ga0496118_0000129 3300048921 Bacteria 134056
256 Ga0496118_0107312 3300048921 Bacteria 1865
257 Ga0496119_0000002 3300048922 Bacteria 738385
258 Ga0496120_0059682 3300048923 Bacteria 2137
259 Ga0496121_0000008 3300048924 Bacteria 843593
260 Ga0496122_0000090 3300048925 Bacteria 205886
261 Ga0496122_0000207 3300048925 Bacteria 131493
262 Ga0496122_0000294 3300048925 Bacteria 110530
263 Ga0496122_0006679 3300048925 Bacteria 13139
264 Ga0496122_0033010 3300048925 Bacteria 4265
265 Ga0496123_0000496 3300048926 Bacteria 68245
266 Ga0496123_0001908 3300048926 Bacteria 27193
267 Ga0496124_0024657 3300048927 Bacteria 5463
268 Ga0496124_0068579 3300048927 Bacteria 2947
269 Ga0496125_0000208 3300048928 Bacteria 122812
270 Ga0496125_0016515 3300048928 Bacteria 7084
271 Ga0496126_0001670 3300048929 Bacteria 33301
272 Ga0496126_0139389 3300048929 Bacteria 2089
273 Ga0495678_007880 3300049459 Bacteria 5471
274 Ga0501249_000001 3300049679 Bacteria 268580
275 nmdc:mga0k408_139768_c1 3300050493 Bacteria 1440
276 nmdc:mga0k408_27660_c1 3300050493 Bacteria 3222
277 Ga0500578_0000303 3300053086 Bacteria 60307
278 Ga0500646_0004705 3300053090 Bacteria 3451
279 Ga0500647_0049839 3300053091 Bacteria 2014
280 Ga0500583_0001109 3300053092 Bacteria 7670
281 Ga0500641_0000018 3300053096 Bacteria 132142
282 Ga0500641_0001847 3300053096 Bacteria 7513
283 Ga0500652_038888 3300053131 Bacteria 1905
284 Ga0500655_003686 3300053133 Bacteria 2760
285 Ga0500658_0000004 3300053134 Bacteria 457801
286 Ga0500573_0161833 3300053140 Bacteria 1218
287 Ga0500588_0124679 3300053146 Bacteria 912
288 Ga0500616_0155405 3300053153 Bacteria 1054
289 Ga0500622_0116372 3300053156 Bacteria 1301

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300031251 Ga0265327_10061433 Ga0265327_100614331 238
2 3300046512 Ga0495610_0000001 Ga0495610_0000001_1005970_1006728 240
3 3300003320 rootH2_10038272 rootH2_1003827219 241
4 3300005337 Ga0070682_100336312 Ga0070682_1003363121 241
5 3300025914 Ga0207671_10408236 Ga0207671_104082361 241
6 iso_pu_bacteria 2818991460 2819682089 241
7 iso_pu_bacteria 2884791551 2884792799 243
8 3300003323 rootH1_10054792 rootH1_100547923 245
9 iso_pu_bacteria 2643221600 2644013007 245
10 iso_pu_bacteria 2738541302 2738855210 245
11 iso_pu_bacteria 2739367656 2739615608 245
12 iso_pu_bacteria 2818991437 2819548843 245
13 iso_pu_bacteria 2857627736 2857630760 245
14 iso_pu_bacteria 2919191525 2919195248 245
15 iso_pu_bacteria 2977243572 2977246418 245
16 iso_pu_bacteria 8054307821 8054310017 245
17 3300017792 Ga0163161_10058729 Ga0163161_100587292 246
18 3300025208 Ga0209436_102794 Ga0209436_1027942 246
19 3300025284 Ga0209130_1001745 Ga0209130_10017458 246
20 3300025302 Ga0207426_1000310 Ga0207426_100031050 246
21 3300053086 Ga0500578_0000303 Ga0500578_0000303_16549_17292 247
22 iso_pu_bacteria 2513020052 2513234891 247
23 iso_pu_bacteria 2585428095 2587865592 247
24 iso_pu_bacteria 2585428182 2588208645 247
