F415821

General Info

Members Datasets Scaffolds Average Seq Length
344 183 333 121

Family's Representative Sequence

Representative Sequence 3300004800|Ga0058861_10005061|Ga0058861_100050612
Length 144
Sequence VITPIVGVIGEITNKSVKSKNKGMADKKTLVLGATPNPARYAYLAANRLARNGHSIVNVGLKKGEVAGVAIEKPETIHHDIDTITLYVGPQHQPELYDYILNTHPKRIIFNPGTENSELRRMANENGIETEYACTLVLLSIGEY

Samples

Sample ID Description Type Environment
1 2519899754 Flavobacterium sp. F52 Isolate Rhizosphere
2 2599185184 Mucilaginibacter sp. NFR10 Isolate Rhizoplane
3 2643221716 Flavobacterium sp. Root901 Isolate Unclassified
4 2816332280 Flavobacterium johnsoniae GSE09 Isolate Unclassified
5 2852623160 Mucilaginibacter sp. AK015 Isolate Rhizosphere
6 2884933994 Mucilaginibacter sp. 14171R-50 Isolate Rhizosphere
7 2919437846 Mucilaginibacter pocheonensis 3262 Isolate Rhizosphere
8 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
9 2928147474 Mucilaginibacter rubeus 2025 Isolate Unclassified
10 2958458903 Flavobacterium anhuiense RCM74 Isolate Rhizosphere
11 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
12 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
13 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
14 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
15 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
16 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
17 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
18 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
19 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
20 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
21 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
22 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
23 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
24 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
25 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
26 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
27 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
28 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
29 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
30 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
31 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
32 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
33 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
34 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
35 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
36 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
37 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
38 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
39 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
40 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
41 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
42 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
43 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
44 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
45 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
46 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
47 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
48 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
49 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
50 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
51 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
52 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
53 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
54 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
56 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
57 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
58 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
59 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
60 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
61 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
62 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
63 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
64 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
65 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
66 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
67 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
68 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
69 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
70 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
71 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
72 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
73 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
74 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
75 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
76 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
77 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
78 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
79 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
80 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
81 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
82 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
83 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
84 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
85 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
86 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
87 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
88 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
89 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
90 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
91 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
121 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
122 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
123 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
124 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
125 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
126 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
127 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
128 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
129 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
130 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
131 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
132 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
133 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
134 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
135 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
136 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
137 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
138 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
139 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
140 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
141 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
142 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
143 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
144 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
145 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
146 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
147 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
148 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
149 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
150 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
151 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
152 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
153 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
154 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
155 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
156 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
157 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
158 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
159 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
160 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
161 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
162 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
163 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
164 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
165 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
166 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
167 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
168 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
169 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
170 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
171 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
172 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
173 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
174 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
175 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
176 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
177 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
178 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
179 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
180 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
181 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
182 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
183 8055419101 Flavobacterium tyrosinilyticum KCTC 42726 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.35
Metatranscriptomes 1.45
Isolates 3.2

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.01
Nodule 0
Rhizoplane 1.45
Rhizosphere 84.3
Stem 0
Stem Tuber 0
Unclassified 5.23

