F415821
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 344 | 183 | 333 | 121 |
Family's Representative Sequence
| Representative Sequence | 3300004800|Ga0058861_10005061|Ga0058861_100050612 |
| Length | 144 |
| Sequence | VITPIVGVIGEITNKSVKSKNKGMADKKTLVLGATPNPARYAYLAANRLARNGHSIVNVGLKKGEVAGVAIEKPETIHHDIDTITLYVGPQHQPELYDYILNTHPKRIIFNPGTENSELRRMANENGIETEYACTLVLLSIGEY |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2519899754 | Flavobacterium sp. F52 | Isolate | Rhizosphere |
| 2 | 2599185184 | Mucilaginibacter sp. NFR10 | Isolate | Rhizoplane |
| 3 | 2643221716 | Flavobacterium sp. Root901 | Isolate | Unclassified |
| 4 | 2816332280 | Flavobacterium johnsoniae GSE09 | Isolate | Unclassified |
| 5 | 2852623160 | Mucilaginibacter sp. AK015 | Isolate | Rhizosphere |
| 6 | 2884933994 | Mucilaginibacter sp. 14171R-50 | Isolate | Rhizosphere |
| 7 | 2919437846 | Mucilaginibacter pocheonensis 3262 | Isolate | Rhizosphere |
| 8 | 2928078545 | Mucilaginibacter rubeus 1215 | Isolate | Unclassified |
| 9 | 2928147474 | Mucilaginibacter rubeus 2025 | Isolate | Unclassified |
| 10 | 2958458903 | Flavobacterium anhuiense RCM74 | Isolate | Rhizosphere |
| 11 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 12 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 13 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 14 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 15 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 16 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 17 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 18 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 19 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 20 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 21 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 22 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 23 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 24 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 25 | 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 26 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 27 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 30 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 31 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 32 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 37 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 42 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 43 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 44 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 45 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 46 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 49 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 50 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 51 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 52 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 53 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 54 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 56 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 57 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 58 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 81 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 83 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 84 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 85 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 86 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 87 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 88 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 89 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 90 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 91 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 121 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 122 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 123 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 124 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 125 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 126 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 127 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 128 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 129 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 130 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 131 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 132 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 133 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 134 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 135 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 136 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 137 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 138 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 139 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 140 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 141 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 142 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 143 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 144 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 145 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 146 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 173 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 174 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 175 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 176 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 177 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 178 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 179 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 180 | 3300053143 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere | Metagenome | Endosphere |
| 181 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 182 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 183 | 8055419101 | Flavobacterium tyrosinilyticum KCTC 42726 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 95.35 |
| Metatranscriptomes | 1.45 |
| Isolates | 3.2 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 9.01 |
| Nodule | 0 |
| Rhizoplane | 1.45 |
| Rhizosphere | 84.3 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 5.23 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24736J21556_1002620 | 3300001904 | Bacteria | 3157 |
| 2 | JGI24736J21556_1011537 | 3300001904 | Bacteria | 1436 |
| 3 | JGI24740J21852_10119106 | 3300001979 | Bacteria | 662 |
| 4 | JGI24739J22299_10000787 | 3300001989 | Bacteria | 11576 |
| 5 | JGI24737J22298_10015417 | 3300001990 | Bacteria | 2473 |