25 iso_pu_bacteria 2585428183 2588212845 247
26 iso_pu_bacteria 2585428184 2588219396 247
27 iso_pu_bacteria 2588253712 2588445990 247
28 iso_pu_bacteria 2588254257 2590614111 247
29 iso_pu_bacteria 2599185184 2599481750 247
30 iso_pu_bacteria 2643221667 2644370316 247
31 iso_pu_bacteria 2721755487 2722727941 247
32 iso_pu_bacteria 2728369107 2729201806 247
33 iso_pu_bacteria 2739367857 2740003255 247
34 iso_pu_bacteria 2739367858 2740008072 247
35 iso_pu_bacteria 2751185877 2753672234 247
36 iso_pu_bacteria 2765235839 2765572229 247
37 iso_pu_bacteria 2772190705 2772604258 247
38 iso_pu_bacteria 2775506987 2776615857 247
39 iso_pu_bacteria 2816332188 2816872430 247
40 iso_pu_bacteria 2842083920 2842087637 247
41 iso_pu_bacteria 2842903701 2842909415 247
42 iso_pu_bacteria 2852627209 2852629919 247
43 iso_pu_bacteria 2857618242 2857619541 247
44 iso_pu_bacteria 2871720351 2871721385 247
45 iso_pu_bacteria 2881247448 2881250827 247
46 iso_pu_bacteria 2889290771 2889292137 247
47 iso_pu_bacteria 2890804823 2890807273 247
48 iso_pu_bacteria 2905999023 2906002711 247
49 iso_pu_bacteria 2919186247 2919187178 247
50 iso_pu_bacteria 2919399522 2919404127 247
51 iso_pu_bacteria 2928078545 2928082023 247
52 iso_pu_bacteria 2928147474 2928152043 247
53 iso_pu_bacteria 2929150217 2929152584 247
54 iso_pu_bacteria 2929154850 2929155462 247
55 iso_pu_bacteria 2932082852 2932088078 247
56 iso_pu_bacteria 2939664404 2939665554 247
57 iso_pu_bacteria 2946019816 2946020930 247
58 iso_pu_bacteria 2958512119 2958512681 247
59 iso_pu_bacteria 8056440228 8056442438 247
60 iso_pu_bacteria 2738541284 2738761164 248
61 3300001979 JGI24740J21852_10021094 JGI24740J21852_100210943 249
62 3300003322 rootL2_10044393 rootL2_100443937 249
63 3300003322 rootL2_10100079 rootL2_101000794 249
64 3300005288 Ga0065714_10002217 Ga0065714_1000221730 249
65 3300005338 Ga0068868_100009897 Ga0068868_1000098976 249
66 3300005338 Ga0068868_100781274 Ga0068868_1007812741 249
67 3300005344 Ga0070661_100411741 Ga0070661_1004117412 249
68 3300005347 Ga0070668_100168569 Ga0070668_1001685691 249
69 3300005356 Ga0070674_100294477 Ga0070674_1002944772 249
70 3300005364 Ga0070673_100004445 Ga0070673_1000044457 249
71 3300005367 Ga0070667_100030727 Ga0070667_1000307275 249
72 3300005466 Ga0070685_10122242 Ga0070685_101222422 249
73 3300005539 Ga0068853_100398339 Ga0068853_1003983392 249
74 3300005543 Ga0070672_100110312 Ga0070672_1001103122 249
75 3300005548 Ga0070665_100015766 Ga0070665_1000157662 249
76 3300005564 Ga0070664_100602762 Ga0070664_1006027622 249
77 3300005718 Ga0068866_10057723 Ga0068866_100577232 249
78 3300005719 Ga0068861_100213142 Ga0068861_1002131421 249
79 3300005841 Ga0068863_100305709 Ga0068863_1003057091 249
80 3300005843 Ga0068860_100017305 Ga0068860_1000173057 249
81 3300006237 Ga0097621_100040235 Ga0097621_1000402352 249
82 3300006358 Ga0068871_100028863 Ga0068871_1000288632 249
83 3300009036 Ga0105244_10060875 Ga0105244_100608753 249