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24736J21556_1002620 3300001904 Bacteria 3157
2 JGI24736J21556_1011537 3300001904 Bacteria 1436
3 JGI24740J21852_10119106 3300001979 Bacteria 662
4 JGI24739J22299_10000787 3300001989 Bacteria 11576
5 JGI24737J22298_10015417 3300001990 Bacteria 2473
6 JGI24737J22298_10017618 3300001990 Bacteria 2299
7 JGI24744J21845_10009032 3300002077 Bacteria 2049
8 JGI25162J39368_1000150 3300002737 Bacteria 75945
9 JGI25162J39368_1000682 3300002737 Bacteria 23752
10 JGI25157J39369_1012095 3300002741 Bacteria 1103
11 JGI25164J39214_1001658 3300002772 Bacteria 4589
12 JGI25165J46597_1000456 3300003214 Bacteria 41124
13 rootH1_10045740 3300003316 Bacteria 5468
14 rootH2_10018482 3300003320 Bacteria 7697
15 rootH2_10043869 3300003320 Bacteria 10138
16 rootH2_10241331 3300003320 Bacteria 6262
17 rootL2_10012952 3300003322 Bacteria 5632
18 rootH1_10012978 3300003323 Bacteria 27481
19 rootH1_10068572 3300003323 Bacteria 1630
20 Ga0058863_11859864 3300004799 Bacteria 3600
21 Ga0058861_10005061 3300004800 Bacteria 1606
22 Ga0058862_10002974 3300004803 Bacteria 3136
23 Ga0070658_10000290 3300005327 Bacteria 43973
24 Ga0070658_10014613 3300005327 Bacteria 6301
25 Ga0070658_10254941 3300005327 Bacteria 1489
26 Ga0070658_10285178 3300005327 Bacteria 1406
27 Ga0070676_10007187 3300005328 Bacteria 5966
28 Ga0068869_102084352 3300005334 Bacteria 509
29 Ga0070680_100617808 3300005336 Bacteria 931
30 Ga0068868_100008686 3300005338 Bacteria 7275
31 Ga0070660_100051500 3300005339 Bacteria 3171
32 Ga0070660_100283666 3300005339 Bacteria 1355
33 Ga0070661_101409714 3300005344 Bacteria 586
34 Ga0070671_100312180 3300005355 Bacteria 1339
35 Ga0070673_100008632 3300005364 Bacteria 6788
36 Ga0070673_101799577 3300005364 Unclassified 580
37 Ga0070688_100236922 3300005365 Bacteria 1293
38 Ga0070659_100011510 3300005366 Bacteria 6545
39 Ga0070659_100026245 3300005366 Bacteria 4480
40 Ga0070659_101129164 3300005366 Bacteria 691
41 Ga0070659_101318431 3300005366 Bacteria 640
42 Ga0070663_100003848 3300005455 Bacteria 8740
43 Ga0070678_100017640 3300005456 Bacteria 4604
44 Ga0070678_100945068 3300005456 Unclassified 790
45 Ga0070662_100002313 3300005457 Bacteria 11700
46 Ga0070681_10073517 3300005458 Bacteria 3380
47 Ga0068867_100008159 3300005459 Bacteria 7397
48 Ga0070679_100021503 3300005530 Bacteria 6299
49 Ga0070679_100133450 3300005530 Bacteria 2464
50 Ga0070684_100762665 3300005535 Bacteria 903
51 Ga0068853_100018436 3300005539 Bacteria 5776
52 Ga0068853_100065627 3300005539 Bacteria 3150
53 Ga0068853_102110909 3300005539 Bacteria 546
54 Ga0070672_100086704 3300005543 Bacteria 2518
55 Ga0070665_100000061 3300005548 Bacteria 222138
56 Ga0068855_100000060 3300005563 Bacteria 133838
57 Ga0068855_100008684 3300005563 Bacteria 12281
58 Ga0068855_100015461 3300005563 Bacteria 9188
59 Ga0068855_100028189 3300005563 Bacteria 6717
60 Ga0068855_100077275 3300005563 Bacteria 3862
61 Ga0068855_100621632 3300005563 Bacteria 1163
62 Ga0068855_101041132 3300005563 Bacteria 858
63 Ga0068857_100018920 3300005577 Bacteria 6043
64 Ga0068854_101389424 3300005578 Bacteria 634
65 Ga0068856_100064206 3300005614 Bacteria 3628
66 Ga0068856_100099223 3300005614 Bacteria 2903
67 Ga0068856_100180721 3300005614 Bacteria 2122
68 Ga0068852_100013694 3300005616 Bacteria 6214
69 Ga0068852_102041847 3300005616 Bacteria 595
70 Ga0075366_10004089 3300006195 Bacteria 7802
71 Ga0075366_10015152 3300006195 Bacteria 4414
72 Ga0075366_10055938 3300006195 Bacteria 2343
73 Ga0075366_10616068 3300006195 Unclassified 673
74 Ga0097621_100003881 3300006237 Bacteria 10358
75 Ga0097621_100011606 3300006237 Bacteria 6494
76 Ga0097621_101787321 3300006237 Bacteria 586
77 Ga0075370_10368970 3300006353 Unclassified 859
78 Ga0068871_100000622 3300006358 Bacteria 24425
79 Ga0068865_100007507 3300006881 Bacteria 6707
80 Ga0105240_10000075 3300009093 Bacteria 199596
81 Ga0105240_10146673 3300009093 Bacteria 2815
82 Ga0105240_10149150 3300009093 Bacteria 2787
83 Ga0105240_10183733 3300009093 Bacteria 2465
84 Ga0105240_10235633 3300009093 Bacteria 2124
85 Ga0105240_10299112 3300009093 Bacteria 1841
86 Ga0105240_10346025 3300009093 Bacteria 1688
87 Ga0105240_10638091 3300009093 Bacteria 1169
88 Ga0105240_11714068 3300009093 Bacteria 656
89 Ga0105245_12409064 3300009098 Bacteria 580
90 Ga0105241_10004575 3300009174 Bacteria 10235
91 Ga0105241_10009106 3300009174 Bacteria 7305
92 Ga0105241_12041653 3300009174 Bacteria 565
93 Ga0105242_10014527 3300009176 Bacteria 6101
94 Ga0105237_10000465 3300009545 Bacteria 57393
95 Ga0105237_10021544 3300009545 Bacteria 6626
96 Ga0105237_10023198 3300009545 Bacteria 6361
97 Ga0105237_10024810 3300009545 Bacteria 6135
98 Ga0105237_10059947 3300009545 Bacteria 3807
99 Ga0105237_10163403 3300009545 Bacteria 2225
100 Ga0105237_10270644 3300009545 Bacteria 1702
101 Ga0105237_11005134 3300009545 Bacteria 841
102 Ga0105237_11704081 3300009545 Bacteria 638
103 Ga0105238_10030758 3300009551 Bacteria 5465
104 Ga0105238_10084640 3300009551 Bacteria 3161
105 Ga0105238_10132855 3300009551 Bacteria 2467
106 Ga0105249_11961013 3300009553 Bacteria 658
107 Ga0105239_10000142 3300010375 Bacteria 101628
108 Ga0105239_10000286 3300010375 Bacteria 74525
109 Ga0105239_10002242 3300010375 Bacteria 24707
110 Ga0105239_10061479 3300010375 Bacteria 4122