| 6 | JGI24737J22298_10017618 | 3300001990 | Bacteria | 2299 |
| 7 | JGI24744J21845_10009032 | 3300002077 | Bacteria | 2049 |
| 8 | JGI25162J39368_1000150 | 3300002737 | Bacteria | 75945 |
| 9 | JGI25162J39368_1000682 | 3300002737 | Bacteria | 23752 |
| 10 | JGI25157J39369_1012095 | 3300002741 | Bacteria | 1103 |
| 11 | JGI25164J39214_1001658 | 3300002772 | Bacteria | 4589 |
| 12 | JGI25165J46597_1000456 | 3300003214 | Bacteria | 41124 |
| 13 | rootH1_10045740 | 3300003316 | Bacteria | 5468 |
| 14 | rootH2_10018482 | 3300003320 | Bacteria | 7697 |
| 15 | rootH2_10043869 | 3300003320 | Bacteria | 10138 |
| 16 | rootH2_10241331 | 3300003320 | Bacteria | 6262 |
| 17 | rootL2_10012952 | 3300003322 | Bacteria | 5632 |
| 18 | rootH1_10012978 | 3300003323 | Bacteria | 27481 |
| 19 | rootH1_10068572 | 3300003323 | Bacteria | 1630 |
| 20 | Ga0058863_11859864 | 3300004799 | Bacteria | 3600 |
| 21 | Ga0058861_10005061 | 3300004800 | Bacteria | 1606 |
| 22 | Ga0058862_10002974 | 3300004803 | Bacteria | 3136 |
| 23 | Ga0070658_10000290 | 3300005327 | Bacteria | 43973 |
| 24 | Ga0070658_10014613 | 3300005327 | Bacteria | 6301 |
| 25 | Ga0070658_10254941 | 3300005327 | Bacteria | 1489 |
| 26 | Ga0070658_10285178 | 3300005327 | Bacteria | 1406 |
| 27 | Ga0070676_10007187 | 3300005328 | Bacteria | 5966 |
| 28 | Ga0068869_102084352 | 3300005334 | Bacteria | 509 |
| 29 | Ga0070680_100617808 | 3300005336 | Bacteria | 931 |
| 30 | Ga0068868_100008686 | 3300005338 | Bacteria | 7275 |
| 31 | Ga0070660_100051500 | 3300005339 | Bacteria | 3171 |
| 32 | Ga0070660_100283666 | 3300005339 | Bacteria | 1355 |
| 33 | Ga0070661_101409714 | 3300005344 | Bacteria | 586 |
| 34 | Ga0070671_100312180 | 3300005355 | Bacteria | 1339 |
| 35 | Ga0070673_100008632 | 3300005364 | Bacteria | 6788 |
| 36 | Ga0070673_101799577 | 3300005364 | Unclassified | 580 |
| 37 | Ga0070688_100236922 | 3300005365 | Bacteria | 1293 |
| 38 | Ga0070659_100011510 | 3300005366 | Bacteria | 6545 |
| 39 | Ga0070659_100026245 | 3300005366 | Bacteria | 4480 |
| 40 | Ga0070659_101129164 | 3300005366 | Bacteria | 691 |
| 41 | Ga0070659_101318431 | 3300005366 | Bacteria | 640 |
| 42 | Ga0070663_100003848 | 3300005455 | Bacteria | 8740 |
| 43 | Ga0070678_100017640 | 3300005456 | Bacteria | 4604 |
| 44 | Ga0070678_100945068 | 3300005456 | Unclassified | 790 |
| 45 | Ga0070662_100002313 | 3300005457 | Bacteria | 11700 |
| 46 | Ga0070681_10073517 | 3300005458 | Bacteria | 3380 |
| 47 | Ga0068867_100008159 | 3300005459 | Bacteria | 7397 |
| 48 | Ga0070679_100021503 | 3300005530 | Bacteria | 6299 |
| 49 | Ga0070679_100133450 | 3300005530 | Bacteria | 2464 |
| 50 | Ga0070684_100762665 | 3300005535 | Bacteria | 903 |
| 51 | Ga0068853_100018436 | 3300005539 | Bacteria | 5776 |
| 52 | Ga0068853_100065627 | 3300005539 | Bacteria | 3150 |
| 53 | Ga0068853_102110909 | 3300005539 | Bacteria | 546 |
| 54 | Ga0070672_100086704 | 3300005543 | Bacteria | 2518 |
| 55 | Ga0070665_100000061 | 3300005548 | Bacteria | 222138 |
| 56 | Ga0068855_100000060 | 3300005563 | Bacteria | 133838 |
| 57 | Ga0068855_100008684 | 3300005563 | Bacteria | 12281 |
| 58 | Ga0068855_100015461 | 3300005563 | Bacteria | 9188 |
| 59 | Ga0068855_100028189 | 3300005563 | Bacteria | 6717 |
| 60 | Ga0068855_100077275 | 3300005563 | Bacteria | 3862 |
| 61 | Ga0068855_100621632 | 3300005563 | Bacteria | 1163 |
| 62 | Ga0068855_101041132 | 3300005563 | Bacteria | 858 |
| 63 | Ga0068857_100018920 | 3300005577 | Bacteria | 6043 |
| 64 | Ga0068854_101389424 | 3300005578 | Bacteria | 634 |
| 65 | Ga0068856_100064206 | 3300005614 | Bacteria | 3628 |
| 66 | Ga0068856_100099223 | 3300005614 | Bacteria | 2903 |
| 67 | Ga0068856_100180721 | 3300005614 | Bacteria | 2122 |
| 68 | Ga0068852_100013694 | 3300005616 | Bacteria | 6214 |
| 69 | Ga0068852_102041847 | 3300005616 | Bacteria | 595 |
| 70 | Ga0075366_10004089 | 3300006195 | Bacteria | 7802 |
| 71 | Ga0075366_10015152 | 3300006195 | Bacteria | 4414 |
| 72 | Ga0075366_10055938 | 3300006195 | Bacteria | 2343 |
| 73 | Ga0075366_10616068 | 3300006195 | Unclassified | 673 |
| 74 | Ga0097621_100003881 | 3300006237 | Bacteria | 10358 |
| 75 | Ga0097621_100011606 | 3300006237 | Bacteria | 6494 |
| 76 | Ga0097621_101787321 | 3300006237 | Bacteria | 586 |
| 77 | Ga0075370_10368970 | 3300006353 | Unclassified | 859 |
| 78 | Ga0068871_100000622 | 3300006358 | Bacteria | 24425 |
| 79 | Ga0068865_100007507 | 3300006881 | Bacteria | 6707 |
| 80 | Ga0105240_10000075 | 3300009093 | Bacteria | 199596 |
| 81 | Ga0105240_10146673 | 3300009093 | Bacteria | 2815 |
| 82 | Ga0105240_10149150 | 3300009093 | Bacteria | 2787 |
| 83 | Ga0105240_10183733 | 3300009093 | Bacteria | 2465 |
| 84 | Ga0105240_10235633 | 3300009093 | Bacteria | 2124 |
| 85 | Ga0105240_10299112 | 3300009093 | Bacteria | 1841 |
| 86 | Ga0105240_10346025 | 3300009093 | Bacteria | 1688 |
| 87 | Ga0105240_10638091 | 3300009093 | Bacteria | 1169 |
| 88 | Ga0105240_11714068 | 3300009093 | Bacteria | 656 |
| 89 | Ga0105245_12409064 | 3300009098 | Bacteria | 580 |
| 90 | Ga0105241_10004575 | 3300009174 | Bacteria | 10235 |
| 91 | Ga0105241_10009106 | 3300009174 | Bacteria | 7305 |
| 92 | Ga0105241_12041653 | 3300009174 | Bacteria | 565 |
| 93 | Ga0105242_10014527 | 3300009176 | Bacteria | 6101 |
| 94 | Ga0105237_10000465 | 3300009545 | Bacteria | 57393 |
| 95 | Ga0105237_10021544 | 3300009545 | Bacteria | 6626 |
| 96 | Ga0105237_10023198 | 3300009545 | Bacteria | 6361 |
| 97 | Ga0105237_10024810 | 3300009545 | Bacteria | 6135 |
| 98 | Ga0105237_10059947 | 3300009545 | Bacteria | 3807 |
| 99 | Ga0105237_10163403 | 3300009545 | Bacteria | 2225 |
| 100 | Ga0105237_10270644 | 3300009545 | Bacteria | 1702 |
| 101 | Ga0105237_11005134 | 3300009545 | Bacteria | 841 |
| 102 | Ga0105237_11704081 | 3300009545 | Bacteria | 638 |
| 103 | Ga0105238_10030758 | 3300009551 | Bacteria | 5465 |
| 104 | Ga0105238_10084640 | 3300009551 | Bacteria | 3161 |
| 105 | Ga0105238_10132855 | 3300009551 | Bacteria | 2467 |
| 106 | Ga0105249_11961013 | 3300009553 | Bacteria | 658 |
| 107 | Ga0105239_10000142 | 3300010375 | Bacteria | 101628 |
| 108 | Ga0105239_10000286 | 3300010375 | Bacteria | 74525 |
| 109 | Ga0105239_10002242 | 3300010375 | Bacteria | 24707 |
| 110 | Ga0105239_10061479 | 3300010375 | Bacteria | 4122 |
| 111 | Ga0105239_10093649 | 3300010375 | Bacteria | 3317 |
| 112 | Ga0105239_10218862 | 3300010375 | Bacteria | 2135 |
| 113 | Ga0105239_10266701 | 3300010375 | Bacteria | 1925 |
| 114 | Ga0105239_11997877 | 3300010375 | Bacteria | 673 |