84 3300009174 Ga0105241_10638876 Ga0105241_106388761 249
85 3300009176 Ga0105242_10138021 Ga0105242_101380212 249
86 3300009545 Ga0105237_10494032 Ga0105237_104940323 249
87 3300013100 Ga0157373_10000009 Ga0157373_10000009105 249
88 3300013102 Ga0157371_10000009 Ga0157371_10000009162 249
89 3300013104 Ga0157370_10001185 Ga0157370_100011854 249
90 3300013104 Ga0157370_10048981 Ga0157370_100489811 249
91 3300013296 Ga0157374_10311602 Ga0157374_103116022 249
92 3300013297 Ga0157378_10017059 Ga0157378_100170595 249
93 3300013308 Ga0157375_10197043 Ga0157375_101970432 249
94 3300014497 Ga0182008_10000028 Ga0182008_1000002892 249
95 3300014968 Ga0157379_10236939 Ga0157379_102369391 249
96 3300014969 Ga0157376_10893904 Ga0157376_108939042 249
97 3300025728 Ga0207655_1061070 Ga0207655_10610703 249
98 3300025893 Ga0207682_10020312 Ga0207682_100203122 249
99 3300025903 Ga0207680_10101445 Ga0207680_101014452 249
100 3300025907 Ga0207645_10001839 Ga0207645_100018398 249
101 3300025911 Ga0207654_10430683 Ga0207654_104306831 249
102 3300025926 Ga0207659_10032948 Ga0207659_100329484 249
103 3300025934 Ga0207686_10165486 Ga0207686_101654862 249
104 3300025934 Ga0207686_10235486 Ga0207686_102354862 249
105 3300025938 Ga0207704_10032399 Ga0207704_100323992 249
106 3300025940 Ga0207691_10016276 Ga0207691_100162767 249
107 3300025949 Ga0207667_10124147 Ga0207667_101241472 249
108 3300025960 Ga0207651_10007738 Ga0207651_100077385 249
109 3300025981 Ga0207640_10087477 Ga0207640_100874772 249
110 3300026088 Ga0207641_10173144 Ga0207641_101731443 249
111 3300026089 Ga0207648_10001374 Ga0207648_1000137421 249
112 3300026089 Ga0207648_10129350 Ga0207648_101293502 249
113 3300026118 Ga0207675_100256082 Ga0207675_1002560821 249
114 3300026121 Ga0207683_10008813 Ga0207683_100088138 249
115 3300028379 Ga0268266_10433398 Ga0268266_104333982 249
116 3300028381 Ga0268264_10236038 Ga0268264_102360382 249
117 3300028381 Ga0268264_10860907 Ga0268264_108609071 249
118 3300028794 Ga0307515_10000003 Ga0307515_10000003261 249
119 3300031456 Ga0307513_10131129 Ga0307513_101311292 249
120 3300031649 Ga0307514_10130971 Ga0307514_101309712 249
121 3300046517 Ga0495630_0155963 Ga0495630_0155963_326_1081 249
122 3300046525 Ga0495663_0000224 Ga0495663_0000224_10402_11151 249
123 3300046538 Ga0495609_0000025 Ga0495609_0000025_227355_228104 249
124 3300046558 Ga0495633_0000333 Ga0495633_0000333_8097_8846 249
125 3300046616 Ga0495668_0001543 Ga0495668_0001543_5843_6592 249
126 3300048919 Ga0496116_0000032 Ga0496116_0000032_90847_91602 249
127 3300048921 Ga0496118_0107312 Ga0496118_0107312_741_1496 249
128 3300053133 Ga0500655_003686 Ga0500655_003686_1193_1945 249
129 3300053146 Ga0500588_0124679 Ga0500588_0124679_42_791 249
130 3300053153 Ga0500616_0155405 Ga0500616_0155405_59_823 249
131 3300003320 rootH2_10059244 rootH2_100592445 250
132 3300009036 Ga0105244_10047736 Ga0105244_100477361 250
133 3300026142 Ga0207698_10258587 Ga0207698_102585872 250