111 Ga0105239_10093649 3300010375 Bacteria 3317
112 Ga0105239_10218862 3300010375 Bacteria 2135
113 Ga0105239_10266701 3300010375 Bacteria 1925
114 Ga0105239_11997877 3300010375 Bacteria 673
115 Ga0105246_10058473 3300011119 Bacteria 2671
116 Ga0105246_11538610 3300011119 Unclassified 626
117 Ga0105246_12371139 3300011119 Unclassified 520
118 Ga0157373_10010316 3300013100 Bacteria 6881
119 Ga0157373_10043610 3300013100 Bacteria 3204
120 Ga0157371_10004409 3300013102 Bacteria 12300
121 Ga0157371_10006549 3300013102 Bacteria 9578
122 Ga0157371_10022996 3300013102 Bacteria 4558
123 Ga0157371_10050979 3300013102 Bacteria 2941
124 Ga0157370_10016076 3300013104 Bacteria 7585
125 Ga0157369_10005466 3300013105 Bacteria 14766
126 Ga0157369_10092230 3300013105 Bacteria 3232
127 Ga0157369_10098521 3300013105 Bacteria 3117
128 Ga0157369_10171562 3300013105 Bacteria 2285
129 Ga0157374_10000125 3300013296 Bacteria 70183
130 Ga0157374_10014844 3300013296 Bacteria 6825
131 Ga0157374_10057423 3300013296 Bacteria 3635
132 Ga0157374_10350016 3300013296 Bacteria 1468
133 Ga0157374_11552207 3300013296 Unclassified 686
134 Ga0157378_10038747 3300013297 Bacteria 4225
135 Ga0157378_10619070 3300013297 Bacteria 1095
136 Ga0157378_12332336 3300013297 Bacteria 587
137 Ga0157378_12947592 3300013297 Unclassified 528
138 Ga0163162_10000087 3300013306 Bacteria 85680
139 Ga0163162_10002647 3300013306 Bacteria 16974
140 Ga0163162_10003764 3300013306 Bacteria 14537
141 Ga0163162_10009160 3300013306 Bacteria 9632
142 Ga0163162_10562771 3300013306 Bacteria 1267
143 Ga0163162_12697872 3300013306 Bacteria 572
144 Ga0157372_10000048 3300013307 Bacteria 142757
145 Ga0157372_10000354 3300013307 Bacteria 50294
146 Ga0157372_10001314 3300013307 Bacteria 26916
147 Ga0157372_10045070 3300013307 Bacteria 4890
148 Ga0157372_10717860 3300013307 Bacteria 1163
149 Ga0157375_10036705 3300013308 Bacteria 4690
150 Ga0157375_10041878 3300013308 Bacteria 4427
151 Ga0157375_10195776 3300013308 Bacteria 2176
152 Ga0157375_10433204 3300013308 Bacteria 1481
153 Ga0163163_10947890 3300014325 Bacteria 924
154 Ga0157377_10012454 3300014745 Bacteria 4277
155 Ga0157379_12497885 3300014968 Bacteria 516
156 Ga0157376_10134745 3300014969 Bacteria 2209
157 Ga0157376_10168043 3300014969 Unclassified 1995
158 Ga0157376_11155455 3300014969 Bacteria 801
159 Ga0182007_10027883 3300015262 Bacteria 1943
160 Ga0163161_10915819 3300017792 Bacteria 744
161 Ga0206352_11264405 3300020078 Bacteria 1277
162 Ga0154015_1678080 3300020610 Unclassified 1465
163 Ga0213872_10033831 3300021361 Bacteria 2341
164 Ga0209563_104816 3300025230 Bacteria 2527
165 Ga0207427_100083 3300025231 Bacteria 142745
166 Ga0207427_116069 3300025231 Unclassified 704
167 Ga0209437_100021 3300025233 Bacteria 646400
168 Ga0209437_100230 3300025233 Bacteria 95882
169 Ga0209026_1001689 3300025250 Bacteria 9255
170 Ga0209026_1002250 3300025250 Bacteria 7406
171 Ga0209026_1010077 3300025250 Bacteria 1792
172 Ga0209129_1067783 3300025258 Bacteria 519
173 Ga0209233_1000035 3300025261 Bacteria 568478
174 Ga0209233_1001672 3300025261 Bacteria 8637
175 Ga0209233_1034296 3300025261 Bacteria 1156
176 Ga0207647_10001052 3300025904 Bacteria 21267
177 Ga0207647_10001219 3300025904 Bacteria 19782
178 Ga0207647_10107368 3300025904 Bacteria 1652
179 Ga0207647_10564393 3300025904 Bacteria 630
180 Ga0207645_10013463 3300025907 Bacteria 5510
181 Ga0207705_10000317 3300025909 Bacteria 43987
182 Ga0207705_10114968 3300025909 Bacteria 1991
183 Ga0207705_10214358 3300025909 Bacteria 1461
184 Ga0207654_10002795 3300025911 Bacteria 8870
185 Ga0207654_10020832 3300025911 Bacteria 3482
186 Ga0207654_10031005 3300025911 Bacteria 2941
187 Ga0207707_10194355 3300025912 Bacteria 1770
188 Ga0207695_10000235 3300025913 Bacteria 146984
189 Ga0207695_10020240 3300025913 Bacteria 7627
190 Ga0207695_10106983 3300025913 Bacteria 2782
191 Ga0207695_10187243 3300025913 Bacteria 1988
192 Ga0207695_10374708 3300025913 Bacteria 1309
193 Ga0207671_10008704 3300025914 Bacteria 8564
194 Ga0207671_10012357 3300025914 Bacteria 6869
195 Ga0207671_10014468 3300025914 Bacteria 6233
196 Ga0207671_10023453 3300025914 Bacteria 4654
197 Ga0207671_10068327 3300025914 Bacteria 2647
198 Ga0207671_10747189 3300025914 Bacteria 777
199 Ga0207660_11368600 3300025917 Unclassified 574
200 Ga0207657_10057532 3300025919 Bacteria 3351
201 Ga0207652_10089566 3300025921 Bacteria 2702
202 Ga0207694_10021769 3300025924 Bacteria 4859
203 Ga0207694_10161672 3300025924 Bacteria 1809
204 Ga0207694_10240113 3300025924 Unclassified 1481
205 Ga0207644_10422374 3300025931 Bacteria 1092
206 Ga0207690_10010109 3300025932 Bacteria 5604
207 Ga0207690_10349341 3300025932 Bacteria 1169
208 Ga0207706_10000009 3300025933 Bacteria 200607
209 Ga0207686_10028323 3300025934 Bacteria 3292
210 Ga0207704_10000028 3300025938 Bacteria 122144
211 Ga0207689_11779697 3300025942 Bacteria 509
212 Ga0207661_10510789 3300025944 Unclassified 1098
213 Ga0207667_10000033 3300025949 Bacteria 314353
214 Ga0207667_10006450 3300025949 Bacteria 14200
215 Ga0207667_10097474 3300025949 Bacteria 3035
216 Ga0207667_10100097 3300025949 Bacteria 2990
217 Ga0207667_10164572 3300025949 Bacteria 2281
218 Ga0207667_11568247 3300025949 Bacteria 628
219 Ga0207667_12083312 3300025949 Bacteria 526
220 Ga0207651_10013605 3300025960 Bacteria 4663
221 Ga0207651_11629148 3300025960 Unclassified 581