| 115 | Ga0105246_10058473 | 3300011119 | Bacteria | 2671 |
| 116 | Ga0105246_11538610 | 3300011119 | Unclassified | 626 |
| 117 | Ga0105246_12371139 | 3300011119 | Unclassified | 520 |
| 118 | Ga0157373_10010316 | 3300013100 | Bacteria | 6881 |
| 119 | Ga0157373_10043610 | 3300013100 | Bacteria | 3204 |
| 120 | Ga0157371_10004409 | 3300013102 | Bacteria | 12300 |
| 121 | Ga0157371_10006549 | 3300013102 | Bacteria | 9578 |
| 122 | Ga0157371_10022996 | 3300013102 | Bacteria | 4558 |
| 123 | Ga0157371_10050979 | 3300013102 | Bacteria | 2941 |
| 124 | Ga0157370_10016076 | 3300013104 | Bacteria | 7585 |
| 125 | Ga0157369_10005466 | 3300013105 | Bacteria | 14766 |
| 126 | Ga0157369_10092230 | 3300013105 | Bacteria | 3232 |
| 127 | Ga0157369_10098521 | 3300013105 | Bacteria | 3117 |
| 128 | Ga0157369_10171562 | 3300013105 | Bacteria | 2285 |
| 129 | Ga0157374_10000125 | 3300013296 | Bacteria | 70183 |
| 130 | Ga0157374_10014844 | 3300013296 | Bacteria | 6825 |
| 131 | Ga0157374_10057423 | 3300013296 | Bacteria | 3635 |
| 132 | Ga0157374_10350016 | 3300013296 | Bacteria | 1468 |
| 133 | Ga0157374_11552207 | 3300013296 | Unclassified | 686 |
| 134 | Ga0157378_10038747 | 3300013297 | Bacteria | 4225 |
| 135 | Ga0157378_10619070 | 3300013297 | Bacteria | 1095 |
| 136 | Ga0157378_12332336 | 3300013297 | Bacteria | 587 |
| 137 | Ga0157378_12947592 | 3300013297 | Unclassified | 528 |
| 138 | Ga0163162_10000087 | 3300013306 | Bacteria | 85680 |
| 139 | Ga0163162_10002647 | 3300013306 | Bacteria | 16974 |
| 140 | Ga0163162_10003764 | 3300013306 | Bacteria | 14537 |
| 141 | Ga0163162_10009160 | 3300013306 | Bacteria | 9632 |
| 142 | Ga0163162_10562771 | 3300013306 | Bacteria | 1267 |
| 143 | Ga0163162_12697872 | 3300013306 | Bacteria | 572 |
| 144 | Ga0157372_10000048 | 3300013307 | Bacteria | 142757 |
| 145 | Ga0157372_10000354 | 3300013307 | Bacteria | 50294 |
| 146 | Ga0157372_10001314 | 3300013307 | Bacteria | 26916 |
| 147 | Ga0157372_10045070 | 3300013307 | Bacteria | 4890 |
| 148 | Ga0157372_10717860 | 3300013307 | Bacteria | 1163 |
| 149 | Ga0157375_10036705 | 3300013308 | Bacteria | 4690 |
| 150 | Ga0157375_10041878 | 3300013308 | Bacteria | 4427 |
| 151 | Ga0157375_10195776 | 3300013308 | Bacteria | 2176 |
| 152 | Ga0157375_10433204 | 3300013308 | Bacteria | 1481 |
| 153 | Ga0163163_10947890 | 3300014325 | Bacteria | 924 |
| 154 | Ga0157377_10012454 | 3300014745 | Bacteria | 4277 |
| 155 | Ga0157379_12497885 | 3300014968 | Bacteria | 516 |
| 156 | Ga0157376_10134745 | 3300014969 | Bacteria | 2209 |
| 157 | Ga0157376_10168043 | 3300014969 | Unclassified | 1995 |
| 158 | Ga0157376_11155455 | 3300014969 | Bacteria | 801 |
| 159 | Ga0182007_10027883 | 3300015262 | Bacteria | 1943 |
| 160 | Ga0163161_10915819 | 3300017792 | Bacteria | 744 |
| 161 | Ga0206352_11264405 | 3300020078 | Bacteria | 1277 |
| 162 | Ga0154015_1678080 | 3300020610 | Unclassified | 1465 |
| 163 | Ga0213872_10033831 | 3300021361 | Bacteria | 2341 |
| 164 | Ga0209563_104816 | 3300025230 | Bacteria | 2527 |
| 165 | Ga0207427_100083 | 3300025231 | Bacteria | 142745 |
| 166 | Ga0207427_116069 | 3300025231 | Unclassified | 704 |
| 167 | Ga0209437_100021 | 3300025233 | Bacteria | 646400 |
| 168 | Ga0209437_100230 | 3300025233 | Bacteria | 95882 |
| 169 | Ga0209026_1001689 | 3300025250 | Bacteria | 9255 |
| 170 | Ga0209026_1002250 | 3300025250 | Bacteria | 7406 |
| 171 | Ga0209026_1010077 | 3300025250 | Bacteria | 1792 |
| 172 | Ga0209129_1067783 | 3300025258 | Bacteria | 519 |
| 173 | Ga0209233_1000035 | 3300025261 | Bacteria | 568478 |
| 174 | Ga0209233_1001672 | 3300025261 | Bacteria | 8637 |
| 175 | Ga0209233_1034296 | 3300025261 | Bacteria | 1156 |
| 176 | Ga0207647_10001052 | 3300025904 | Bacteria | 21267 |
| 177 | Ga0207647_10001219 | 3300025904 | Bacteria | 19782 |
| 178 | Ga0207647_10107368 | 3300025904 | Bacteria | 1652 |
| 179 | Ga0207647_10564393 | 3300025904 | Bacteria | 630 |
| 180 | Ga0207645_10013463 | 3300025907 | Bacteria | 5510 |
| 181 | Ga0207705_10000317 | 3300025909 | Bacteria | 43987 |
| 182 | Ga0207705_10114968 | 3300025909 | Bacteria | 1991 |
| 183 | Ga0207705_10214358 | 3300025909 | Bacteria | 1461 |
| 184 | Ga0207654_10002795 | 3300025911 | Bacteria | 8870 |
| 185 | Ga0207654_10020832 | 3300025911 | Bacteria | 3482 |
| 186 | Ga0207654_10031005 | 3300025911 | Bacteria | 2941 |
| 187 | Ga0207707_10194355 | 3300025912 | Bacteria | 1770 |
| 188 | Ga0207695_10000235 | 3300025913 | Bacteria | 146984 |
| 189 | Ga0207695_10020240 | 3300025913 | Bacteria | 7627 |
| 190 | Ga0207695_10106983 | 3300025913 | Bacteria | 2782 |
| 191 | Ga0207695_10187243 | 3300025913 | Bacteria | 1988 |
| 192 | Ga0207695_10374708 | 3300025913 | Bacteria | 1309 |
| 193 | Ga0207671_10008704 | 3300025914 | Bacteria | 8564 |
| 194 | Ga0207671_10012357 | 3300025914 | Bacteria | 6869 |
| 195 | Ga0207671_10014468 | 3300025914 | Bacteria | 6233 |
| 196 | Ga0207671_10023453 | 3300025914 | Bacteria | 4654 |
| 197 | Ga0207671_10068327 | 3300025914 | Bacteria | 2647 |
| 198 | Ga0207671_10747189 | 3300025914 | Bacteria | 777 |
| 199 | Ga0207660_11368600 | 3300025917 | Unclassified | 574 |
| 200 | Ga0207657_10057532 | 3300025919 | Bacteria | 3351 |
| 201 | Ga0207652_10089566 | 3300025921 | Bacteria | 2702 |
| 202 | Ga0207694_10021769 | 3300025924 | Bacteria | 4859 |
| 203 | Ga0207694_10161672 | 3300025924 | Bacteria | 1809 |
| 204 | Ga0207694_10240113 | 3300025924 | Unclassified | 1481 |
| 205 | Ga0207644_10422374 | 3300025931 | Bacteria | 1092 |
| 206 | Ga0207690_10010109 | 3300025932 | Bacteria | 5604 |
| 207 | Ga0207690_10349341 | 3300025932 | Bacteria | 1169 |
| 208 | Ga0207706_10000009 | 3300025933 | Bacteria | 200607 |
| 209 | Ga0207686_10028323 | 3300025934 | Bacteria | 3292 |
| 210 | Ga0207704_10000028 | 3300025938 | Bacteria | 122144 |
| 211 | Ga0207689_11779697 | 3300025942 | Bacteria | 509 |
| 212 | Ga0207661_10510789 | 3300025944 | Unclassified | 1098 |
| 213 | Ga0207667_10000033 | 3300025949 | Bacteria | 314353 |
| 214 | Ga0207667_10006450 | 3300025949 | Bacteria | 14200 |
| 215 | Ga0207667_10097474 | 3300025949 | Bacteria | 3035 |
| 216 | Ga0207667_10100097 | 3300025949 | Bacteria | 2990 |
| 217 | Ga0207667_10164572 | 3300025949 | Bacteria | 2281 |
| 218 | Ga0207667_11568247 | 3300025949 | Bacteria | 628 |
| 219 | Ga0207667_12083312 | 3300025949 | Bacteria | 526 |
| 220 | Ga0207651_10013605 | 3300025960 | Bacteria | 4663 |
| 221 | Ga0207651_11629148 | 3300025960 | Unclassified | 581 |
| 222 | Ga0207677_10003962 | 3300026023 | Bacteria | 7890 |
| 223 | Ga0207639_10014276 | 3300026041 | Bacteria | 5580 |