134 3300041407 Ga0439447_007797 Ga0439447_007797_2559_3311 250
135 3300041411 Ga0439466_0001856 Ga0439466_0001856_2424_3176 250
136 3300048924 Ga0496121_0000008 Ga0496121_0000008_338276_339097 250
137 3300053134 Ga0500658_0000004 Ga0500658_0000004_14167_14919 250
138 3300053140 Ga0500573_0161833 Ga0500573_0161833_170_922 250
139 3300001915 JGI24741J21665_1009434 JGI24741J21665_10094343 251
140 3300001989 JGI24739J22299_10022578 JGI24739J22299_100225781 251
141 3300001989 JGI24739J22299_10027105 JGI24739J22299_100271052 251
142 3300001990 JGI24737J22298_10000914 JGI24737J22298_100009142 251
143 3300001990 JGI24737J22298_10001745 JGI24737J22298_100017455 251
144 3300002067 JGI24735J21928_10000027 JGI24735J21928_1000002735 251
145 3300003320 rootH2_10302698 rootH2_103026982 251
146 3300003322 rootL2_10224518 rootL2_102245182 251
147 3300003323 rootH1_10006320 rootH1_100063201 251
148 3300003323 rootH1_10052802 rootH1_100528022 251
149 3300003781 Ga0055536_1000009 Ga0055536_10000093 251
150 3300003784 Ga0055534_1005976 Ga0055534_10059762 251
151 3300003791 Ga0055530_10006855 Ga0055530_100068553 251
152 3300005288 Ga0065714_10007915 Ga0065714_100079152 251
153 3300005288 Ga0065714_10068458 Ga0065714_100684583 251
154 3300005289 Ga0065704_10075090 Ga0065704_100750906 251
155 3300005327 Ga0070658_10003549 Ga0070658_100035499 251
156 3300005327 Ga0070658_10126913 Ga0070658_101269131 251
157 3300005328 Ga0070676_10030692 Ga0070676_100306922 251
158 3300005331 Ga0070670_100412553 Ga0070670_1004125531 251
159 3300005335 Ga0070666_10001098 Ga0070666_100010986 251
160 3300005336 Ga0070680_100744865 Ga0070680_1007448651 251
161 3300005337 Ga0070682_100000063 Ga0070682_10000006375 251
162 3300005338 Ga0068868_100024933 Ga0068868_1000249335 251
163 3300005338 Ga0068868_100063842 Ga0068868_1000638424 251
164 3300005339 Ga0070660_100051607 Ga0070660_1000516073 251
165 3300005347 Ga0070668_100000970 Ga0070668_1000009705 251
166 3300005364 Ga0070673_100012685 Ga0070673_1000126852 251
167 3300005367 Ga0070667_100005087 Ga0070667_1000050872 251
168 3300005367 Ga0070667_100147105 Ga0070667_1001471051 251
169 3300005456 Ga0070678_100058790 Ga0070678_1000587902 251
170 3300005457 Ga0070662_100219107 Ga0070662_1002191072 251
171 3300005459 Ga0068867_100030436 Ga0068867_1000304362 251
172 3300005530 Ga0070679_100355893 Ga0070679_1003558932 251
173 3300005530 Ga0070679_100437757 Ga0070679_1004377571 251
174 3300005543 Ga0070672_100001914 Ga0070672_10000191413 251
175 3300005543 Ga0070672_100085789 Ga0070672_1000857893 251
176 3300005548 Ga0070665_100004105 Ga0070665_1000041059 251
177 3300005563 Ga0068855_100030654 Ga0068855_1000306542 251
178 3300005564 Ga0070664_100418943 Ga0070664_1004189432 251
179 3300005577 Ga0068857_100303972 Ga0068857_1003039721 251
180 3300005616 Ga0068852_100390845 Ga0068852_1003908452 251
181 3300005617 Ga0068859_100550450 Ga0068859_1005504502 251
182 3300005618 Ga0068864_100205780 Ga0068864_1002057802 251