222 Ga0207677_10003962 3300026023 Bacteria 7890
223 Ga0207639_10014276 3300026041 Bacteria 5580
224 Ga0207639_10037757 3300026041 Bacteria 3590
225 Ga0207678_10018264 3300026067 Bacteria 6158
226 Ga0207702_10040749 3300026078 Bacteria 3893
227 Ga0207702_10531557 3300026078 Bacteria 1149
228 Ga0207702_11188587 3300026078 Bacteria 757
229 Ga0207648_10006336 3300026089 Bacteria 11766
230 Ga0207674_10013951 3300026116 Bacteria 8888
231 Ga0207674_10648236 3300026116 Bacteria 1020
232 Ga0207683_10006779 3300026121 Bacteria 9804
233 Ga0207683_10499177 3300026121 Bacteria 1124
234 Ga0207698_10033528 3300026142 Bacteria 3732
235 Ga0268266_10000053 3300028379 Bacteria 295181
236 Ga0307517_10024827 3300028786 Bacteria 7360
237 Ga0265338_10074593 3300028800 Bacteria 2884
238 Ga0316183_1134560 3300030742 Bacteria 13366
239 Ga0316181_1166451 3300030744 Bacteria 615
240 Ga0316181_1167506 3300030744 Bacteria 16152
241 Ga0265327_10005705 3300031251 Bacteria 10273
242 Ga0307408_100001246 3300031548 Bacteria 19110
243 Ga0307408_100001545 3300031548 Bacteria 17060
244 Ga0307408_100032561 3300031548 Bacteria 3635
245 Ga0307412_10000490 3300031911 Bacteria 23654
246 Ga0307414_12059816 3300032004 Bacteria 533
247 Ga0307510_10013839 3300033180 Bacteria 9560
248 Ga0373923_0331243 3300035111 Unclassified 724
249 Ga0373941_0012566 3300035115 Bacteria 2217
250 Ga0395899_0000237 3300037312 Bacteria 74249
251 Ga0395899_0000453 3300037312 Bacteria 46699
252 Ga0395899_0002538 3300037312 Bacteria 14791
253 Ga0395899_0022066 3300037312 Bacteria 4828
254 Ga0395899_0208559 3300037312 Bacteria 1359
255 Ga0395900_0000431 3300037418 Bacteria 60172
256 Ga0395900_0038965 3300037418 Bacteria 4899
257 Ga0395900_0334235 3300037418 Bacteria 1492
258 Ga0395898_0027065 3300037466 Bacteria 5761
259 Ga0395905_0001649 3300037471 Bacteria 26382
260 Ga0395905_0009670 3300037471 Bacteria 9412
261 Ga0395901_0001158 3300038443 Bacteria 28004
262 Ga0395901_0039100 3300038443 Bacteria 4909
263 Ga0395901_0041273 3300038443 Bacteria 4781
264 Ga0395901_0389006 3300038443 Bacteria 1434
265 Ga0436361_0358981 3300039447 Bacteria 6265
266 Ga0439436_0082463 3300041404 Bacteria 895
267 Ga0451789_1067397 3300041443 Bacteria 686
268 Ga0451793_0309094 3300041452 Bacteria 552
269 Ga0451793_1848691 3300041452 Bacteria 715
270 Ga0451841_1095603 3300041498 Bacteria 866
271 Ga0439448_0004511 3300042005 Bacteria 3932
272 Ga0439455_0027085 3300042012 Bacteria 1403
273 Ga0466966_0086008 3300044684 Bacteria 1954
274 Ga0466957_0236904 3300044842 Bacteria 1210
275 Ga0466959_0179400 3300045049 Bacteria 1482
276 Ga0466959_0696563 3300045049 Bacteria 681
277 Ga0495638_0206681 3300046460 Bacteria 1105
278 Ga0495650_0000023 3300046471 Bacteria 527763
279 Ga0495650_0046826 3300046471 Bacteria 1812
280 Ga0495585_0000629 3300046492 Bacteria 32624
281 Ga0495607_0163460 3300046501 Bacteria 1129
282 Ga0495606_0000448 3300046507 Bacteria 67282
283 Ga0495606_0008544 3300046507 Bacteria 8869
284 Ga0495606_0346556 3300046507 Bacteria 790
285 Ga0495610_0001664 3300046512 Bacteria 19541
286 Ga0495616_0001269 3300046513 Bacteria 17736
287 Ga0495616_0008922 3300046513 Bacteria 5892
288 Ga0495632_0139120 3300046519 Bacteria 1127
289 Ga0495637_0088684 3300046520 Bacteria 1223
290 Ga0495637_0116533 3300046520 Bacteria 1031
291 Ga0495644_0020392 3300046523 Bacteria 2529
292 Ga0495648_0068323 3300046524 Bacteria 2074
293 Ga0495652_0418287 3300046529 Bacteria 945
294 Ga0495654_0160464 3300046530 Bacteria 987
295 Ga0495609_0036292 3300046538 Bacteria 2226
296 Ga0495633_0004222 3300046558 Bacteria 9203
297 Ga0495625_0000018 3300046660 Bacteria 299567
298 Ga0495625_0012435 3300046660 Bacteria 6896
299 Ga0495625_0051947 3300046660 Bacteria 2936
300 Ga0495625_0069096 3300046660 Bacteria 2482
301 Ga0495625_0109983 3300046660 Bacteria 1884
302 Ga0495625_0517336 3300046660 Bacteria 727
303 Ga0495661_0001731 3300046665 Bacteria 17639
304 Ga0495661_0090361 3300046665 Bacteria 1743
305 Ga0495669_0242627 3300046684 Bacteria 865
306 Ga0495670_0409068 3300046691 Bacteria 733
307 Ga0495671_0131137 3300046692 Bacteria 1222
308 Ga0495649_0000015 3300046694 Bacteria 246431
309 Ga0495649_0467099 3300046694 Bacteria 629
310 Ga0495660_0007525 3300046810 Bacteria 6393
311 Ga0495683_0009041 3300047323 Bacteria 5310
312 Ga0495687_006209 3300047443 Bacteria 7379
313 Ga0495687_011194 3300047443 Bacteria 4841
314 Ga0495673_0042298 3300047469 Bacteria 2046
315 Ga0495686_0000303 3300047472 Bacteria 84544
316 Ga0495686_0005200 3300047472 Bacteria 10358
317 Ga0495686_0195064 3300047472 Bacteria 1165
318 Ga0495686_0389593 3300047472 Bacteria 750
319 Ga0495686_0546569 3300047472 Bacteria 605
320 Ga0496105_1079430 3300048908 Bacteria 597
321 nmdc:mga0k408_4057_c1 3300050493 Bacteria 7768
322 nmdc:mga0k408_52982_c1 3300050493 Bacteria 2351
323 nmdc:mga0k408_59224_c1 3300050493 Bacteria 2225
324 nmdc:mga07m45_201033_c1 3300050496 Bacteria 1159
325 nmdc:mga07m45_289242_c1 3300050496 Bacteria 953
326 Ga0500650_0347714 3300053098 Bacteria 649
327 Ga0500608_007517 3300053122 Bacteria 4515
328 Ga0500618_040265 3300053125 Bacteria 1074
329 Ga0500642_0088644 3300053130 Bacteria 1428
330 Ga0500573_0144382 3300053140 Bacteria 1308
331 Ga0500579_132437 3300053143 Bacteria 1160
332 Ga0500622_0000860 3300053156 Bacteria 25927
333 Ga0500634_0142485 3300053161 Bacteria 1133