| 224 | Ga0207639_10037757 | 3300026041 | Bacteria | 3590 |
| 225 | Ga0207678_10018264 | 3300026067 | Bacteria | 6158 |
| 226 | Ga0207702_10040749 | 3300026078 | Bacteria | 3893 |
| 227 | Ga0207702_10531557 | 3300026078 | Bacteria | 1149 |
| 228 | Ga0207702_11188587 | 3300026078 | Bacteria | 757 |
| 229 | Ga0207648_10006336 | 3300026089 | Bacteria | 11766 |
| 230 | Ga0207674_10013951 | 3300026116 | Bacteria | 8888 |
| 231 | Ga0207674_10648236 | 3300026116 | Bacteria | 1020 |
| 232 | Ga0207683_10006779 | 3300026121 | Bacteria | 9804 |
| 233 | Ga0207683_10499177 | 3300026121 | Bacteria | 1124 |
| 234 | Ga0207698_10033528 | 3300026142 | Bacteria | 3732 |
| 235 | Ga0268266_10000053 | 3300028379 | Bacteria | 295181 |
| 236 | Ga0307517_10024827 | 3300028786 | Bacteria | 7360 |
| 237 | Ga0265338_10074593 | 3300028800 | Bacteria | 2884 |
| 238 | Ga0316183_1134560 | 3300030742 | Bacteria | 13366 |
| 239 | Ga0316181_1166451 | 3300030744 | Bacteria | 615 |
| 240 | Ga0316181_1167506 | 3300030744 | Bacteria | 16152 |
| 241 | Ga0265327_10005705 | 3300031251 | Bacteria | 10273 |
| 242 | Ga0307408_100001246 | 3300031548 | Bacteria | 19110 |
| 243 | Ga0307408_100001545 | 3300031548 | Bacteria | 17060 |
| 244 | Ga0307408_100032561 | 3300031548 | Bacteria | 3635 |
| 245 | Ga0307412_10000490 | 3300031911 | Bacteria | 23654 |
| 246 | Ga0307414_12059816 | 3300032004 | Bacteria | 533 |
| 247 | Ga0307510_10013839 | 3300033180 | Bacteria | 9560 |
| 248 | Ga0373923_0331243 | 3300035111 | Unclassified | 724 |
| 249 | Ga0373941_0012566 | 3300035115 | Bacteria | 2217 |
| 250 | Ga0395899_0000237 | 3300037312 | Bacteria | 74249 |
| 251 | Ga0395899_0000453 | 3300037312 | Bacteria | 46699 |
| 252 | Ga0395899_0002538 | 3300037312 | Bacteria | 14791 |
| 253 | Ga0395899_0022066 | 3300037312 | Bacteria | 4828 |
| 254 | Ga0395899_0208559 | 3300037312 | Bacteria | 1359 |
| 255 | Ga0395900_0000431 | 3300037418 | Bacteria | 60172 |
| 256 | Ga0395900_0038965 | 3300037418 | Bacteria | 4899 |
| 257 | Ga0395900_0334235 | 3300037418 | Bacteria | 1492 |
| 258 | Ga0395898_0027065 | 3300037466 | Bacteria | 5761 |
| 259 | Ga0395905_0001649 | 3300037471 | Bacteria | 26382 |
| 260 | Ga0395905_0009670 | 3300037471 | Bacteria | 9412 |
| 261 | Ga0395901_0001158 | 3300038443 | Bacteria | 28004 |
| 262 | Ga0395901_0039100 | 3300038443 | Bacteria | 4909 |
| 263 | Ga0395901_0041273 | 3300038443 | Bacteria | 4781 |
| 264 | Ga0395901_0389006 | 3300038443 | Bacteria | 1434 |
| 265 | Ga0436361_0358981 | 3300039447 | Bacteria | 6265 |
| 266 | Ga0439436_0082463 | 3300041404 | Bacteria | 895 |
| 267 | Ga0451789_1067397 | 3300041443 | Bacteria | 686 |
| 268 | Ga0451793_0309094 | 3300041452 | Bacteria | 552 |
| 269 | Ga0451793_1848691 | 3300041452 | Bacteria | 715 |
| 270 | Ga0451841_1095603 | 3300041498 | Bacteria | 866 |
| 271 | Ga0439448_0004511 | 3300042005 | Bacteria | 3932 |
| 272 | Ga0439455_0027085 | 3300042012 | Bacteria | 1403 |
| 273 | Ga0466966_0086008 | 3300044684 | Bacteria | 1954 |
| 274 | Ga0466957_0236904 | 3300044842 | Bacteria | 1210 |
| 275 | Ga0466959_0179400 | 3300045049 | Bacteria | 1482 |
| 276 | Ga0466959_0696563 | 3300045049 | Bacteria | 681 |
| 277 | Ga0495638_0206681 | 3300046460 | Bacteria | 1105 |
| 278 | Ga0495650_0000023 | 3300046471 | Bacteria | 527763 |
| 279 | Ga0495650_0046826 | 3300046471 | Bacteria | 1812 |
| 280 | Ga0495585_0000629 | 3300046492 | Bacteria | 32624 |
| 281 | Ga0495607_0163460 | 3300046501 | Bacteria | 1129 |
| 282 | Ga0495606_0000448 | 3300046507 | Bacteria | 67282 |
| 283 | Ga0495606_0008544 | 3300046507 | Bacteria | 8869 |
| 284 | Ga0495606_0346556 | 3300046507 | Bacteria | 790 |
| 285 | Ga0495610_0001664 | 3300046512 | Bacteria | 19541 |
| 286 | Ga0495616_0001269 | 3300046513 | Bacteria | 17736 |
| 287 | Ga0495616_0008922 | 3300046513 | Bacteria | 5892 |
| 288 | Ga0495632_0139120 | 3300046519 | Bacteria | 1127 |
| 289 | Ga0495637_0088684 | 3300046520 | Bacteria | 1223 |
| 290 | Ga0495637_0116533 | 3300046520 | Bacteria | 1031 |
| 291 | Ga0495644_0020392 | 3300046523 | Bacteria | 2529 |
| 292 | Ga0495648_0068323 | 3300046524 | Bacteria | 2074 |
| 293 | Ga0495652_0418287 | 3300046529 | Bacteria | 945 |
| 294 | Ga0495654_0160464 | 3300046530 | Bacteria | 987 |
| 295 | Ga0495609_0036292 | 3300046538 | Bacteria | 2226 |
| 296 | Ga0495633_0004222 | 3300046558 | Bacteria | 9203 |
| 297 | Ga0495625_0000018 | 3300046660 | Bacteria | 299567 |
| 298 | Ga0495625_0012435 | 3300046660 | Bacteria | 6896 |
| 299 | Ga0495625_0051947 | 3300046660 | Bacteria | 2936 |
| 300 | Ga0495625_0069096 | 3300046660 | Bacteria | 2482 |
| 301 | Ga0495625_0109983 | 3300046660 | Bacteria | 1884 |
| 302 | Ga0495625_0517336 | 3300046660 | Bacteria | 727 |
| 303 | Ga0495661_0001731 | 3300046665 | Bacteria | 17639 |
| 304 | Ga0495661_0090361 | 3300046665 | Bacteria | 1743 |
| 305 | Ga0495669_0242627 | 3300046684 | Bacteria | 865 |
| 306 | Ga0495670_0409068 | 3300046691 | Bacteria | 733 |
| 307 | Ga0495671_0131137 | 3300046692 | Bacteria | 1222 |
| 308 | Ga0495649_0000015 | 3300046694 | Bacteria | 246431 |
| 309 | Ga0495649_0467099 | 3300046694 | Bacteria | 629 |
| 310 | Ga0495660_0007525 | 3300046810 | Bacteria | 6393 |
| 311 | Ga0495683_0009041 | 3300047323 | Bacteria | 5310 |
| 312 | Ga0495687_006209 | 3300047443 | Bacteria | 7379 |
| 313 | Ga0495687_011194 | 3300047443 | Bacteria | 4841 |
| 314 | Ga0495673_0042298 | 3300047469 | Bacteria | 2046 |
| 315 | Ga0495686_0000303 | 3300047472 | Bacteria | 84544 |
| 316 | Ga0495686_0005200 | 3300047472 | Bacteria | 10358 |
| 317 | Ga0495686_0195064 | 3300047472 | Bacteria | 1165 |
| 318 | Ga0495686_0389593 | 3300047472 | Bacteria | 750 |
| 319 | Ga0495686_0546569 | 3300047472 | Bacteria | 605 |
| 320 | Ga0496105_1079430 | 3300048908 | Bacteria | 597 |
| 321 | nmdc:mga0k408_4057_c1 | 3300050493 | Bacteria | 7768 |
| 322 | nmdc:mga0k408_52982_c1 | 3300050493 | Bacteria | 2351 |
| 323 | nmdc:mga0k408_59224_c1 | 3300050493 | Bacteria | 2225 |
| 324 | nmdc:mga07m45_201033_c1 | 3300050496 | Bacteria | 1159 |
| 325 | nmdc:mga07m45_289242_c1 | 3300050496 | Bacteria | 953 |
| 326 | Ga0500650_0347714 | 3300053098 | Bacteria | 649 |
| 327 | Ga0500608_007517 | 3300053122 | Bacteria | 4515 |
| 328 | Ga0500618_040265 | 3300053125 | Bacteria | 1074 |
| 329 | Ga0500642_0088644 | 3300053130 | Bacteria | 1428 |
| 330 | Ga0500573_0144382 | 3300053140 | Bacteria | 1308 |
| 331 | Ga0500579_132437 | 3300053143 | Bacteria | 1160 |
| 332 | Ga0500622_0000860 | 3300053156 | Bacteria | 25927 |