183 3300005834 Ga0068851_10011294 Ga0068851_100112943 251
184 3300005840 Ga0068870_10039746 Ga0068870_100397462 251
185 3300005840 Ga0068870_10338051 Ga0068870_103380511 251
186 3300005841 Ga0068863_100059271 Ga0068863_1000592713 251
187 3300005842 Ga0068858_100009832 Ga0068858_1000098329 251
188 3300005843 Ga0068860_100002897 Ga0068860_1000028975 251
189 3300006237 Ga0097621_100005783 Ga0097621_1000057835 251
190 3300006358 Ga0068871_100084246 Ga0068871_1000842462 251
191 3300006931 Ga0097620_100550430 Ga0097620_1005504302 251
192 3300006946 Ga0079104_1041540 Ga0079104_10415402 251
193 3300009036 Ga0105244_10000060 Ga0105244_1000006076 251
194 3300009093 Ga0105240_10249480 Ga0105240_102494802 251
195 3300009101 Ga0105247_10043477 Ga0105247_100434772 251
196 3300009148 Ga0105243_10000127 Ga0105243_100001274 251
197 3300009148 Ga0105243_10000143 Ga0105243_100001435 251
198 3300009176 Ga0105242_10047949 Ga0105242_100479492 251
199 3300009545 Ga0105237_10179963 Ga0105237_101799632 251
200 3300009545 Ga0105237_10454470 Ga0105237_104544701 251
201 3300009551 Ga0105238_10261725 Ga0105238_102617252 251
202 3300009553 Ga0105249_10017061 Ga0105249_100170616 251
203 3300009553 Ga0105249_10026844 Ga0105249_100268442 251
204 3300010375 Ga0105239_10060063 Ga0105239_100600634 251
205 3300010375 Ga0105239_10191006 Ga0105239_101910062 251
206 3300010375 Ga0105239_10775624 Ga0105239_107756242 251
207 3300011119 Ga0105246_10015847 Ga0105246_100158474 251
208 3300013102 Ga0157371_10001037 Ga0157371_100010377 251
209 3300013102 Ga0157371_10026484 Ga0157371_100264842 251
210 3300013102 Ga0157371_10321049 Ga0157371_103210491 251
211 3300013104 Ga0157370_10041557 Ga0157370_100415571 251
212 3300013104 Ga0157370_10061372 Ga0157370_100613721 251
213 3300013104 Ga0157370_10206023 Ga0157370_102060232 251
214 3300013104 Ga0157370_10224378 Ga0157370_102243782 251
215 3300013104 Ga0157370_10268487 Ga0157370_102684873 251
216 3300013104 Ga0157370_10482766 Ga0157370_104827661 251
217 3300013105 Ga0157369_10479768 Ga0157369_104797682 251
218 3300013296 Ga0157374_10003576 Ga0157374_100035763 251
219 3300013297 Ga0157378_10003862 Ga0157378_100038627 251
220 3300013306 Ga0163162_10003581 Ga0163162_100035815 251
221 3300013307 Ga0157372_10009473 Ga0157372_100094735 251
222 3300013307 Ga0157372_10087293 Ga0157372_100872935 251
223 3300013308 Ga0157375_10002956 Ga0157375_100029565 251
224 3300013308 Ga0157375_10945244 Ga0157375_109452441 251
225 3300014325 Ga0163163_10003557 Ga0163163_100035573 251
226 3300014497 Ga0182008_10000001 Ga0182008_10000001316 251
227 3300014968 Ga0157379_10003531 Ga0157379_1000353111 251
228 3300014969 Ga0157376_10006779 Ga0157376_100067795 251
229 3300015261 Ga0182006_1000344 Ga0182006_100034435 251
230 3300015261 Ga0182006_1013870 Ga0182006_10138702 251
231 3300017792 Ga0163161_10000097 Ga0163161_1000009739 251
232 3300017792 Ga0163161_10003013 Ga0163161_100030135 251