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2519899754 2520879562 117
2 iso_pu_bacteria 2599185184 2599479212 117
3 iso_pu_bacteria 2643221716 2644643906 117
4 iso_pu_bacteria 2816332280 2817413519 117
5 iso_pu_bacteria 2852623160 2852627040 117
6 iso_pu_bacteria 2884933994 2884935228 117
7 iso_pu_bacteria 2919437846 2919439264 117
8 iso_pu_bacteria 2928078545 2928082472 117
9 iso_pu_bacteria 2928147474 2928148940 117
10 iso_pu_bacteria 2958458903 2958461972 117
11 iso_pu_bacteria 8055419101 8055423554 117
12 3300037312 Ga0395899_0208559 Ga0395899_0208559_128_493 118
13 3300038443 Ga0395901_0389006 Ga0395901_0389006_78_443 118
14 3300053161 Ga0500634_0142485 Ga0500634_0142485_689_1045 118
15 3300013306 Ga0163162_12697872 Ga0163162_126978721 119
16 3300025261 Ga0209233_1034296 Ga0209233_10342962 119
17 3300030742 Ga0316183_1134560 Ga0316183_11345602 119
18 3300030744 Ga0316181_1166451 Ga0316181_11664511 119
19 3300030744 Ga0316181_1167506 Ga0316181_11675068 119
20 3300031251 Ga0265327_10005705 Ga0265327_100057055 119
21 3300031548 Ga0307408_100001246 Ga0307408_1000012462 119
22 3300031548 Ga0307408_100032561 Ga0307408_1000325612 119
23 3300031911 Ga0307412_10000490 Ga0307412_1000049020 119
24 3300032004 Ga0307414_12059816 Ga0307414_120598161 119
25 3300041404 Ga0439436_0082463 Ga0439436_0082463_20_379 119
26 3300041498 Ga0451841_1095603 Ga0451841_1095603_325_684 119
27 3300002737 JGI25162J39368_1000150 JGI25162J39368_10001503 120
28 3300002772 JGI25164J39214_1001658 JGI25164J39214_10016583 120
29 3300003214 JGI25165J46597_1000456 JGI25165J46597_100045622 120
30 3300005563 Ga0068855_100000060 Ga0068855_10000006074 120
31 3300009093 Ga0105240_10346025 Ga0105240_103460252 120
32 3300009093 Ga0105240_11714068 Ga0105240_117140682 120
33 3300009545 Ga0105237_10000465 Ga0105237_1000046552 120
34 3300021361 Ga0213872_10033831 Ga0213872_100338312 120
35 3300025230 Ga0209563_104816 Ga0209563_1048163 120
36 3300025231 Ga0207427_100083 Ga0207427_10008380 120
37 3300025233 Ga0209437_100021 Ga0209437_100021339 120
38 3300025261 Ga0209233_1000035 Ga0209233_1000035299 120
39 3300025914 Ga0207671_10008704 Ga0207671_100087048 120
40 3300025949 Ga0207667_10000033 Ga0207667_10000033215 120
41 3300028786 Ga0307517_10024827 Ga0307517_100248273 120
42 3300031548 Ga0307408_100001545 Ga0307408_10000154512 120
43 3300037312 Ga0395899_0000237 Ga0395899_0000237_71239_71601 120
44 3300039447 Ga0436361_0358981 Ga0436361_0358981_1889_2251 120
45 3300001904 JGI24736J21556_1002620 JGI24736J21556_10026203 121
46 3300001904 JGI24736J21556_1011537 JGI24736J21556_10115372 121
47 3300001979 JGI24740J21852_10119106 JGI24740J21852_101191061 121
48 3300001989 JGI24739J22299_10000787 JGI24739J22299_100007873 121
49 3300001990 JGI24737J22298_10015417 JGI24737J22298_100154173 121
50 3300001990 JGI24737J22298_10017618 JGI24737J22298_100176181 121
51 3300002077 JGI24744J21845_10009032 JGI24744J21845_100090323 121
52 3300002737 JGI25162J39368_1000682 JGI25162J39368_10006823 121
53 3300002741 JGI25157J39369_1012095 JGI25157J39369_10120952 121
54 3300003316 rootH1_10045740 rootH1_100457403 121
55 3300003320 rootH2_10018482 rootH2_100184825 121
56 3300003320 rootH2_10043869 rootH2_100438695 121
57 3300003320 rootH2_10241331 rootH2_102413315 121
58 3300003322 rootL2_10012952 rootL2_100129527 121
59 3300003323 rootH1_10012978 rootH1_1001297810 121
60 3300003323 rootH1_10068572 rootH1_100685723 121
61 3300004799 Ga0058863_11859864 Ga0058863_118598643 121
62 3300004800 Ga0058861_10005061 Ga0058861_100050612 121
63 3300004803 Ga0058862_10002974 Ga0058862_100029743 121
64 3300005327 Ga0070658_10000290 Ga0070658_1000029032 121
65 3300005327 Ga0070658_10014613 Ga0070658_100146134 121
66 3300005327 Ga0070658_10254941 Ga0070658_102549412 121
67 3300005327 Ga0070658_10285178 Ga0070658_102851782 121
68 3300005328 Ga0070676_10007187 Ga0070676_100071874 121
69 3300005334 Ga0068869_102084352 Ga0068869_1020843521 121
70 3300005336 Ga0070680_100617808 Ga0070680_1006178082 121
71 3300005338 Ga0068868_100008686 Ga0068868_1000086867 121
72 3300005339 Ga0070660_100051500 Ga0070660_1000515002 121
73 3300005339 Ga0070660_100283666 Ga0070660_1002836662 121
74 3300005344 Ga0070661_101409714 Ga0070661_1014097141 121
75 3300005355 Ga0070671_100312180 Ga0070671_1003121802 121
76 3300005364 Ga0070673_100008632 Ga0070673_1000086326 121
77 3300005364 Ga0070673_101799577 Ga0070673_1017995771 121
78 3300005365 Ga0070688_100236922 Ga0070688_1002369222 121
79 3300005366 Ga0070659_100011510 Ga0070659_1000115104 121
80 3300005366 Ga0070659_100026245 Ga0070659_1000262452 121
81 3300005366 Ga0070659_101129164 Ga0070659_1011291641 121
82 3300005366 Ga0070659_101318431 Ga0070659_1013184311 121
83 3300005455 Ga0070663_100003848 Ga0070663_1000038488 121
84 3300005456 Ga0070678_100017640 Ga0070678_1000176403 121
85 3300005456 Ga0070678_100945068 Ga0070678_1009450681 121
86 3300005457 Ga0070662_100002313 Ga0070662_1000023133 121
87 3300005458 Ga0070681_10073517 Ga0070681_100735174 121
88 3300005459 Ga0068867_100008159 Ga0068867_1000081596 121
89 3300005530 Ga0070679_100021503 Ga0070679_1000215033 121
90 3300005530 Ga0070679_100133450 Ga0070679_1001334503 121
91 3300005535 Ga0070684_100762665 Ga0070684_1007626652 121
92 3300005539 Ga0068853_100018436 Ga0068853_1000184364 121
93 3300005539 Ga0068853_100065627 Ga0068853_1000656273 121
94 3300005539 Ga0068853_102110909 Ga0068853_1021109091 121
95 3300005543 Ga0070672_100086704 Ga0070672_1000867043 121
96 3300005548 Ga0070665_100000061 Ga0070665_1000000614 121
97 3300005563 Ga0068855_100008684 Ga0068855_1000086844 121
98 3300005563 Ga0068855_100015461 Ga0068855_1000154616 121
99 3300005563 Ga0068855_100028189 Ga0068855_1000281897 121
100 3300005563 Ga0068855_100077275 Ga0068855_1000772753 121
101 3300005563 Ga0068855_100621632 Ga0068855_1006216322 121
102 3300005563 Ga0068855_101041132 Ga0068855_1010411322 121
103 3300005577 Ga0068857_100018920 Ga0068857_1000189205 121
104 3300005578 Ga0068854_101389424 Ga0068854_1013894242 121
105 3300005614 Ga0068856_100064206 Ga0068856_1000642063 121
106 3300005614 Ga0068856_100099223 Ga0068856_1000992233 121
107 3300005614 Ga0068856_100180721 Ga0068856_1001807213 121
108 3300005616 Ga0068852_100013694 Ga0068852_1000136944 121
109 3300005616 Ga0068852_102041847 Ga0068852_1020418472 121
110 3300006195 Ga0075366_10004089 Ga0075366_100040895 121
111 3300006195 Ga0075366_10015152 Ga0075366_100151525 121
112 3300006195 Ga0075366_10055938 Ga0075366_100559383 121
113 3300006195 Ga0075366_10616068 Ga0075366_106160681 121
114 3300006237 Ga0097621_100003881 Ga0097621_1000038817 121
115 3300006237 Ga0097621_100011606 Ga0097621_1000116063 121
116 3300006237 Ga0097621_101787321 Ga0097621_1017873211 121
117 3300006353 Ga0075370_10368970 Ga0075370_103689701 121
118 3300006358 Ga0068871_100000622 Ga0068871_10000062220 121