| 333 | Ga0500634_0142485 | 3300053161 | Bacteria | 1133 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | iso_pu_bacteria | 2519899754 | 2520879562 | 117 |
| 2 | iso_pu_bacteria | 2599185184 | 2599479212 | 117 |
| 3 | iso_pu_bacteria | 2643221716 | 2644643906 | 117 |
| 4 | iso_pu_bacteria | 2816332280 | 2817413519 | 117 |
| 5 | iso_pu_bacteria | 2852623160 | 2852627040 | 117 |
| 6 | iso_pu_bacteria | 2884933994 | 2884935228 | 117 |
| 7 | iso_pu_bacteria | 2919437846 | 2919439264 | 117 |
| 8 | iso_pu_bacteria | 2928078545 | 2928082472 | 117 |
| 9 | iso_pu_bacteria | 2928147474 | 2928148940 | 117 |
| 10 | iso_pu_bacteria | 2958458903 | 2958461972 | 117 |
| 11 | iso_pu_bacteria | 8055419101 | 8055423554 | 117 |
| 12 | 3300037312 | Ga0395899_0208559 | Ga0395899_0208559_128_493 | 118 |
| 13 | 3300038443 | Ga0395901_0389006 | Ga0395901_0389006_78_443 | 118 |
| 14 | 3300053161 | Ga0500634_0142485 | Ga0500634_0142485_689_1045 | 118 |
| 15 | 3300013306 | Ga0163162_12697872 | Ga0163162_126978721 | 119 |
| 16 | 3300025261 | Ga0209233_1034296 | Ga0209233_10342962 | 119 |
| 17 | 3300030742 | Ga0316183_1134560 | Ga0316183_11345602 | 119 |
| 18 | 3300030744 | Ga0316181_1166451 | Ga0316181_11664511 | 119 |
| 19 | 3300030744 | Ga0316181_1167506 | Ga0316181_11675068 | 119 |
| 20 | 3300031251 | Ga0265327_10005705 | Ga0265327_100057055 | 119 |
| 21 | 3300031548 | Ga0307408_100001246 | Ga0307408_1000012462 | 119 |
| 22 | 3300031548 | Ga0307408_100032561 | Ga0307408_1000325612 | 119 |
| 23 | 3300031911 | Ga0307412_10000490 | Ga0307412_1000049020 | 119 |
| 24 | 3300032004 | Ga0307414_12059816 | Ga0307414_120598161 | 119 |
| 25 | 3300041404 | Ga0439436_0082463 | Ga0439436_0082463_20_379 | 119 |
| 26 | 3300041498 | Ga0451841_1095603 | Ga0451841_1095603_325_684 | 119 |
| 27 | 3300002737 | JGI25162J39368_1000150 | JGI25162J39368_10001503 | 120 |
| 28 | 3300002772 | JGI25164J39214_1001658 | JGI25164J39214_10016583 | 120 |
| 29 | 3300003214 | JGI25165J46597_1000456 | JGI25165J46597_100045622 | 120 |
| 30 | 3300005563 | Ga0068855_100000060 | Ga0068855_10000006074 | 120 |
| 31 | 3300009093 | Ga0105240_10346025 | Ga0105240_103460252 | 120 |
| 32 | 3300009093 | Ga0105240_11714068 | Ga0105240_117140682 | 120 |
| 33 | 3300009545 | Ga0105237_10000465 | Ga0105237_1000046552 | 120 |
| 34 | 3300021361 | Ga0213872_10033831 | Ga0213872_100338312 | 120 |
| 35 | 3300025230 | Ga0209563_104816 | Ga0209563_1048163 | 120 |
| 36 | 3300025231 | Ga0207427_100083 | Ga0207427_10008380 | 120 |
| 37 | 3300025233 | Ga0209437_100021 | Ga0209437_100021339 | 120 |
| 38 | 3300025261 | Ga0209233_1000035 | Ga0209233_1000035299 | 120 |
| 39 | 3300025914 | Ga0207671_10008704 | Ga0207671_100087048 | 120 |
| 40 | 3300025949 | Ga0207667_10000033 | Ga0207667_10000033215 | 120 |
| 41 | 3300028786 | Ga0307517_10024827 | Ga0307517_100248273 | 120 |
| 42 | 3300031548 | Ga0307408_100001545 | Ga0307408_10000154512 | 120 |
| 43 | 3300037312 | Ga0395899_0000237 | Ga0395899_0000237_71239_71601 | 120 |
| 44 | 3300039447 | Ga0436361_0358981 | Ga0436361_0358981_1889_2251 | 120 |
| 45 | 3300001904 | JGI24736J21556_1002620 | JGI24736J21556_10026203 | 121 |
| 46 | 3300001904 | JGI24736J21556_1011537 | JGI24736J21556_10115372 | 121 |
| 47 | 3300001979 | JGI24740J21852_10119106 | JGI24740J21852_101191061 | 121 |
| 48 | 3300001989 | JGI24739J22299_10000787 | JGI24739J22299_100007873 | 121 |
| 49 | 3300001990 | JGI24737J22298_10015417 | JGI24737J22298_100154173 | 121 |
| 50 | 3300001990 | JGI24737J22298_10017618 | JGI24737J22298_100176181 | 121 |
| 51 | 3300002077 | JGI24744J21845_10009032 | JGI24744J21845_100090323 | 121 |
| 52 | 3300002737 | JGI25162J39368_1000682 | JGI25162J39368_10006823 | 121 |
| 53 | 3300002741 | JGI25157J39369_1012095 | JGI25157J39369_10120952 | 121 |
| 54 | 3300003316 | rootH1_10045740 | rootH1_100457403 | 121 |
| 55 | 3300003320 | rootH2_10018482 | rootH2_100184825 | 121 |
| 56 | 3300003320 | rootH2_10043869 | rootH2_100438695 | 121 |
| 57 | 3300003320 | rootH2_10241331 | rootH2_102413315 | 121 |
| 58 | 3300003322 | rootL2_10012952 | rootL2_100129527 | 121 |
| 59 | 3300003323 | rootH1_10012978 | rootH1_1001297810 | 121 |
| 60 | 3300003323 | rootH1_10068572 | rootH1_100685723 | 121 |
| 61 | 3300004799 | Ga0058863_11859864 | Ga0058863_118598643 | 121 |
| 62 | 3300004800 | Ga0058861_10005061 | Ga0058861_100050612 | 121 |
| 63 | 3300004803 | Ga0058862_10002974 | Ga0058862_100029743 | 121 |
| 64 | 3300005327 | Ga0070658_10000290 | Ga0070658_1000029032 | 121 |
| 65 | 3300005327 | Ga0070658_10014613 | Ga0070658_100146134 | 121 |
| 66 | 3300005327 | Ga0070658_10254941 | Ga0070658_102549412 | 121 |
| 67 | 3300005327 | Ga0070658_10285178 | Ga0070658_102851782 | 121 |
| 68 | 3300005328 | Ga0070676_10007187 | Ga0070676_100071874 | 121 |
| 69 | 3300005334 | Ga0068869_102084352 | Ga0068869_1020843521 | 121 |
| 70 | 3300005336 | Ga0070680_100617808 | Ga0070680_1006178082 | 121 |
| 71 | 3300005338 | Ga0068868_100008686 | Ga0068868_1000086867 | 121 |
| 72 | 3300005339 | Ga0070660_100051500 | Ga0070660_1000515002 | 121 |
| 73 | 3300005339 | Ga0070660_100283666 | Ga0070660_1002836662 | 121 |
| 74 | 3300005344 | Ga0070661_101409714 | Ga0070661_1014097141 | 121 |
| 75 | 3300005355 | Ga0070671_100312180 | Ga0070671_1003121802 | 121 |
| 76 | 3300005364 | Ga0070673_100008632 | Ga0070673_1000086326 | 121 |
| 77 | 3300005364 | Ga0070673_101799577 | Ga0070673_1017995771 | 121 |
| 78 | 3300005365 | Ga0070688_100236922 | Ga0070688_1002369222 | 121 |
| 79 | 3300005366 | Ga0070659_100011510 | Ga0070659_1000115104 | 121 |
| 80 | 3300005366 | Ga0070659_100026245 | Ga0070659_1000262452 | 121 |
| 81 | 3300005366 | Ga0070659_101129164 | Ga0070659_1011291641 | 121 |
| 82 | 3300005366 | Ga0070659_101318431 | Ga0070659_1013184311 | 121 |
| 83 | 3300005455 | Ga0070663_100003848 | Ga0070663_1000038488 | 121 |
| 84 | 3300005456 | Ga0070678_100017640 | Ga0070678_1000176403 | 121 |
| 85 | 3300005456 | Ga0070678_100945068 | Ga0070678_1009450681 | 121 |
| 86 | 3300005457 | Ga0070662_100002313 | Ga0070662_1000023133 | 121 |
| 87 | 3300005458 | Ga0070681_10073517 | Ga0070681_100735174 | 121 |
| 88 | 3300005459 | Ga0068867_100008159 | Ga0068867_1000081596 | 121 |
| 89 | 3300005530 | Ga0070679_100021503 | Ga0070679_1000215033 | 121 |
| 90 | 3300005530 | Ga0070679_100133450 | Ga0070679_1001334503 | 121 |
| 91 | 3300005535 | Ga0070684_100762665 | Ga0070684_1007626652 | 121 |
| 92 | 3300005539 | Ga0068853_100018436 | Ga0068853_1000184364 | 121 |
| 93 | 3300005539 | Ga0068853_100065627 | Ga0068853_1000656273 | 121 |
| 94 | 3300005539 | Ga0068853_102110909 | Ga0068853_1021109091 | 121 |