233 3300017792 Ga0163161_10025892 Ga0163161_100258925 251
234 3300017792 Ga0163161_10062178 Ga0163161_100621781 251
235 3300025291 Ga0209675_1000056 Ga0209675_100005666 251
236 3300025292 Ga0209676_1000001 Ga0209676_10000011341 251
237 3300025298 Ga0209050_1000018 Ga0209050_1000018242 251
238 3300025321 Ga0207656_10006839 Ga0207656_100068392 251
239 3300025728 Ga0207655_1000259 Ga0207655_100025936 251
240 3300025903 Ga0207680_10038084 Ga0207680_100380843 251
241 3300025907 Ga0207645_10058546 Ga0207645_100585462 251
242 3300025908 Ga0207643_10002794 Ga0207643_100027946 251
243 3300025908 Ga0207643_10320836 Ga0207643_103208361 251
244 3300025909 Ga0207705_10003033 Ga0207705_100030336 251
245 3300025909 Ga0207705_10490680 Ga0207705_104906801 251
246 3300025925 Ga0207650_10347323 Ga0207650_103473232 251
247 3300025933 Ga0207706_10253836 Ga0207706_102538362 251
248 3300025934 Ga0207686_10042918 Ga0207686_100429182 251
249 3300025934 Ga0207686_10191331 Ga0207686_101913312 251
250 3300025935 Ga0207709_10000176 Ga0207709_100001764 251
251 3300025935 Ga0207709_10000184 Ga0207709_100001846 251
252 3300025935 Ga0207709_10229294 Ga0207709_102292942 251
253 3300025940 Ga0207691_10001432 Ga0207691_1000143212 251
254 3300025940 Ga0207691_10047317 Ga0207691_100473173 251
255 3300025942 Ga0207689_10003000 Ga0207689_100030009 251
256 3300025945 Ga0207679_10355543 Ga0207679_103555432 251
257 3300025949 Ga0207667_10042039 Ga0207667_100420393 251
258 3300025960 Ga0207651_10001070 Ga0207651_100010705 251
259 3300025961 Ga0207712_10011135 Ga0207712_100111356 251
260 3300025961 Ga0207712_10048394 Ga0207712_100483945 251
261 3300025972 Ga0207668_10000554 Ga0207668_1000055418 251
262 3300025986 Ga0207658_10001247 Ga0207658_100012476 251
263 3300025986 Ga0207658_10204625 Ga0207658_102046253 251
264 3300026023 Ga0207677_10004844 Ga0207677_100048444 251
265 3300026035 Ga0207703_10002419 Ga0207703_100024198 251
266 3300026088 Ga0207641_10001203 Ga0207641_100012033 251
267 3300026089 Ga0207648_10027548 Ga0207648_100275482 251
268 3300026095 Ga0207676_10104464 Ga0207676_101044643 251
269 3300026116 Ga0207674_10076743 Ga0207674_100767432 251
270 3300026121 Ga0207683_10113610 Ga0207683_101136102 251
271 3300026142 Ga0207698_10352345 Ga0207698_103523451 251
272 3300028379 Ga0268266_10004266 Ga0268266_1000426612 251
273 3300028381 Ga0268264_10014190 Ga0268264_100141903 251
274 3300028573 Ga0265334_10023257 Ga0265334_100232572 251
275 3300028786 Ga0307517_10009157 Ga0307517_1000915711 251
276 3300028794 Ga0307515_10000001 Ga0307515_10000001983 251
277 3300028794 Ga0307515_10000299 Ga0307515_1000029917 251
278 3300028794 Ga0307515_10435553 Ga0307515_104355531 251
279 3300030521 Ga0307511_10000002 Ga0307511_10000002154 251
280 3300030732 Ga0316176_1002742 Ga0316176_10027424 251
281 3300030742 Ga0316183_1188392 Ga0316183_11883928 251
282 3300030744 Ga0316181_1284540 Ga0316181_128454011 251
283 3300031251 Ga0265327_10012590 Ga0265327_100125905 251
284 3300031730 Ga0307516_10000648 Ga0307516_1000064834 251
285 3300031911 Ga0307412_10000028 Ga0307412_10000028121 251
286 3300032002 Ga0307416_100000033 Ga0307416_1000000334 251
287 3300032004 Ga0307414_10014303 Ga0307414_100143033 251
288 3300032004 Ga0307414_10044586 Ga0307414_100445863 251
289 3300032004 Ga0307414_10290781 Ga0307414_102907812 251
290 3300033180 Ga0307510_10285212 Ga0307510_102852121 251
291 3300041498 Ga0451841_0689466 Ga0451841_0689466_204_962 251
292 3300042012 Ga0439455_0018126 Ga0439455_0018126_450_1205 251
293 3300046492 Ga0495585_0141706 Ga0495585_0141706_438_1193 251
294 3300046500 Ga0495596_0001481 Ga0495596_0001481_2908_3663 251
295 3300046507 Ga0495606_0041527 Ga0495606_0041527_1249_2007 251
296 3300046507 Ga0495606_0277141 Ga0495606_0277141_107_862 251
297 3300046529 Ga0495652_0154564 Ga0495652_0154564_453_1211 251
298 3300046616 Ga0495668_0000154 Ga0495668_0000154_28837_29595 251
299 3300046660 Ga0495625_0071930 Ga0495625_0071930_294_1049 251
300 3300048905 Ga0496102_0084767 Ga0496102_0084767_1505_2260 251
301 3300048906 Ga0496103_0019856 Ga0496103_0019856_2975_3730 251
302 3300048907 Ga0496104_0187945 Ga0496104_0187945_123_878 251
303 3300048908 Ga0496105_0339895 Ga0496105_0339895_164_919 251
304 3300048911 Ga0496108_0265749 Ga0496108_0265749_144_899 251
305 3300048916 Ga0496113_0080925 Ga0496113_0080925_873_1628 251
306 3300048917 Ga0496114_0001472 Ga0496114_0001472_14487_15248 251
307 3300048919 Ga0496116_0000012 Ga0496116_0000012_348743_349498 251
308 3300048919 Ga0496116_0004879 Ga0496116_0004879_7256_8017 251
309 3300048920 Ga0496117_0000139 Ga0496117_0000139_74008_74763 251
310 3300048920 Ga0496117_0000897 Ga0496117_0000897_41815_42576 251
311 3300048921 Ga0496118_0000129 Ga0496118_0000129_81276_82031 251
312 3300048922 Ga0496119_0000002 Ga0496119_0000002_653936_654691 251
313 3300048923 Ga0496120_0059682 Ga0496120_0059682_945_1700 251
314 3300048925 Ga0496122_0000090 Ga0496122_0000090_147457_148272 251
315 3300048925 Ga0496122_0000207 Ga0496122_0000207_72990_73745 251
316 3300048925 Ga0496122_0000294 Ga0496122_0000294_37897_38652 251
317 3300048925 Ga0496122_0006679 Ga0496122_0006679_101_856 251
318 3300048925 Ga0496122_0033010 Ga0496122_0033010_3349_4110 251
319 3300048926 Ga0496123_0000496 Ga0496123_0000496_57617_58372 251
320 3300048926 Ga0496123_0001908 Ga0496123_0001908_20908_21723 251
321 3300048927 Ga0496124_0024657 Ga0496124_0024657_2269_3024 251
322 3300048927 Ga0496124_0068579 Ga0496124_0068579_601_1362 251
323 3300048928 Ga0496125_0000208 Ga0496125_0000208_50029_50784 251
324 3300048928 Ga0496125_0016515 Ga0496125_0016515_2285_3040 251
325 3300048929 Ga0496126_0001670 Ga0496126_0001670_24796_25551 251
326 3300048929 Ga0496126_0139389 Ga0496126_0139389_1027_1782 251
327 3300049459 Ga0495678_007880 Ga0495678_007880_4540_5298 251
328 3300049679 Ga0501249_000001 Ga0501249_000001_11405_12160 251
329 3300050493 nmdc:mga0k408_139768_c1 nmdc:mga0k408_139768_c1_121_876 251
330 3300050493 nmdc:mga0k408_27660_c1 nmdc:mga0k408_27660_c1_1418_2173 251
331 3300053090 Ga0500646_0004705 Ga0500646_0004705_973_1728 251
332 3300053091 Ga0500647_0049839 Ga0500647_0049839_242_1000 251
333 3300053092 Ga0500583_0001109 Ga0500583_0001109_3050_3808 251
334 3300053096 Ga0500641_0000018 Ga0500641_0000018_11724_12479 251
335 3300053096 Ga0500641_0001847 Ga0500641_0001847_2789_3544 251
336 3300053131 Ga0500652_038888 Ga0500652_038888_301_1059 251
337 3300053156 Ga0500622_0116372 Ga0500622_0116372_172_930 251
338 iso_pu_bacteria 2582581278 2585142735 251
339 iso_pu_bacteria 2585428045 2587679511 251
340 iso_pu_bacteria 2585428060 2587748415 251
341 iso_pu_bacteria 2585428060 2587748543 251
342 iso_pu_bacteria 2585428185 2588224248 251
343 iso_pu_bacteria 2588254255 2590601116 251
344 iso_pu_bacteria 2739367663 2739645497 251

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF20240

DUF6597

Domain of unknown function (DUF6597)

40

137

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
3oio-assembly1.cif.gz_A crystal structure of transcriptional regulator (arac-type dna-binding domain-containing proteins) from chromobacterium violaceum 0.8585 142 239
3lsg-assembly1.cif.gz_A the crystal structure of the c-terminal domain of the two-component response regulator yesn from fusobacterium nucleatum subsp. nucleatum atcc 25586 0.7952 141 235
6swi-assembly1.cif.gz_A the c-terminal domain of arat, a response regulator from geobacillus stearothermophilus 0.7659 137 238
4fe7-assembly1.cif.gz_A-2 structure of xylose-binding transcription activator xylr 0.7547 137 236
3oio-assembly1.cif.gz_A crystal structure of transcriptional regulator (arac-type dna-binding domain-containing proteins) from chromobacterium violaceum 0.7534 142 239
ID Description Score Start End Superfamily
af_P77379_178_282_1.10.10.60 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.8446 146 237 1.10.10.60
3oioA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.8434 142 239 1.10.10.60
af_P76241_154_259_1.10.10.60 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.8427 147 237 1.10.10.60
af_P31449_179_288_1.10.10.60 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.8367 142 239 1.10.10.60
af_Q2FY65_11_117_1.10.10.60 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.8176 142 239 1.10.10.60
ID Description Score Start End GO Terms
AF-A0A316WNP5-F1-model_v4 Transcriptional regulator 0.996 1 251 GO:0003700
GO:0043565
AF-A0A0Q1BB88-F1-model_v4 DNA-binding domain-containing protein, AraC-type 0.9896 35 251 GO:0003700
GO:0043565
AF-A0A0Q5N4Y7-F1-model_v4 Transcriptional regulator 0.9874 4 251 GO:0003700
GO:0043565
AF-A0A558C4L4-F1-model_v4 Helix-turn-helix transcriptional regulator 0.9851 3 246 GO:0003700
GO:0043565
AF-A0A5B8VJA6-F1-model_v4 AraC family transcriptional regulator 0.982 1 246

Feature Viewer

pLDDT pTM Quality
93.73 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map