119 3300006881 Ga0068865_100007507 Ga0068865_1000075076 121
120 3300009093 Ga0105240_10000075 Ga0105240_100000753 121
121 3300009093 Ga0105240_10146673 Ga0105240_101466733 121
122 3300009093 Ga0105240_10149150 Ga0105240_101491502 121
123 3300009093 Ga0105240_10183733 Ga0105240_101837332 121
124 3300009093 Ga0105240_10235633 Ga0105240_102356332 121
125 3300009093 Ga0105240_10299112 Ga0105240_102991122 121
126 3300009093 Ga0105240_10638091 Ga0105240_106380912 121
127 3300009098 Ga0105245_12409064 Ga0105245_124090641 121
128 3300009174 Ga0105241_10004575 Ga0105241_100045754 121
129 3300009174 Ga0105241_10009106 Ga0105241_100091064 121
130 3300009174 Ga0105241_12041653 Ga0105241_120416531 121
131 3300009176 Ga0105242_10014527 Ga0105242_100145274 121
132 3300009545 Ga0105237_10021544 Ga0105237_100215442 121
133 3300009545 Ga0105237_10023198 Ga0105237_100231983 121
134 3300009545 Ga0105237_10024810 Ga0105237_100248105 121
135 3300009545 Ga0105237_10059947 Ga0105237_100599473 121
136 3300009545 Ga0105237_10163403 Ga0105237_101634033 121
137 3300009545 Ga0105237_10270644 Ga0105237_102706441 121
138 3300009545 Ga0105237_11005134 Ga0105237_110051341 121
139 3300009545 Ga0105237_11704081 Ga0105237_117040812 121
140 3300009551 Ga0105238_10030758 Ga0105238_100307583 121
141 3300009551 Ga0105238_10084640 Ga0105238_100846402 121
142 3300009551 Ga0105238_10132855 Ga0105238_101328553 121
143 3300009553 Ga0105249_11961013 Ga0105249_119610132 121
144 3300010375 Ga0105239_10000142 Ga0105239_1000014269 121
145 3300010375 Ga0105239_10000286 Ga0105239_1000028667 121
146 3300010375 Ga0105239_10002242 Ga0105239_100022424 121
147 3300010375 Ga0105239_10061479 Ga0105239_100614793 121
148 3300010375 Ga0105239_10093649 Ga0105239_100936493 121
149 3300010375 Ga0105239_10218862 Ga0105239_102188623 121
150 3300010375 Ga0105239_10266701 Ga0105239_102667012 121
151 3300010375 Ga0105239_11997877 Ga0105239_119978771 121
152 3300011119 Ga0105246_10058473 Ga0105246_100584733 121
153 3300011119 Ga0105246_11538610 Ga0105246_115386102 121
154 3300011119 Ga0105246_12371139 Ga0105246_123711392 121
155 3300013100 Ga0157373_10010316 Ga0157373_100103161 121
156 3300013100 Ga0157373_10043610 Ga0157373_100436104 121
157 3300013102 Ga0157371_10004409 Ga0157371_1000440911 121
158 3300013102 Ga0157371_10006549 Ga0157371_100065496 121
159 3300013102 Ga0157371_10022996 Ga0157371_100229962 121
160 3300013102 Ga0157371_10050979 Ga0157371_100509793 121
161 3300013104 Ga0157370_10016076 Ga0157370_100160763 121
162 3300013105 Ga0157369_10005466 Ga0157369_100054663 121
163 3300013105 Ga0157369_10092230 Ga0157369_100922301 121
164 3300013105 Ga0157369_10098521 Ga0157369_100985213 121
165 3300013105 Ga0157369_10171562 Ga0157369_101715621 121
166 3300013296 Ga0157374_10000125 Ga0157374_100001253 121
167 3300013296 Ga0157374_10014844 Ga0157374_100148443 121
168 3300013296 Ga0157374_10057423 Ga0157374_100574233 121
169 3300013296 Ga0157374_10350016 Ga0157374_103500162 121
170 3300013296 Ga0157374_11552207 Ga0157374_115522072 121
171 3300013297 Ga0157378_10038747 Ga0157378_100387473 121
172 3300013297 Ga0157378_10619070 Ga0157378_106190702 121
173 3300013297 Ga0157378_12332336 Ga0157378_123323362 121
174 3300013297 Ga0157378_12947592 Ga0157378_129475921 121
175 3300013306 Ga0163162_10000087 Ga0163162_100000874 121
176 3300013306 Ga0163162_10002647 Ga0163162_100026478 121
177 3300013306 Ga0163162_10003764 Ga0163162_100037649 121
178 3300013306 Ga0163162_10009160 Ga0163162_100091603 121
179 3300013306 Ga0163162_10562771 Ga0163162_105627711 121
180 3300013307 Ga0157372_10000048 Ga0157372_100000482 121
181 3300013307 Ga0157372_10000354 Ga0157372_1000035436 121
182 3300013307 Ga0157372_10001314 Ga0157372_100013142 121
183 3300013307 Ga0157372_10045070 Ga0157372_100450701 121
184 3300013307 Ga0157372_10717860 Ga0157372_107178602 121
185 3300013308 Ga0157375_10036705 Ga0157375_100367053 121
186 3300013308 Ga0157375_10041878 Ga0157375_100418786 121
187 3300013308 Ga0157375_10195776 Ga0157375_101957762 121
188 3300013308 Ga0157375_10433204 Ga0157375_104332042 121
189 3300014325 Ga0163163_10947890 Ga0163163_109478902 121
190 3300014745 Ga0157377_10012454 Ga0157377_100124543 121
191 3300014968 Ga0157379_12497885 Ga0157379_124978851 121
192 3300014969 Ga0157376_10134745 Ga0157376_101347453 121
193 3300014969 Ga0157376_10168043 Ga0157376_101680431 121
194 3300014969 Ga0157376_11155455 Ga0157376_111554551 121
195 3300015262 Ga0182007_10027883 Ga0182007_100278833 121
196 3300017792 Ga0163161_10915819 Ga0163161_109158191 121
197 3300020078 Ga0206352_11264405 Ga0206352_112644052 121
198 3300020610 Ga0154015_1678080 Ga0154015_16780802 121
199 3300025231 Ga0207427_116069 Ga0207427_1160691 121
200 3300025233 Ga0209437_100230 Ga0209437_10023085 121
201 3300025250 Ga0209026_1001689 Ga0209026_10016899 121
202 3300025250 Ga0209026_1002250 Ga0209026_10022502 121
203 3300025250 Ga0209026_1010077 Ga0209026_10100771 121
204 3300025258 Ga0209129_1067783 Ga0209129_10677831 121
205 3300025261 Ga0209233_1001672 Ga0209233_10016728 121
206 3300025904 Ga0207647_10001052 Ga0207647_1000105211 121
207 3300025904 Ga0207647_10001219 Ga0207647_100012193 121
208 3300025904 Ga0207647_10107368 Ga0207647_101073683 121
209 3300025904 Ga0207647_10564393 Ga0207647_105643932 121
210 3300025907 Ga0207645_10013463 Ga0207645_100134634 121
211 3300025909 Ga0207705_10000317 Ga0207705_1000031732 121
212 3300025909 Ga0207705_10114968 Ga0207705_101149683 121
213 3300025909 Ga0207705_10214358 Ga0207705_102143582 121
214 3300025911 Ga0207654_10002795 Ga0207654_100027953 121
215 3300025911 Ga0207654_10020832 Ga0207654_100208324 121
216 3300025911 Ga0207654_10031005 Ga0207654_100310053 121
217 3300025912 Ga0207707_10194355 Ga0207707_101943552 121
218 3300025913 Ga0207695_10000235 Ga0207695_10000235131 121
219 3300025913 Ga0207695_10020240 Ga0207695_100202406 121
220 3300025913 Ga0207695_10106983 Ga0207695_101069834 121
221 3300025913 Ga0207695_10187243 Ga0207695_101872432 121
222 3300025913 Ga0207695_10374708 Ga0207695_103747082 121
223 3300025914 Ga0207671_10012357 Ga0207671_100123573 121
224 3300025914 Ga0207671_10014468 Ga0207671_100144685 121
225 3300025914 Ga0207671_10023453 Ga0207671_100234534 121
226 3300025914 Ga0207671_10068327 Ga0207671_100683272 121
227 3300025914 Ga0207671_10747189 Ga0207671_107471891 121
228 3300025917 Ga0207660_11368600 Ga0207660_113686001 121
229 3300025919 Ga0207657_10057532 Ga0207657_100575323 121
230 3300025921 Ga0207652_10089566 Ga0207652_100895663 121
231 3300025924 Ga0207694_10021769 Ga0207694_100217694 121
232 3300025924 Ga0207694_10161672 Ga0207694_101616723 121
233 3300025924 Ga0207694_10240113 Ga0207694_102401132 121
234 3300025931 Ga0207644_10422374 Ga0207644_104223742 121
235 3300025932 Ga0207690_10010109 Ga0207690_100101092 121
236 3300025932 Ga0207690_10349341 Ga0207690_103493411 121
237 3300025933 Ga0207706_10000009 Ga0207706_100000093 121
238 3300025934 Ga0207686_10028323 Ga0207686_100283234 121
239 3300025938 Ga0207704_10000028 Ga0207704_100000285 121
240 3300025942 Ga0207689_11779697 Ga0207689_117796971 121
241 3300025944 Ga0207661_10510789 Ga0207661_105107891 121
242 3300025949 Ga0207667_10006450 Ga0207667_100064502 121
243 3300025949 Ga0207667_10097474 Ga0207667_100974742 121
244 3300025949 Ga0207667_10100097 Ga0207667_101000973 121
245 3300025949 Ga0207667_10164572 Ga0207667_101645722 121
246 3300025949 Ga0207667_11568247 Ga0207667_115682471 121
247 3300025949 Ga0207667_12083312 Ga0207667_120833121 121
248 3300025960 Ga0207651_10013605 Ga0207651_100136056 121
249 3300025960 Ga0207651_11629148 Ga0207651_116291481 121
250 3300026023 Ga0207677_10003962 Ga0207677_100039626 121
251 3300026041 Ga0207639_10014276 Ga0207639_100142766 121
252 3300026041 Ga0207639_10037757 Ga0207639_100377573 121
253 3300026067 Ga0207678_10018264 Ga0207678_100182648 121
254 3300026078 Ga0207702_10040749 Ga0207702_100407493 121
255 3300026078 Ga0207702_10531557 Ga0207702_105315572 121
256 3300026078 Ga0207702_11188587 Ga0207702_111885871 121
257 3300026089 Ga0207648_10006336 Ga0207648_100063368 121
258 3300026116 Ga0207674_10013951 Ga0207674_100139513 121
259 3300026116 Ga0207674_10648236 Ga0207674_106482362 121
260 3300026121 Ga0207683_10006779 Ga0207683_100067797 121
261 3300026121 Ga0207683_10499177 Ga0207683_104991772 121
262 3300026142 Ga0207698_10033528 Ga0207698_100335283 121
263 3300028379 Ga0268266_10000053 Ga0268266_10000053195 121
264 3300028800 Ga0265338_10074593 Ga0265338_100745932 121
265 3300033180 Ga0307510_10013839 Ga0307510_100138393 121
266 3300035111 Ga0373923_0331243 Ga0373923_0331243_177_548 121
267 3300035115 Ga0373941_0012566 Ga0373941_0012566_528_893 121
268 3300037312 Ga0395899_0000453 Ga0395899_0000453_2406_2771 121
269 3300037312 Ga0395899_0002538 Ga0395899_0002538_2602_2967 121
270 3300037312 Ga0395899_0022066 Ga0395899_0022066_1522_1887 121
271 3300037418 Ga0395900_0000431 Ga0395900_0000431_57205_57570 121
272 3300037418 Ga0395900_0038965 Ga0395900_0038965_2342_2707 121
273 3300037418 Ga0395900_0334235 Ga0395900_0334235_641_1057 121
274 3300037466 Ga0395898_0027065 Ga0395898_0027065_2866_3231 121
275 3300037471 Ga0395905_0001649 Ga0395905_0001649_23415_23780 121
276 3300037471 Ga0395905_0009670 Ga0395905_0009670_2459_2824 121
277 3300038443 Ga0395901_0001158 Ga0395901_0001158_3007_3372 121
278 3300038443 Ga0395901_0039100 Ga0395901_0039100_1699_2115 121
279 3300038443 Ga0395901_0041273 Ga0395901_0041273_2331_2696 121
280 3300041443 Ga0451789_1067397 Ga0451789_1067397_93_458 121
281 3300041452 Ga0451793_0309094 Ga0451793_0309094_31_396 121
282 3300041452 Ga0451793_1848691 Ga0451793_1848691_19_384 121
283 3300042005 Ga0439448_0004511 Ga0439448_0004511_2192_2557 121
284 3300042012 Ga0439455_0027085 Ga0439455_0027085_249_614 121
285 3300044684 Ga0466966_0086008 Ga0466966_0086008_1478_1843 121
286 3300044842 Ga0466957_0236904 Ga0466957_0236904_508_873 121
287 3300045049 Ga0466959_0179400 Ga0466959_0179400_891_1256 121
288 3300045049 Ga0466959_0696563 Ga0466959_0696563_152_517 121
289 3300046460 Ga0495638_0206681 Ga0495638_0206681_43_408 121
290 3300046471 Ga0495650_0000023 Ga0495650_0000023_414677_415042 121
291 3300046471 Ga0495650_0046826 Ga0495650_0046826_374_739 121
292 3300046492 Ga0495585_0000629 Ga0495585_0000629_17406_17771 121
293 3300046501 Ga0495607_0163460 Ga0495607_0163460_459_824 121
294 3300046507 Ga0495606_0000448 Ga0495606_0000448_21113_21478 121
295 3300046507 Ga0495606_0008544 Ga0495606_0008544_7391_7756 121
296 3300046507 Ga0495606_0346556 Ga0495606_0346556_81_446 121
297 3300046512 Ga0495610_0001664 Ga0495610_0001664_16001_16366 121
298 3300046513 Ga0495616_0001269 Ga0495616_0001269_1925_2290 121
299 3300046513 Ga0495616_0008922 Ga0495616_0008922_4444_4809 121
300 3300046519 Ga0495632_0139120 Ga0495632_0139120_625_990 121
301 3300046520 Ga0495637_0088684 Ga0495637_0088684_291_656 121
302 3300046520 Ga0495637_0116533 Ga0495637_0116533_583_948 121
303 3300046523 Ga0495644_0020392 Ga0495644_0020392_801_1166 121
304 3300046524 Ga0495648_0068323 Ga0495648_0068323_397_762 121
305 3300046529 Ga0495652_0418287 Ga0495652_0418287_257_622 121
306 3300046530 Ga0495654_0160464 Ga0495654_0160464_140_505 121
307 3300046538 Ga0495609_0036292 Ga0495609_0036292_384_749 121
308 3300046558 Ga0495633_0004222 Ga0495633_0004222_7258_7623 121
309 3300046660 Ga0495625_0000018 Ga0495625_0000018_128067_128432 121
310 3300046660 Ga0495625_0012435 Ga0495625_0012435_1894_2259 121
311 3300046660 Ga0495625_0051947 Ga0495625_0051947_1580_1945 121
312 3300046660 Ga0495625_0069096 Ga0495625_0069096_1109_1474 121
313 3300046660 Ga0495625_0109983 Ga0495625_0109983_1310_1675 121
314 3300046660 Ga0495625_0517336 Ga0495625_0517336_207_572 121
315 3300046665 Ga0495661_0001731 Ga0495661_0001731_17012_17377 121
316 3300046665 Ga0495661_0090361 Ga0495661_0090361_1113_1478 121
317 3300046684 Ga0495669_0242627 Ga0495669_0242627_26_391 121
318 3300046691 Ga0495670_0409068 Ga0495670_0409068_163_528 121
319 3300046692 Ga0495671_0131137 Ga0495671_0131137_539_904 121
320 3300046694 Ga0495649_0000015 Ga0495649_0000015_56568_56933 121
321 3300046694 Ga0495649_0467099 Ga0495649_0467099_81_446 121
322 3300046810 Ga0495660_0007525 Ga0495660_0007525_945_1310 121
323 3300047323 Ga0495683_0009041 Ga0495683_0009041_4110_4475 121
324 3300047443 Ga0495687_006209 Ga0495687_006209_3966_4331 121
325 3300047443 Ga0495687_011194 Ga0495687_011194_1790_2155 121
326 3300047469 Ga0495673_0042298 Ga0495673_0042298_756_1121 121
327 3300047472 Ga0495686_0000303 Ga0495686_0000303_82272_82637 121
328 3300047472 Ga0495686_0005200 Ga0495686_0005200_6641_7006 121
329 3300047472 Ga0495686_0195064 Ga0495686_0195064_57_422 121
330 3300047472 Ga0495686_0389593 Ga0495686_0389593_207_572 121
331 3300047472 Ga0495686_0546569 Ga0495686_0546569_214_579 121
332 3300048908 Ga0496105_1079430 Ga0496105_1079430_140_511 121
333 3300050493 nmdc:mga0k408_4057_c1 nmdc:mga0k408_4057_c1_2770_3135 121
334 3300050493 nmdc:mga0k408_52982_c1 nmdc:mga0k408_52982_c1_1739_2104 121
335 3300050493 nmdc:mga0k408_59224_c1 nmdc:mga0k408_59224_c1_1265_1630 121
336 3300050496 nmdc:mga07m45_201033_c1 nmdc:mga07m45_201033_c1_138_503 121
337 3300050496 nmdc:mga07m45_289242_c1 nmdc:mga07m45_289242_c1_244_609 121
338 3300053098 Ga0500650_0347714 Ga0500650_0347714_25_390 121
339 3300053122 Ga0500608_007517 Ga0500608_007517_2994_3359 121
340 3300053125 Ga0500618_040265 Ga0500618_040265_293_658 121
341 3300053130 Ga0500642_0088644 Ga0500642_0088644_787_1152 121
342 3300053140 Ga0500573_0144382 Ga0500573_0144382_94_459 121
343 3300053143 Ga0500579_132437 Ga0500579_132437_337_702 121
344 3300053156 Ga0500622_0000860 Ga0500622_0000860_17939_18304 121

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13380

CoA_binding_2

CoA binding domain

27

140

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
3ff4-assembly1.cif.gz_A crystal structure of uncharacterized protein chu_1412 0.9805 1 121
2d5a-assembly1.cif.gz_A hypothetical protein from pyrococcus horikoshii ot3 0.8934 2 112
1y81-assembly1.cif.gz_A conserved hypothetical protein pfu-723267-001 from pyrococcus furiosus 0.8806 4 114
3qa9-assembly1.cif.gz_A crystal structure of prb (ph1109 protein redesigned for binding) 0.8719 2 121
1iul-assembly1.cif.gz_A the structure of cell-free id.343 from thermus thermophilus 0.8704 3 121
ID Description Score Start End Superfamily
3ff4A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9748 2 121 3.40.50.720
3ff4A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9668 2 121 3.40.50.720
1iulA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8704 3 121 3.40.50.720
1y81A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8682 4 114 3.40.50.720
1iulA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8506 3 121 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A7K0FT10-F1-model_v4 CoA-binding protein 1.004 4 121
AF-A0A4Q6AXN0-F1-model_v4 CoA-binding protein 1.003 1 121
AF-A0A0F8YEY5-F1-model_v4 CoA-binding domain-containing protein 0.9983 61 121
AF-A0A4R1LXK8-F1-model_v4 CoA-binding domain-containing protein 0.9972 8 121
AF-A0A520CTC5-F1-model_v4 CoA-binding protein 0.9966 4 64

Feature Viewer

pLDDT pTM Quality
97.56 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map