| 95 | 3300005543 | Ga0070672_100086704 | Ga0070672_1000867043 | 121 |
| 96 | 3300005548 | Ga0070665_100000061 | Ga0070665_1000000614 | 121 |
| 97 | 3300005563 | Ga0068855_100008684 | Ga0068855_1000086844 | 121 |
| 98 | 3300005563 | Ga0068855_100015461 | Ga0068855_1000154616 | 121 |
| 99 | 3300005563 | Ga0068855_100028189 | Ga0068855_1000281897 | 121 |
| 100 | 3300005563 | Ga0068855_100077275 | Ga0068855_1000772753 | 121 |
| 101 | 3300005563 | Ga0068855_100621632 | Ga0068855_1006216322 | 121 |
| 102 | 3300005563 | Ga0068855_101041132 | Ga0068855_1010411322 | 121 |
| 103 | 3300005577 | Ga0068857_100018920 | Ga0068857_1000189205 | 121 |
| 104 | 3300005578 | Ga0068854_101389424 | Ga0068854_1013894242 | 121 |
| 105 | 3300005614 | Ga0068856_100064206 | Ga0068856_1000642063 | 121 |
| 106 | 3300005614 | Ga0068856_100099223 | Ga0068856_1000992233 | 121 |
| 107 | 3300005614 | Ga0068856_100180721 | Ga0068856_1001807213 | 121 |
| 108 | 3300005616 | Ga0068852_100013694 | Ga0068852_1000136944 | 121 |
| 109 | 3300005616 | Ga0068852_102041847 | Ga0068852_1020418472 | 121 |
| 110 | 3300006195 | Ga0075366_10004089 | Ga0075366_100040895 | 121 |
| 111 | 3300006195 | Ga0075366_10015152 | Ga0075366_100151525 | 121 |
| 112 | 3300006195 | Ga0075366_10055938 | Ga0075366_100559383 | 121 |
| 113 | 3300006195 | Ga0075366_10616068 | Ga0075366_106160681 | 121 |
| 114 | 3300006237 | Ga0097621_100003881 | Ga0097621_1000038817 | 121 |
| 115 | 3300006237 | Ga0097621_100011606 | Ga0097621_1000116063 | 121 |
| 116 | 3300006237 | Ga0097621_101787321 | Ga0097621_1017873211 | 121 |
| 117 | 3300006353 | Ga0075370_10368970 | Ga0075370_103689701 | 121 |
| 118 | 3300006358 | Ga0068871_100000622 | Ga0068871_10000062220 | 121 |
| 119 | 3300006881 | Ga0068865_100007507 | Ga0068865_1000075076 | 121 |
| 120 | 3300009093 | Ga0105240_10000075 | Ga0105240_100000753 | 121 |
| 121 | 3300009093 | Ga0105240_10146673 | Ga0105240_101466733 | 121 |
| 122 | 3300009093 | Ga0105240_10149150 | Ga0105240_101491502 | 121 |
| 123 | 3300009093 | Ga0105240_10183733 | Ga0105240_101837332 | 121 |
| 124 | 3300009093 | Ga0105240_10235633 | Ga0105240_102356332 | 121 |
| 125 | 3300009093 | Ga0105240_10299112 | Ga0105240_102991122 | 121 |
| 126 | 3300009093 | Ga0105240_10638091 | Ga0105240_106380912 | 121 |
| 127 | 3300009098 | Ga0105245_12409064 | Ga0105245_124090641 | 121 |
| 128 | 3300009174 | Ga0105241_10004575 | Ga0105241_100045754 | 121 |
| 129 | 3300009174 | Ga0105241_10009106 | Ga0105241_100091064 | 121 |
| 130 | 3300009174 | Ga0105241_12041653 | Ga0105241_120416531 | 121 |
| 131 | 3300009176 | Ga0105242_10014527 | Ga0105242_100145274 | 121 |
| 132 | 3300009545 | Ga0105237_10021544 | Ga0105237_100215442 | 121 |
| 133 | 3300009545 | Ga0105237_10023198 | Ga0105237_100231983 | 121 |
| 134 | 3300009545 | Ga0105237_10024810 | Ga0105237_100248105 | 121 |
| 135 | 3300009545 | Ga0105237_10059947 | Ga0105237_100599473 | 121 |
| 136 | 3300009545 | Ga0105237_10163403 | Ga0105237_101634033 | 121 |
| 137 | 3300009545 | Ga0105237_10270644 | Ga0105237_102706441 | 121 |
| 138 | 3300009545 | Ga0105237_11005134 | Ga0105237_110051341 | 121 |
| 139 | 3300009545 | Ga0105237_11704081 | Ga0105237_117040812 | 121 |
| 140 | 3300009551 | Ga0105238_10030758 | Ga0105238_100307583 | 121 |
| 141 | 3300009551 | Ga0105238_10084640 | Ga0105238_100846402 | 121 |
| 142 | 3300009551 | Ga0105238_10132855 | Ga0105238_101328553 | 121 |
| 143 | 3300009553 | Ga0105249_11961013 | Ga0105249_119610132 | 121 |
| 144 | 3300010375 | Ga0105239_10000142 | Ga0105239_1000014269 | 121 |
| 145 | 3300010375 | Ga0105239_10000286 | Ga0105239_1000028667 | 121 |
| 146 | 3300010375 | Ga0105239_10002242 | Ga0105239_100022424 | 121 |
| 147 | 3300010375 | Ga0105239_10061479 | Ga0105239_100614793 | 121 |
| 148 | 3300010375 | Ga0105239_10093649 | Ga0105239_100936493 | 121 |
| 149 | 3300010375 | Ga0105239_10218862 | Ga0105239_102188623 | 121 |
| 150 | 3300010375 | Ga0105239_10266701 | Ga0105239_102667012 | 121 |
| 151 | 3300010375 | Ga0105239_11997877 | Ga0105239_119978771 | 121 |
| 152 | 3300011119 | Ga0105246_10058473 | Ga0105246_100584733 | 121 |
| 153 | 3300011119 | Ga0105246_11538610 | Ga0105246_115386102 | 121 |
| 154 | 3300011119 | Ga0105246_12371139 | Ga0105246_123711392 | 121 |
| 155 | 3300013100 | Ga0157373_10010316 | Ga0157373_100103161 | 121 |
| 156 | 3300013100 | Ga0157373_10043610 | Ga0157373_100436104 | 121 |
| 157 | 3300013102 | Ga0157371_10004409 | Ga0157371_1000440911 | 121 |
| 158 | 3300013102 | Ga0157371_10006549 | Ga0157371_100065496 | 121 |
| 159 | 3300013102 | Ga0157371_10022996 | Ga0157371_100229962 | 121 |
| 160 | 3300013102 | Ga0157371_10050979 | Ga0157371_100509793 | 121 |
| 161 | 3300013104 | Ga0157370_10016076 | Ga0157370_100160763 | 121 |
| 162 | 3300013105 | Ga0157369_10005466 | Ga0157369_100054663 | 121 |
| 163 | 3300013105 | Ga0157369_10092230 | Ga0157369_100922301 | 121 |
| 164 | 3300013105 | Ga0157369_10098521 | Ga0157369_100985213 | 121 |
| 165 | 3300013105 | Ga0157369_10171562 | Ga0157369_101715621 | 121 |
| 166 | 3300013296 | Ga0157374_10000125 | Ga0157374_100001253 | 121 |
| 167 | 3300013296 | Ga0157374_10014844 | Ga0157374_100148443 | 121 |
| 168 | 3300013296 | Ga0157374_10057423 | Ga0157374_100574233 | 121 |
| 169 | 3300013296 | Ga0157374_10350016 | Ga0157374_103500162 | 121 |
| 170 | 3300013296 | Ga0157374_11552207 | Ga0157374_115522072 | 121 |
| 171 | 3300013297 | Ga0157378_10038747 | Ga0157378_100387473 | 121 |
| 172 | 3300013297 | Ga0157378_10619070 | Ga0157378_106190702 | 121 |
| 173 | 3300013297 | Ga0157378_12332336 | Ga0157378_123323362 | 121 |
| 174 | 3300013297 | Ga0157378_12947592 | Ga0157378_129475921 | 121 |
| 175 | 3300013306 | Ga0163162_10000087 | Ga0163162_100000874 | 121 |
| 176 | 3300013306 | Ga0163162_10002647 | Ga0163162_100026478 | 121 |
| 177 | 3300013306 | Ga0163162_10003764 | Ga0163162_100037649 | 121 |
| 178 | 3300013306 | Ga0163162_10009160 | Ga0163162_100091603 | 121 |
| 179 | 3300013306 | Ga0163162_10562771 | Ga0163162_105627711 | 121 |
| 180 | 3300013307 | Ga0157372_10000048 | Ga0157372_100000482 | 121 |
| 181 | 3300013307 | Ga0157372_10000354 | Ga0157372_1000035436 | 121 |
| 182 | 3300013307 | Ga0157372_10001314 | Ga0157372_100013142 | 121 |
| 183 | 3300013307 | Ga0157372_10045070 | Ga0157372_100450701 | 121 |
| 184 | 3300013307 | Ga0157372_10717860 | Ga0157372_107178602 | 121 |
| 185 | 3300013308 | Ga0157375_10036705 | Ga0157375_100367053 | 121 |
| 186 | 3300013308 | Ga0157375_10041878 | Ga0157375_100418786 | 121 |
| 187 | 3300013308 | Ga0157375_10195776 | Ga0157375_101957762 | 121 |
| 188 | 3300013308 | Ga0157375_10433204 | Ga0157375_104332042 | 121 |
| 189 | 3300014325 | Ga0163163_10947890 | Ga0163163_109478902 | 121 |
| 190 | 3300014745 | Ga0157377_10012454 | Ga0157377_100124543 | 121 |
| 191 | 3300014968 | Ga0157379_12497885 | Ga0157379_124978851 | 121 |
| 192 | 3300014969 | Ga0157376_10134745 | Ga0157376_101347453 | 121 |
| 193 | 3300014969 | Ga0157376_10168043 | Ga0157376_101680431 | 121 |
| 194 | 3300014969 | Ga0157376_11155455 | Ga0157376_111554551 | 121 |
| 195 | 3300015262 | Ga0182007_10027883 | Ga0182007_100278833 | 121 |
| 196 | 3300017792 | Ga0163161_10915819 | Ga0163161_109158191 | 121 |
| 197 | 3300020078 | Ga0206352_11264405 | Ga0206352_112644052 | 121 |
| 198 | 3300020610 | Ga0154015_1678080 | Ga0154015_16780802 | 121 |
| 199 | 3300025231 | Ga0207427_116069 | Ga0207427_1160691 | 121 |
| 200 | 3300025233 | Ga0209437_100230 | Ga0209437_10023085 | 121 |
| 201 | 3300025250 | Ga0209026_1001689 | Ga0209026_10016899 | 121 |
| 202 | 3300025250 | Ga0209026_1002250 | Ga0209026_10022502 | 121 |
| 203 | 3300025250 | Ga0209026_1010077 | Ga0209026_10100771 | 121 |
| 204 | 3300025258 | Ga0209129_1067783 | Ga0209129_10677831 | 121 |
| 205 | 3300025261 | Ga0209233_1001672 | Ga0209233_10016728 | 121 |
| 206 | 3300025904 | Ga0207647_10001052 | Ga0207647_1000105211 | 121 |
| 207 | 3300025904 | Ga0207647_10001219 | Ga0207647_100012193 | 121 |
| 208 | 3300025904 | Ga0207647_10107368 | Ga0207647_101073683 | 121 |
| 209 | 3300025904 | Ga0207647_10564393 | Ga0207647_105643932 | 121 |
| 210 | 3300025907 | Ga0207645_10013463 | Ga0207645_100134634 | 121 |
| 211 | 3300025909 | Ga0207705_10000317 | Ga0207705_1000031732 | 121 |
| 212 | 3300025909 | Ga0207705_10114968 | Ga0207705_101149683 | 121 |
| 213 | 3300025909 | Ga0207705_10214358 | Ga0207705_102143582 | 121 |
| 214 | 3300025911 | Ga0207654_10002795 | Ga0207654_100027953 | 121 |
| 215 | 3300025911 | Ga0207654_10020832 | Ga0207654_100208324 | 121 |
| 216 | 3300025911 | Ga0207654_10031005 | Ga0207654_100310053 | 121 |
| 217 | 3300025912 | Ga0207707_10194355 | Ga0207707_101943552 | 121 |
| 218 | 3300025913 | Ga0207695_10000235 | Ga0207695_10000235131 | 121 |
| 219 | 3300025913 | Ga0207695_10020240 | Ga0207695_100202406 | 121 |
| 220 | 3300025913 | Ga0207695_10106983 | Ga0207695_101069834 | 121 |
| 221 | 3300025913 | Ga0207695_10187243 | Ga0207695_101872432 | 121 |
| 222 | 3300025913 | Ga0207695_10374708 | Ga0207695_103747082 | 121 |
| 223 | 3300025914 | Ga0207671_10012357 | Ga0207671_100123573 | 121 |
| 224 | 3300025914 | Ga0207671_10014468 | Ga0207671_100144685 | 121 |
| 225 | 3300025914 | Ga0207671_10023453 | Ga0207671_100234534 | 121 |
| 226 | 3300025914 | Ga0207671_10068327 | Ga0207671_100683272 | 121 |
| 227 | 3300025914 | Ga0207671_10747189 | Ga0207671_107471891 | 121 |
| 228 | 3300025917 | Ga0207660_11368600 | Ga0207660_113686001 | 121 |
| 229 | 3300025919 | Ga0207657_10057532 | Ga0207657_100575323 | 121 |
| 230 | 3300025921 | Ga0207652_10089566 | Ga0207652_100895663 | 121 |
| 231 | 3300025924 | Ga0207694_10021769 | Ga0207694_100217694 | 121 |
| 232 | 3300025924 | Ga0207694_10161672 | Ga0207694_101616723 | 121 |
| 233 | 3300025924 | Ga0207694_10240113 | Ga0207694_102401132 | 121 |
| 234 | 3300025931 | Ga0207644_10422374 | Ga0207644_104223742 | 121 |
| 235 | 3300025932 | Ga0207690_10010109 | Ga0207690_100101092 | 121 |
| 236 | 3300025932 | Ga0207690_10349341 | Ga0207690_103493411 | 121 |
| 237 | 3300025933 | Ga0207706_10000009 | Ga0207706_100000093 | 121 |
| 238 | 3300025934 | Ga0207686_10028323 | Ga0207686_100283234 | 121 |
| 239 | 3300025938 | Ga0207704_10000028 | Ga0207704_100000285 | 121 |
| 240 | 3300025942 | Ga0207689_11779697 | Ga0207689_117796971 | 121 |
| 241 | 3300025944 | Ga0207661_10510789 | Ga0207661_105107891 | 121 |
| 242 | 3300025949 | Ga0207667_10006450 | Ga0207667_100064502 | 121 |
| 243 | 3300025949 | Ga0207667_10097474 | Ga0207667_100974742 | 121 |
| 244 | 3300025949 | Ga0207667_10100097 | Ga0207667_101000973 | 121 |
| 245 | 3300025949 | Ga0207667_10164572 | Ga0207667_101645722 | 121 |
| 246 | 3300025949 | Ga0207667_11568247 | Ga0207667_115682471 | 121 |
| 247 | 3300025949 | Ga0207667_12083312 | Ga0207667_120833121 | 121 |
| 248 | 3300025960 | Ga0207651_10013605 | Ga0207651_100136056 | 121 |
| 249 | 3300025960 | Ga0207651_11629148 | Ga0207651_116291481 | 121 |
| 250 | 3300026023 | Ga0207677_10003962 | Ga0207677_100039626 | 121 |
| 251 | 3300026041 | Ga0207639_10014276 | Ga0207639_100142766 | 121 |
| 252 | 3300026041 | Ga0207639_10037757 | Ga0207639_100377573 | 121 |
| 253 | 3300026067 | Ga0207678_10018264 | Ga0207678_100182648 | 121 |
| 254 | 3300026078 | Ga0207702_10040749 | Ga0207702_100407493 | 121 |
| 255 | 3300026078 | Ga0207702_10531557 | Ga0207702_105315572 | 121 |
| 256 | 3300026078 | Ga0207702_11188587 | Ga0207702_111885871 | 121 |
| 257 | 3300026089 | Ga0207648_10006336 | Ga0207648_100063368 | 121 |
| 258 | 3300026116 | Ga0207674_10013951 | Ga0207674_100139513 | 121 |
| 259 | 3300026116 | Ga0207674_10648236 | Ga0207674_106482362 | 121 |
| 260 | 3300026121 | Ga0207683_10006779 | Ga0207683_100067797 | 121 |
| 261 | 3300026121 | Ga0207683_10499177 | Ga0207683_104991772 | 121 |
| 262 | 3300026142 | Ga0207698_10033528 | Ga0207698_100335283 | 121 |
| 263 | 3300028379 | Ga0268266_10000053 | Ga0268266_10000053195 | 121 |
| 264 | 3300028800 | Ga0265338_10074593 | Ga0265338_100745932 | 121 |
| 265 | 3300033180 | Ga0307510_10013839 | Ga0307510_100138393 | 121 |
| 266 | 3300035111 | Ga0373923_0331243 | Ga0373923_0331243_177_548 | 121 |
| 267 | 3300035115 | Ga0373941_0012566 | Ga0373941_0012566_528_893 | 121 |
| 268 | 3300037312 | Ga0395899_0000453 | Ga0395899_0000453_2406_2771 | 121 |
| 269 | 3300037312 | Ga0395899_0002538 | Ga0395899_0002538_2602_2967 | 121 |
| 270 | 3300037312 | Ga0395899_0022066 | Ga0395899_0022066_1522_1887 | 121 |
| 271 | 3300037418 | Ga0395900_0000431 | Ga0395900_0000431_57205_57570 | 121 |
| 272 | 3300037418 | Ga0395900_0038965 | Ga0395900_0038965_2342_2707 | 121 |
| 273 | 3300037418 | Ga0395900_0334235 | Ga0395900_0334235_641_1057 | 121 |
| 274 | 3300037466 | Ga0395898_0027065 | Ga0395898_0027065_2866_3231 | 121 |
| 275 | 3300037471 | Ga0395905_0001649 | Ga0395905_0001649_23415_23780 | 121 |
| 276 | 3300037471 | Ga0395905_0009670 | Ga0395905_0009670_2459_2824 | 121 |
| 277 | 3300038443 | Ga0395901_0001158 | Ga0395901_0001158_3007_3372 | 121 |
| 278 | 3300038443 | Ga0395901_0039100 | Ga0395901_0039100_1699_2115 | 121 |
| 279 | 3300038443 | Ga0395901_0041273 | Ga0395901_0041273_2331_2696 | 121 |
| 280 | 3300041443 | Ga0451789_1067397 | Ga0451789_1067397_93_458 | 121 |
| 281 | 3300041452 | Ga0451793_0309094 | Ga0451793_0309094_31_396 | 121 |
| 282 | 3300041452 | Ga0451793_1848691 | Ga0451793_1848691_19_384 | 121 |
| 283 | 3300042005 | Ga0439448_0004511 | Ga0439448_0004511_2192_2557 | 121 |
| 284 | 3300042012 | Ga0439455_0027085 | Ga0439455_0027085_249_614 | 121 |
| 285 | 3300044684 | Ga0466966_0086008 | Ga0466966_0086008_1478_1843 | 121 |
| 286 | 3300044842 | Ga0466957_0236904 | Ga0466957_0236904_508_873 | 121 |
| 287 | 3300045049 | Ga0466959_0179400 | Ga0466959_0179400_891_1256 | 121 |
| 288 | 3300045049 | Ga0466959_0696563 | Ga0466959_0696563_152_517 | 121 |
| 289 | 3300046460 | Ga0495638_0206681 | Ga0495638_0206681_43_408 | 121 |
| 290 | 3300046471 | Ga0495650_0000023 | Ga0495650_0000023_414677_415042 | 121 |
| 291 | 3300046471 | Ga0495650_0046826 | Ga0495650_0046826_374_739 | 121 |
| 292 | 3300046492 | Ga0495585_0000629 | Ga0495585_0000629_17406_17771 | 121 |
| 293 | 3300046501 | Ga0495607_0163460 | Ga0495607_0163460_459_824 | 121 |
| 294 | 3300046507 | Ga0495606_0000448 | Ga0495606_0000448_21113_21478 | 121 |
| 295 | 3300046507 | Ga0495606_0008544 | Ga0495606_0008544_7391_7756 | 121 |
| 296 | 3300046507 | Ga0495606_0346556 | Ga0495606_0346556_81_446 | 121 |
| 297 | 3300046512 | Ga0495610_0001664 | Ga0495610_0001664_16001_16366 | 121 |
| 298 | 3300046513 | Ga0495616_0001269 | Ga0495616_0001269_1925_2290 | 121 |
| 299 | 3300046513 | Ga0495616_0008922 | Ga0495616_0008922_4444_4809 | 121 |
| 300 | 3300046519 | Ga0495632_0139120 | Ga0495632_0139120_625_990 | 121 |
| 301 | 3300046520 | Ga0495637_0088684 | Ga0495637_0088684_291_656 | 121 |
| 302 | 3300046520 | Ga0495637_0116533 | Ga0495637_0116533_583_948 | 121 |
| 303 | 3300046523 | Ga0495644_0020392 | Ga0495644_0020392_801_1166 | 121 |
| 304 | 3300046524 | Ga0495648_0068323 | Ga0495648_0068323_397_762 | 121 |
| 305 | 3300046529 | Ga0495652_0418287 | Ga0495652_0418287_257_622 | 121 |
| 306 | 3300046530 | Ga0495654_0160464 | Ga0495654_0160464_140_505 | 121 |
| 307 | 3300046538 | Ga0495609_0036292 | Ga0495609_0036292_384_749 | 121 |
| 308 | 3300046558 | Ga0495633_0004222 | Ga0495633_0004222_7258_7623 | 121 |
| 309 | 3300046660 | Ga0495625_0000018 | Ga0495625_0000018_128067_128432 | 121 |
| 310 | 3300046660 | Ga0495625_0012435 | Ga0495625_0012435_1894_2259 | 121 |
| 311 | 3300046660 | Ga0495625_0051947 | Ga0495625_0051947_1580_1945 | 121 |
| 312 | 3300046660 | Ga0495625_0069096 | Ga0495625_0069096_1109_1474 | 121 |
| 313 | 3300046660 | Ga0495625_0109983 | Ga0495625_0109983_1310_1675 | 121 |
| 314 | 3300046660 | Ga0495625_0517336 | Ga0495625_0517336_207_572 | 121 |
| 315 | 3300046665 | Ga0495661_0001731 | Ga0495661_0001731_17012_17377 | 121 |
| 316 | 3300046665 | Ga0495661_0090361 | Ga0495661_0090361_1113_1478 | 121 |
| 317 | 3300046684 | Ga0495669_0242627 | Ga0495669_0242627_26_391 | 121 |
| 318 | 3300046691 | Ga0495670_0409068 | Ga0495670_0409068_163_528 | 121 |
| 319 | 3300046692 | Ga0495671_0131137 | Ga0495671_0131137_539_904 | 121 |
| 320 | 3300046694 | Ga0495649_0000015 | Ga0495649_0000015_56568_56933 | 121 |
| 321 | 3300046694 | Ga0495649_0467099 | Ga0495649_0467099_81_446 | 121 |
| 322 | 3300046810 | Ga0495660_0007525 | Ga0495660_0007525_945_1310 | 121 |
| 323 | 3300047323 | Ga0495683_0009041 | Ga0495683_0009041_4110_4475 | 121 |
| 324 | 3300047443 | Ga0495687_006209 | Ga0495687_006209_3966_4331 | 121 |
| 325 | 3300047443 | Ga0495687_011194 | Ga0495687_011194_1790_2155 | 121 |
| 326 | 3300047469 | Ga0495673_0042298 | Ga0495673_0042298_756_1121 | 121 |
| 327 | 3300047472 | Ga0495686_0000303 | Ga0495686_0000303_82272_82637 | 121 |
| 328 | 3300047472 | Ga0495686_0005200 | Ga0495686_0005200_6641_7006 | 121 |
| 329 | 3300047472 | Ga0495686_0195064 | Ga0495686_0195064_57_422 | 121 |
| 330 | 3300047472 | Ga0495686_0389593 | Ga0495686_0389593_207_572 | 121 |
| 331 | 3300047472 | Ga0495686_0546569 | Ga0495686_0546569_214_579 | 121 |
| 332 | 3300048908 | Ga0496105_1079430 | Ga0496105_1079430_140_511 | 121 |
| 333 | 3300050493 | nmdc:mga0k408_4057_c1 | nmdc:mga0k408_4057_c1_2770_3135 | 121 |
| 334 | 3300050493 | nmdc:mga0k408_52982_c1 | nmdc:mga0k408_52982_c1_1739_2104 | 121 |
| 335 | 3300050493 | nmdc:mga0k408_59224_c1 | nmdc:mga0k408_59224_c1_1265_1630 | 121 |
| 336 | 3300050496 | nmdc:mga07m45_201033_c1 | nmdc:mga07m45_201033_c1_138_503 | 121 |
| 337 | 3300050496 | nmdc:mga07m45_289242_c1 | nmdc:mga07m45_289242_c1_244_609 | 121 |
| 338 | 3300053098 | Ga0500650_0347714 | Ga0500650_0347714_25_390 | 121 |
| 339 | 3300053122 | Ga0500608_007517 | Ga0500608_007517_2994_3359 | 121 |
| 340 | 3300053125 | Ga0500618_040265 | Ga0500618_040265_293_658 | 121 |
| 341 | 3300053130 | Ga0500642_0088644 | Ga0500642_0088644_787_1152 | 121 |
| 342 | 3300053140 | Ga0500573_0144382 | Ga0500573_0144382_94_459 | 121 |
| 343 | 3300053143 | Ga0500579_132437 | Ga0500579_132437_337_702 | 121 |
| 344 | 3300053156 | Ga0500622_0000860 | Ga0500622_0000860_17939_18304 | 121 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3ff4-assembly1.cif.gz_A | crystal structure of uncharacterized protein chu_1412 | 0.9805 | 1 | 121 |
| 2d5a-assembly1.cif.gz_A | hypothetical protein from pyrococcus horikoshii ot3 | 0.8934 | 2 | 112 |
| 1y81-assembly1.cif.gz_A | conserved hypothetical protein pfu-723267-001 from pyrococcus furiosus | 0.8806 | 4 | 114 |
| 3qa9-assembly1.cif.gz_A | crystal structure of prb (ph1109 protein redesigned for binding) | 0.8719 | 2 | 121 |
| 1iul-assembly1.cif.gz_A | the structure of cell-free id.343 from thermus thermophilus | 0.8704 | 3 | 121 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3ff4A00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9748 | 2 | 121 | 3.40.50.720 |
| 3ff4A00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9668 | 2 | 121 | 3.40.50.720 |
| 1iulA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.8704 | 3 | 121 | 3.40.50.720 |
| 1y81A00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.8682 | 4 | 114 | 3.40.50.720 |
| 1iulA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.8506 | 3 | 121 | 3.40.50.720 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7K0FT10-F1-model_v4 | CoA-binding protein | 1.004 | 4 | 121 |
|
| AF-A0A4Q6AXN0-F1-model_v4 | CoA-binding protein | 1.003 | 1 | 121 |
|
| AF-A0A0F8YEY5-F1-model_v4 | CoA-binding domain-containing protein | 0.9983 | 61 | 121 |
|
| AF-A0A4R1LXK8-F1-model_v4 | CoA-binding domain-containing protein | 0.9972 | 8 | 121 |
|
| AF-A0A520CTC5-F1-model_v4 | CoA-binding protein | 0.9966 | 4 | 64 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar