F415761
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 343 | 186 | 686 | 330 |
Family's Representative Sequence
| Representative Sequence | 3300050489|nmdc:mga03683_19539_c1|nmdc:mga03683_19539_c1_492_1538 |
| Length | 348 |
| Sequence | MTRRHSLPLGPLRKAVFGVALIAALGLSACGKKSAEPAAGAAPKELVFSILSAENQQSMGPLWQPLLDDMSAQIGVKVKPYFATNYTSLVEAMRFKQVQMGWFSAAPALEAINRADGEVLGRVVDAGGDATYKSVIIVKKGSGITLEKLLKCDRTLSFGLGDAQSTSGTLAPMAYLFTPKGIEPSKCFKTVRSASHQANAFSVANGVLDVATNNTVGLVFMRRQNAAAADKLEEPIWTSPPLPESSIVVRRDLDPALKEKIRQFFLTYGTGADAVGEKQREVLKGLAYGGFKPADNSYLDPVREMEAAEELAAAKRSGDAGKVAKAQAEFDKIKADADAHRAKESPAP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 2 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 3 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 4 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 5 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 6 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 7 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 8 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 9 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 10 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 13 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 20 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 21 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 22 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 24 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 26 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 27 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 28 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 29 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 30 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 31 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 32 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 33 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 35 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 36 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 37 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 38 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 39 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 40 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 41 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 42 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 43 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 44 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 45 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 46 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 47 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 48 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 49 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 50 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 51 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 52 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 53 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 54 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 55 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 56 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 57 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 58 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 59 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 60 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 61 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 62 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 89 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 93 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 94 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 95 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 96 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 97 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 98 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 99 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 100 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 101 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 102 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 103 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 104 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 105 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 106 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 107 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 108 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 109 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 110 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 111 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 112 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 113 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 114 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 115 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 116 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 117 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 118 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 119 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 120 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 121 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 122 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 142 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 143 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 144 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 145 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 146 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 147 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 148 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 149 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 150 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 151 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 152 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 153 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 154 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 155 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 156 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 157 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 158 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 159 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 160 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 161 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 162 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 163 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 164 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 165 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 166 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 167 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 168 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 169 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 170 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 171 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 172 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 173 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 174 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 175 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 176 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 177 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 178 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 179 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 180 | 2643221545 | Caulobacter sp. Root1455 | Isolate | Unclassified |
| 181 | 2643221552 | Caulobacter sp. Root1472 | Isolate | Unclassified |
| 182 | 2643221584 | Caulobacter sp. Root656 | Isolate | Unclassified |
| 183 | 2643221691 | Caulobacter sp. Root487D2Y | Isolate | Unclassified |
| 184 | 2739367756 | Asticcacaulis sp. CF398 | Isolate | Unclassified |
| 185 | 2818991435 | Caulobacter henricii 536 | Isolate | Unclassified |
| 186 | 2818991454 | Caulobacter rhizosphaerae 3260 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.67 |
| Metatranscriptomes | 0.29 |
| Isolates | 2.04 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 22.16 |
| Nodule | 0.29 |
| Rhizoplane | 3.79 |
| Rhizosphere | 67.64 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | nmdc:mga03683_19539_c1 | 3300050489 | Bacteria | 2143 |
| 2 | Ga0055537_1003016 | 3300003773 | Bacteria | 5318 |
| 3 | Ga0055524_1007648 | 3300003775 | Bacteria | 4568 |
| 4 | Ga0055528_1006087 | 3300003790 | Bacteria | 5513 |
| 5 | Ga0055530_10000543 | 3300003791 | Bacteria | 32746 |
| 6 | Ga0055530_10001731 | 3300003791 | Bacteria | 15324 |
| 7 | Ga0055531_10003109 | 3300003794 | Bacteria | 10718 |
| 8 | Ga0055531_10003676 | 3300003794 | Bacteria | 9665 |
| 9 | Ga0055543_1009183 | 3300004625 | Bacteria | 2142 |
| 10 | Ga0065165_1000702 | 3300005262 | Bacteria | 47623 |
| 11 | Ga0065165_1001536 | 3300005262 | Bacteria | 24140 |
| 12 | Ga0065165_1002345 | 3300005262 | Bacteria | 16457 |
| 13 | Ga0065715_10157540 | 3300005293 | Bacteria | 1661 |
| 14 | Ga0070658_10053705 | 3300005327 | Bacteria | 3271 |
| 15 | Ga0070670_100000022 | 3300005331 | Bacteria | 199146 |
| 16 | Ga0070670_100313407 | 3300005331 | Bacteria | 1374 |
| 17 | Ga0070680_100032591 | 3300005336 | Bacteria | 4195 |
| 18 | Ga0070680_100193846 | 3300005336 | Bacteria | 1713 |
| 19 | Ga0070668_100000395 | 3300005347 | Bacteria | 28917 |
| 20 | Ga0070668_100000902 | 3300005347 | Bacteria | 20661 |
| 21 | Ga0070668_100001880 | 3300005347 | Bacteria | 15351 |
| 22 | Ga0070669_100013438 | 3300005353 | Bacteria | 5820 |
| 23 | Ga0070669_100081175 | 3300005353 | Bacteria | 2415 |
| 24 | Ga0070671_100007353 | 3300005355 | Bacteria | 8798 |
| 25 | Ga0070671_100060758 | 3300005355 | Bacteria | 3146 |
| 26 | Ga0070673_100193424 | 3300005364 | Bacteria | 1748 |
| 27 | Ga0070659_100000916 | 3300005366 | Bacteria | 21579 |
| 28 | Ga0070659_100086585 | 3300005366 | Bacteria | 2507 |
| 29 | Ga0070667_100000292 | 3300005367 | Bacteria | 56417 |
| 30 | Ga0070667_100003693 | 3300005367 | Bacteria | 13027 |
| 31 | Ga0070667_100081771 | 3300005367 | Bacteria | 2764 |
| 32 | Ga0070681_10041572 | 3300005458 | Bacteria | 4607 |
| 33 | Ga0070681_10047153 | 3300005458 | Bacteria | 4307 |
| 34 | Ga0070681_10131550 | 3300005458 | Bacteria | 2434 |
| 35 | Ga0070679_100012222 | 3300005530 | Bacteria | 8202 |
| 36 | Ga0070679_100084683 | 3300005530 | Bacteria | 3158 |
| 37 | Ga0068853_100079738 | 3300005539 | Bacteria | 2863 |
| 38 | Ga0070665_100000157 | 3300005548 | Bacteria | 124344 |
| 39 | Ga0070665_100000689 | 3300005548 | Bacteria | 45116 |
| 40 | Ga0070665_100004075 | 3300005548 | Bacteria | 15363 |
| 41 | Ga0070665_100021797 | 3300005548 | Bacteria | 6441 |
| 42 | Ga0070665_100031118 | 3300005548 | Bacteria | 5371 |
| 43 | Ga0068855_100019526 | 3300005563 | Bacteria | 8142 |
| 44 | Ga0068855_100146971 | 3300005563 | Bacteria | 2682 |
| 45 | Ga0068855_100515519 | 3300005563 | Bacteria | 1298 |
| 46 | Ga0070664_100341163 | 3300005564 | Bacteria | 1361 |
| 47 | Ga0068857_100040524 | 3300005577 | Bacteria | 4130 |
| 48 | Ga0068852_100043916 | 3300005616 | Bacteria | 3793 |
| 49 | Ga0068859_100222560 | 3300005617 | Bacteria | 1975 |
| 50 | Ga0068864_100000131 | 3300005618 | Bacteria | 72744 |
| 51 | Ga0068864_100000522 | 3300005618 | Bacteria | 33095 |
| 52 | Ga0068864_100029033 | 3300005618 | Bacteria | 4679 |
| 53 | Ga0068863_100000076 | 3300005841 | Bacteria | 109412 |
| 54 | Ga0068863_100000266 | 3300005841 | Bacteria | 54663 |
| 55 | Ga0068863_100008614 | 3300005841 | Bacteria | 9970 |
| 56 | Ga0068863_100044510 | 3300005841 | Bacteria | 4214 |
| 57 | Ga0068858_100000079 | 3300005842 | Bacteria | 100753 |
| 58 | Ga0068858_100000500 | 3300005842 | Bacteria | 41083 |
| 59 | Ga0068858_100030377 | 3300005842 | Bacteria | 5017 |
| 60 | Ga0068860_100000136 | 3300005843 | Bacteria | 120083 |
| 61 | Ga0068860_100000212 | 3300005843 | Bacteria | 91248 |
| 62 | Ga0068860_100036094 | 3300005843 | Bacteria | 4738 |
| 63 | Ga0068860_100052731 | 3300005843 | Bacteria | 3868 |
| 64 | Ga0068862_100002821 | 3300005844 | Bacteria | 15242 |
| 65 | Ga0068862_100029089 | 3300005844 | Bacteria | 4654 |
| 66 | Ga0068862_100123688 | 3300005844 | Bacteria | 2282 |
| 67 | Ga0070717_10046160 | 3300006028 | Bacteria | 3564 |
| 68 | Ga0075363_100137579 | 3300006048 | Bacteria | 1373 |
| 69 | Ga0075364_10014800 | 3300006051 | Bacteria | 4826 |
| 70 | Ga0075366_10067973 | 3300006195 | Bacteria | 2121 |
| 71 | Ga0075366_10213196 | 3300006195 | Bacteria | 1176 |
| 72 | Ga0097621_100315007 | 3300006237 | Bacteria | 1385 |
| 73 | Ga0075370_10081770 | 3300006353 | Bacteria | 1857 |
| 74 | Ga0075370_10186467 | 3300006353 | Bacteria | 1221 |
| 75 | Ga0068865_100022396 | 3300006881 | Bacteria | 4122 |
| 76 | Ga0097620_100222562 | 3300006931 | Bacteria | 1975 |
| 77 | Ga0079104_1005369 | 3300006946 | Bacteria | 5140 |
| 78 | Ga0105240_10021982 | 3300009093 | Bacteria | 8473 |
| 79 | Ga0105240_10037542 | 3300009093 | Bacteria | 6225 |
| 80 | Ga0105240_10088974 | 3300009093 | Bacteria | 3777 |
| 81 | Ga0105242_10016915 | 3300009176 | Bacteria | 5675 |
| 82 | Ga0105248_10006919 | 3300009177 | Bacteria | 12428 |
| 83 | Ga0105248_10047949 | 3300009177 | Bacteria | 4791 |
| 84 | Ga0105248_10048937 | 3300009177 | Bacteria | 4741 |
| 85 | Ga0105248_10239524 | 3300009177 | Bacteria | 2042 |
| 86 | Ga0105248_10297951 | 3300009177 | Bacteria | 1816 |
| 87 | Ga0105238_10014977 | 3300009551 | Bacteria | 7852 |
| 88 | Ga0105238_10023558 | 3300009551 | Bacteria | 6273 |
| 89 | Ga0105238_10028622 | 3300009551 | Bacteria | 5676 |
| 90 | Ga0105238_10297823 | 3300009551 | Bacteria | 1596 |
| 91 | Ga0105249_10000296 | 3300009553 | Bacteria | 51256 |
| 92 | Ga0105249_10116903 | 3300009553 | Bacteria | 2529 |
| 93 | Ga0105249_10327638 | 3300009553 | Bacteria | 1544 |
| 94 | Ga0105239_10151117 | 3300010375 | Bacteria | 2591 |
| 95 | Ga0105239_10517704 | 3300010375 | Bacteria | 1357 |
| 96 | Ga0157370_10062209 | 3300013104 | Bacteria | 3541 |
| 97 | Ga0157369_10265393 | 3300013105 | Bacteria | 1790 |
| 98 | Ga0157369_10501120 | 3300013105 | Bacteria | 1256 |
| 99 | Ga0157369_10567121 | 3300013105 | Bacteria | 1173 |
| 100 | Ga0163162_10202728 | 3300013306 | Bacteria | 2113 |
| 101 | Ga0157372_10101599 | 3300013307 | Bacteria | 3283 |
| 102 | Ga0163163_10027235 | 3300014325 | Bacteria | 5473 |
| 103 | Ga0163163_10033743 | 3300014325 | Bacteria | 4953 |
| 104 | Ga0163163_10055245 | 3300014325 | Bacteria | 3925 |
| 105 | Ga0163163_10258689 | 3300014325 | Bacteria | 1791 |
| 106 | Ga0157379_10000416 | 3300014968 | Bacteria | 34546 |
| 107 | Ga0157379_10049129 | 3300014968 | Bacteria | 3766 |
| 108 | Ga0209026_1000727 | 3300025250 | Bacteria | 19294 |
| 109 | Ga0209026_1001921 | 3300025250 | Bacteria | 8405 |
| 110 | Ga0209565_1000287 | 3300025263 | Bacteria | 49357 |
| 111 | Ga0209673_1000855 | 3300025273 | Bacteria | 39566 |
| 112 | Ga0209675_1009044 | 3300025291 | Bacteria | 3566 |
| 113 | Ga0209564_1005854 | 3300025295 | Bacteria | 6838 |
| 114 | Ga0209564_1031917 | 3300025295 | Bacteria | 1597 |
| 115 | Ga0209758_1000984 | 3300025297 | Bacteria | 38314 |
| 116 | Ga0209758_1001915 | 3300025297 | Bacteria | 22656 |
| 117 | Ga0209758_1003450 | 3300025297 | Bacteria | 14357 |
| 118 | Ga0209050_1000053 | 3300025298 | Bacteria | 349521 |
| 119 | Ga0209050_1000073 | 3300025298 | Bacteria | 292046 |
| 120 | Ga0209050_1019308 | 3300025298 | Bacteria | 2594 |
| 121 | Ga0209257_1000036 | 3300025304 | Bacteria | 616006 |
| 122 | Ga0209257_1000099 | 3300025304 | Bacteria | 255304 |
| 123 | Ga0209257_1000316 | 3300025304 | Bacteria | 102171 |
| 124 | Ga0209257_1001003 | 3300025304 | Bacteria | 38243 |
| 125 | Ga0207705_10000635 | 3300025909 | Bacteria | 29374 |
| 126 | Ga0207705_10275305 | 3300025909 | Bacteria | 1287 |
| 127 | Ga0207707_10010929 | 3300025912 | Bacteria | 7895 |
| 128 | Ga0207707_10082922 | 3300025912 | Bacteria | 2799 |
| 129 | Ga0207695_10011248 | 3300025913 | Bacteria | 10851 |
| 130 | Ga0207695_10023356 | 3300025913 | Bacteria | 6988 |
| 131 | Ga0207695_10108905 | 3300025913 | Bacteria | 2754 |
| 132 | Ga0207695_10121250 | 3300025913 | Bacteria | 2582 |
| 133 | Ga0207660_10011956 | 3300025917 | Bacteria | 5666 |
| 134 | Ga0207660_10131840 | 3300025917 | Bacteria | 1903 |
| 135 | Ga0207657_10008316 | 3300025919 | Bacteria | 10557 |
| 136 | Ga0207657_10124250 | 3300025919 | Bacteria | 2120 |
| 137 | Ga0207652_10004863 | 3300025921 | Bacteria | 10881 |
| 138 | Ga0207694_10014969 | 3300025924 | Bacteria | 5849 |
| 139 | Ga0207694_10015927 | 3300025924 | Bacteria | 5673 |
| 140 | Ga0207694_10029559 | 3300025924 | Bacteria | 4182 |
| 141 | Ga0207650_10000234 | 3300025925 | Bacteria | 61636 |
| 142 | Ga0207650_10059612 | 3300025925 | Bacteria | 2846 |
| 143 | Ga0207644_10006126 | 3300025931 | Bacteria | 7845 |
| 144 | Ga0207644_10392951 | 3300025931 | Bacteria | 1132 |
| 145 | Ga0207690_10000196 | 3300025932 | Bacteria | 47111 |
| 146 | Ga0207690_10028339 | 3300025932 | Bacteria | 3550 |
| 147 | Ga0207686_10016505 | 3300025934 | Bacteria | 4145 |
| 148 | Ga0207704_10006022 | 3300025938 | Bacteria | 5623 |
| 149 | Ga0207711_10000097 | 3300025941 | Bacteria | 92721 |
| 150 | Ga0207711_10000979 | 3300025941 | Bacteria | 27387 |
| 151 | Ga0207711_10010553 | 3300025941 | Bacteria | 7677 |
| 152 | Ga0207711_10028511 | 3300025941 | Bacteria | 4698 |
| 153 | Ga0207711_10031981 | 3300025941 | Bacteria | 4446 |
| 154 | Ga0207711_10210099 | 3300025941 | Bacteria | 1778 |
| 155 | Ga0207679_10105648 | 3300025945 | Bacteria | 2212 |
| 156 | Ga0207667_10055266 | 3300025949 | Bacteria | 4174 |
| 157 | Ga0207667_10129752 | 3300025949 | Bacteria | 2596 |
| 158 | Ga0207667_10176201 | 3300025949 | Bacteria | 2197 |
| 159 | Ga0207667_10593494 | 3300025949 | Bacteria | 1117 |
| 160 | Ga0207651_10019751 | 3300025960 | Bacteria | 4048 |
| 161 | Ga0207712_10251650 | 3300025961 | Bacteria | 1428 |
| 162 | Ga0207668_10000042 | 3300025972 | Bacteria | 103877 |
| 163 | Ga0207668_10000090 | 3300025972 | Bacteria | 68790 |
| 164 | Ga0207668_10003671 | 3300025972 | Bacteria | 9021 |
| 165 | Ga0207668_10003905 | 3300025972 | Bacteria | 8786 |
| 166 | Ga0207668_10166392 | 3300025972 | Bacteria | 1724 |
| 167 | Ga0207658_10000326 | 3300025986 | Bacteria | 48082 |
| 168 | Ga0207658_10002221 | 3300025986 | Bacteria | 14418 |
| 169 | Ga0207677_10075671 | 3300026023 | Bacteria | 2394 |
| 170 | Ga0207703_10000051 | 3300026035 | Bacteria | 145390 |
| 171 | Ga0207703_10002541 | 3300026035 | Bacteria | 15765 |
| 172 | Ga0207703_10004406 | 3300026035 | Bacteria | 11582 |
| 173 | Ga0207703_10032119 | 3300026035 | Bacteria | 4155 |
| 174 | Ga0207641_10000003 | 3300026088 | Bacteria | 496984 |
| 175 | Ga0207641_10002068 | 3300026088 | Bacteria | 19042 |
| 176 | Ga0207641_10010056 | 3300026088 | Bacteria | 7779 |
| 177 | Ga0207641_10015131 | 3300026088 | Bacteria | 6322 |
| 178 | Ga0207641_10040636 | 3300026088 | Bacteria | 3895 |
| 179 | Ga0207676_10000055 | 3300026095 | Bacteria | 124678 |
| 180 | Ga0207676_10000223 | 3300026095 | Bacteria | 48952 |
| 181 | Ga0207676_10015352 | 3300026095 | Bacteria | 5521 |
| 182 | Ga0207674_10055631 | 3300026116 | Bacteria | 4022 |
| 183 | Ga0207698_10036363 | 3300026142 | Bacteria | 3614 |
| 184 | Ga0209999_1009691 | 3300027543 | Bacteria | 1738 |
| 185 | Ga0209813_10002978 | 3300027866 | Bacteria | 3923 |
| 186 | Ga0268266_10000003 | 3300028379 | Bacteria | 1701703 |
| 187 | Ga0268266_10000705 | 3300028379 | Bacteria | 45155 |
| 188 | Ga0268266_10105023 | 3300028379 | Bacteria | 2495 |
| 189 | Ga0268266_10190885 | 3300028379 | Bacteria | 1870 |
| 190 | Ga0268265_10002759 | 3300028380 | Bacteria | 12966 |
| 191 | Ga0268264_10000091 | 3300028381 | Bacteria | 233338 |
| 192 | Ga0268264_10000265 | 3300028381 | Bacteria | 92655 |
| 193 | Ga0268264_10018632 | 3300028381 | Bacteria | 5676 |
| 194 | Ga0268264_10276775 | 3300028381 | Bacteria | 1570 |
| 195 | Ga0307517_10000813 | 3300028786 | Bacteria | 53669 |
| 196 | Ga0307517_10113086 | 3300028786 | Bacteria | 2051 |
| 197 | Ga0307515_10265889 | 3300028794 | Bacteria | 1443 |
| 198 | Ga0265338_10238440 | 3300028800 | Bacteria | 1348 |
| 199 | Ga0307511_10050117 | 3300030521 | Bacteria | 3367 |
| 200 | Ga0265760_10037995 | 3300031090 | Bacteria | 1430 |
| 201 | Ga0265327_10019780 | 3300031251 | Bacteria | 4125 |
| 202 | Ga0307513_10000100 | 3300031456 | Bacteria | 125183 |
| 203 | Ga0307513_10000377 | 3300031456 | Bacteria | 64679 |
| 204 | Ga0307513_10001018 | 3300031456 | Bacteria | 40592 |
| 205 | Ga0307516_10000035 | 3300031730 | Bacteria | 152658 |
| 206 | Ga0307411_10331195 | 3300032005 | Bacteria | 1234 |
| 207 | Ga0307510_10009033 | 3300033180 | Bacteria | 11868 |
| 208 | Ga0373926_0024723 | 3300035083 | Bacteria | 2093 |
| 209 | Ga0373944_0016285 | 3300035089 | Bacteria | 2094 |
| 210 | Ga0373946_0120060 | 3300035171 | Bacteria | 1199 |
| 211 | Ga0373935_0029101 | 3300035692 | Bacteria | 3418 |
| 212 | Ga0373927_0002775 | 3300035695 | Bacteria | 12786 |
| 213 | Ga0373925_0000135 | 3300037068 | Bacteria | 78245 |
| 214 | Ga0395899_0000052 | 3300037312 | Bacteria | 221643 |
| 215 | Ga0395899_0026607 | 3300037312 | Bacteria | 4364 |
| 216 | Ga0395899_0123938 | 3300037312 | Bacteria | 1849 |
| 217 | Ga0395899_0178054 | 3300037312 | Bacteria | 1494 |
| 218 | Ga0395900_0000002 | 3300037418 | Bacteria | 671103 |
| 219 | Ga0395900_0020140 | 3300037418 | Bacteria | 6805 |
| 220 | Ga0395900_0177460 | 3300037418 | Bacteria | 2166 |
| 221 | Ga0395900_0212175 | 3300037418 | Bacteria | 1955 |
| 222 | Ga0395898_0003902 | 3300037466 | Bacteria | 16468 |
| 223 | Ga0395898_0060663 | 3300037466 | Bacteria | 3675 |
| 224 | Ga0395905_0039814 | 3300037471 | Bacteria | 4410 |
| 225 | Ga0395905_0057762 | 3300037471 | Bacteria | 3629 |
| 226 | Ga0395905_0073327 | 3300037471 | Bacteria | 3209 |
| 227 | Ga0395905_0081429 | 3300037471 | Bacteria | 3034 |
| 228 | Ga0395905_0128918 | 3300037471 | Bacteria | 2379 |
| 229 | Ga0395905_0530582 | 3300037471 | Bacteria | 1078 |
| 230 | Ga0395901_0000013 | 3300038443 | Bacteria | 375733 |
| 231 | Ga0395901_0176457 | 3300038443 | Bacteria | 2241 |
| 232 | Ga0436365_0369424 | 3300039437 | Bacteria | 2862 |
| 233 | Ga0439446_0001784 | 3300042156 | Bacteria | 5017 |
| 234 | Ga0495638_0002290 | 3300046460 | Bacteria | 15795 |
| 235 | Ga0495638_0011140 | 3300046460 | Bacteria | 6211 |
| 236 | Ga0495650_0066136 | 3300046471 | Bacteria | 1432 |
| 237 | Ga0495583_0000025 | 3300046506 | Bacteria | 263775 |
| 238 | Ga0495583_0024795 | 3300046506 | Bacteria | 3007 |
| 239 | Ga0495616_0007045 | 3300046513 | Bacteria | 6758 |
| 240 | Ga0495620_0008408 | 3300046515 | Bacteria | 5545 |
| 241 | Ga0495637_0040719 | 3300046520 | Bacteria | 1998 |
| 242 | Ga0495643_0030085 | 3300046522 | Bacteria | 3034 |
| 243 | Ga0495643_0085010 | 3300046522 | Bacteria | 1641 |
| 244 | Ga0495642_0009632 | 3300046528 | Bacteria | 3697 |
| 245 | Ga0495587_0216897 | 3300046536 | Bacteria | 1080 |
| 246 | Ga0495609_0033952 | 3300046538 | Bacteria | 2314 |
| 247 | Ga0495621_0003731 | 3300046539 | Bacteria | 4222 |
| 248 | Ga0495597_0013653 | 3300046542 | Bacteria | 3885 |
| 249 | Ga0495645_0026904 | 3300046543 | Bacteria | 4178 |
| 250 | Ga0495622_0014049 | 3300046557 | Bacteria | 3715 |
| 251 | Ga0495668_0005607 | 3300046616 | Bacteria | 8443 |
| 252 | Ga0495668_0018834 | 3300046616 | Bacteria | 3989 |
| 253 | Ga0495611_0002865 | 3300046648 | Bacteria | 7697 |
| 254 | Ga0495625_0000233 | 3300046660 | Bacteria | 86941 |
| 255 | Ga0495625_0032514 | 3300046660 | Bacteria | 3866 |
| 256 | Ga0495625_0071042 | 3300046660 | Bacteria | 2443 |
| 257 | Ga0495599_0162953 | 3300046678 | Bacteria | 1378 |
| 258 | Ga0495669_0000006 | 3300046684 | Bacteria | 190838 |
| 259 | Ga0495669_0000237 | 3300046684 | Bacteria | 32456 |
| 260 | Ga0495669_0011314 | 3300046684 | Bacteria | 3787 |
| 261 | Ga0495613_0001433 | 3300046689 | Bacteria | 18206 |
| 262 | Ga0495581_0058651 | 3300047315 | Bacteria | 2223 |
| 263 | Ga0495687_042060 | 3300047443 | Bacteria | 2000 |
| 264 | Ga0495679_005668 | 3300047446 | Bacteria | 5507 |
| 265 | Ga0495673_0000102 | 3300047469 | Bacteria | 173343 |
| 266 | Ga0495686_0016384 | 3300047472 | Bacteria | 5026 |
| 267 | Ga0495686_0044105 | 3300047472 | Bacteria | 2823 |
| 268 | Ga0495593_0145830 | 3300047673 | Bacteria | 1198 |
| 269 | Ga0496102_0017140 | 3300048905 | Bacteria | 6343 |
| 270 | Ga0496103_0034329 | 3300048906 | Bacteria | 3102 |
| 271 | Ga0496106_0022925 | 3300048909 | Bacteria | 4637 |
| 272 | Ga0496107_0000028 | 3300048910 | Bacteria | 105641 |
| 273 | Ga0496107_0113533 | 3300048910 | Bacteria | 1993 |
| 274 | Ga0496108_0087687 | 3300048911 | Bacteria | 2643 |
| 275 | Ga0496112_0010553 | 3300048915 | Bacteria | 8389 |
| 276 | Ga0496112_0247472 | 3300048915 | Bacteria | 1734 |
| 277 | Ga0496115_0009139 | 3300048918 | Bacteria | 7356 |
| 278 | Ga0496115_0017776 | 3300048918 | Bacteria | 5444 |
| 279 | Ga0496115_0079594 | 3300048918 | Bacteria | 2667 |
| 280 | Ga0496115_0108240 | 3300048918 | Bacteria | 2282 |
| 281 | Ga0496115_0109260 | 3300048918 | Bacteria | 2271 |
| 282 | Ga0496117_0014293 | 3300048920 | Bacteria | 6850 |
| 283 | Ga0496121_0000874 | 3300048924 | Bacteria | 54498 |
| 284 | Ga0496121_0001627 | 3300048924 | Bacteria | 37176 |
| 285 | Ga0501033_0006243 | 3300049570 | Bacteria | 9339 |
| 286 | Ga0501043_0151050 | 3300049579 | Bacteria | 1818 |
| 287 | Ga0501047_0009801 | 3300049581 | Bacteria | 9052 |
| 288 | Ga0501047_0015970 | 3300049581 | Bacteria | 7159 |
| 289 | Ga0501047_0098910 | 3300049581 | Bacteria | 2796 |
| 290 | Ga0501047_0131488 | 3300049581 | Bacteria | 2383 |
| 291 | Ga0501047_0397262 | 3300049581 | Bacteria | 1212 |
| 292 | Ga0501257_000402 | 3300049686 | Bacteria | 8450 |
| 293 | Ga0501044_0003386 | 3300049823 | Bacteria | 17962 |
| 294 | Ga0501044_0028059 | 3300049823 | Bacteria | 5940 |
| 295 | nmdc:mga00v17_1499_c1 | 3300050491 | Bacteria | 12193 |
| 296 | nmdc:mga0k408_92538_c1 | 3300050493 | Bacteria | 1777 |
| 297 | nmdc:mga06z11_9322_c1 | 3300050494 | Bacteria | 4132 |
| 298 | nmdc:mga04h51_3263_c1 | 3300050495 | Bacteria | 3923 |
| 299 | nmdc:mga07m45_101316_c1 | 3300050496 | Bacteria | 1653 |
| 300 | nmdc:mga07m45_3735_c1 | 3300050496 | Bacteria | 7370 |
| 301 | Ga0500635_0000659 | 3300053080 | Bacteria | 8776 |
| 302 | Ga0500643_000633 | 3300053087 | Bacteria | 23691 |
| 303 | Ga0500643_004778 | 3300053087 | Bacteria | 6003 |
| 304 | Ga0500643_045035 | 3300053087 | Bacteria | 1280 |
| 305 | Ga0500566_0148077 | 3300053094 | Bacteria | 1238 |
| 306 | Ga0500641_0000233 | 3300053096 | Bacteria | 20852 |
| 307 | Ga0500641_0000841 | 3300053096 | Bacteria | 11070 |
| 308 | Ga0500650_0178831 | 3300053098 | Bacteria | 972 |
| 309 | Ga0500555_014197 | 3300053103 | Bacteria | 2296 |
| 310 | Ga0500556_0001837 | 3300053104 | Bacteria | 7741 |
| 311 | Ga0500556_0027944 | 3300053104 | Bacteria | 1889 |
| 312 | Ga0500562_000482 | 3300053108 | Bacteria | 9663 |
| 313 | Ga0500562_000574 | 3300053108 | Bacteria | 8810 |
| 314 | Ga0500562_013925 | 3300053108 | Bacteria | 2057 |
| 315 | Ga0500595_011196 | 3300053119 | Bacteria | 3523 |
| 316 | Ga0500595_057773 | 3300053119 | Bacteria | 1181 |
| 317 | Ga0500608_000246 | 3300053122 | Bacteria | 21323 |
| 318 | Ga0500618_000299 | 3300053125 | Bacteria | 37630 |
| 319 | Ga0500658_0115621 | 3300053134 | Bacteria | 1185 |
| 320 | Ga0500559_0000048 | 3300053136 | Bacteria | 93755 |
| 321 | Ga0500559_0000271 | 3300053136 | Bacteria | 40434 |
| 322 | Ga0500559_0006853 | 3300053136 | Bacteria | 5107 |
| 323 | Ga0500559_0036141 | 3300053136 | Bacteria | 2135 |
| 324 | Ga0500577_0085778 | 3300053142 | Bacteria | 1264 |
| 325 | Ga0500616_0035660 | 3300053153 | Bacteria | 2704 |
| 326 | Ga0500622_0006244 | 3300053156 | Bacteria | 6964 |
| 327 | Ga0500622_0023321 | 3300053156 | Bacteria | 3277 |
| 328 | Ga0500636_0157515 | 3300053177 | Bacteria | 1241 |
| 329 | Ga0500637_0017665 | 3300053178 | Bacteria | 3822 |
| 330 | Ga0500637_0134038 | 3300053178 | Bacteria | 1435 |
| 331 | Ga0500625_036548 | 3300053729 | Bacteria | 2324 |
| 332 | Ga0500645_000264 | 3300053730 | Bacteria | 37805 |
| 333 | Ga0500645_000275 | 3300053730 | Bacteria | 36860 |
| 334 | Ga0500645_002129 | 3300053730 | Bacteria | 9109 |
| 335 | Ga0500645_012676 | 3300053730 | Bacteria | 2722 |
| 336 | Ga0500645_022346 | 3300053730 | Bacteria | 1947 |
| 337 | 2643749020 | 2643221545 | Bacteria | 5083237 |
| 338 | 2643779826 | 2643221552 | Bacteria | 5708754 |
| 339 | 2643930224 | 2643221584 | Bacteria | 5511711 |
| 340 | 2644509220 | 2643221691 | Bacteria | 5093099 |
| 341 | 2739792623 | 2739367756 | Bacteria | 4553612 |
| 342 | 2819537575 | 2818991435 | Bacteria | 5433759 |
| 343 | 2819647351 | 2818991454 | Bacteria | 5563326 |
| 344 | nmdc:mga03683_19539_c1 | |||
| 345 | Ga0055537_1003016 | |||
| 346 | Ga0055524_1007648 | |||
| 347 | Ga0055528_1006087 | |||
| 348 | Ga0055530_10000543 | |||
| 349 | Ga0055530_10001731 | |||
| 350 | Ga0055531_10003109 | |||
| 351 | Ga0055531_10003676 | |||
| 352 | Ga0055543_1009183 | |||
| 353 | Ga0065165_1000702 | |||
| 354 | Ga0065165_1001536 | |||
| 355 | Ga0065165_1002345 | |||
| 356 | Ga0065715_10157540 | |||
| 357 | Ga0070658_10053705 | |||
| 358 | Ga0070670_100000022 | |||
| 359 | Ga0070670_100313407 | |||
| 360 | Ga0070680_100032591 | |||
| 361 | Ga0070680_100193846 | |||
| 362 | Ga0070668_100000395 | |||
| 363 | Ga0070668_100000902 | |||
| 364 | Ga0070668_100001880 | |||
| 365 | Ga0070669_100013438 | |||
| 366 | Ga0070669_100081175 | |||
| 367 | Ga0070671_100007353 | |||
| 368 | Ga0070671_100060758 | |||
| 369 | Ga0070673_100193424 | |||
| 370 | Ga0070659_100000916 | |||
| 371 | Ga0070659_100086585 | |||
| 372 | Ga0070667_100000292 | |||
| 373 | Ga0070667_100003693 | |||
| 374 | Ga0070667_100081771 | |||
| 375 | Ga0070681_10041572 | |||
| 376 | Ga0070681_10047153 | |||
| 377 | Ga0070681_10131550 | |||
| 378 | Ga0070679_100012222 | |||
| 379 | Ga0070679_100084683 | |||
| 380 | Ga0068853_100079738 | |||
| 381 | Ga0070665_100000157 | |||
| 382 | Ga0070665_100000689 | |||
| 383 | Ga0070665_100004075 | |||
| 384 | Ga0070665_100021797 | |||
| 385 | Ga0070665_100031118 | |||
| 386 | Ga0068855_100019526 | |||
| 387 | Ga0068855_100146971 | |||
| 388 | Ga0068855_100515519 | |||
| 389 | Ga0070664_100341163 | |||
| 390 | Ga0068857_100040524 | |||
| 391 | Ga0068852_100043916 | |||
| 392 | Ga0068859_100222560 | |||
| 393 | Ga0068864_100000131 | |||
| 394 | Ga0068864_100000522 | |||
| 395 | Ga0068864_100029033 | |||
| 396 | Ga0068863_100000076 | |||
| 397 | Ga0068863_100000266 | |||
| 398 | Ga0068863_100008614 | |||
| 399 | Ga0068863_100044510 | |||
| 400 | Ga0068858_100000079 | |||
| 401 | Ga0068858_100000500 | |||
| 402 | Ga0068858_100030377 | |||
| 403 | Ga0068860_100000136 | |||
| 404 | Ga0068860_100000212 | |||
| 405 | Ga0068860_100036094 | |||
| 406 | Ga0068860_100052731 | |||
| 407 | Ga0068862_100002821 | |||
| 408 | Ga0068862_100029089 | |||
| 409 | Ga0068862_100123688 | |||
| 410 | Ga0070717_10046160 | |||
| 411 | Ga0075363_100137579 | |||
| 412 | Ga0075364_10014800 | |||
| 413 | Ga0075366_10067973 | |||
| 414 | Ga0075366_10213196 | |||
| 415 | Ga0097621_100315007 | |||
| 416 | Ga0075370_10081770 | |||
| 417 | Ga0075370_10186467 | |||
| 418 | Ga0068865_100022396 | |||
| 419 | Ga0097620_100222562 | |||
| 420 | Ga0079104_1005369 | |||
| 421 | Ga0105240_10021982 | |||
| 422 | Ga0105240_10037542 | |||
| 423 | Ga0105240_10088974 | |||
| 424 | Ga0105242_10016915 | |||
| 425 | Ga0105248_10006919 | |||
| 426 | Ga0105248_10047949 | |||
| 427 | Ga0105248_10048937 | |||
| 428 | Ga0105248_10239524 | |||
| 429 | Ga0105248_10297951 | |||
| 430 | Ga0105238_10014977 | |||
| 431 | Ga0105238_10023558 | |||
| 432 | Ga0105238_10028622 | |||
| 433 | Ga0105238_10297823 | |||
| 434 | Ga0105249_10000296 | |||
| 435 | Ga0105249_10116903 | |||
| 436 | Ga0105249_10327638 | |||
| 437 | Ga0105239_10151117 | |||
| 438 | Ga0105239_10517704 | |||
| 439 | Ga0157370_10062209 | |||
| 440 | Ga0157369_10265393 | |||
| 441 | Ga0157369_10501120 | |||
| 442 | Ga0157369_10567121 | |||
| 443 | Ga0163162_10202728 | |||
| 444 | Ga0157372_10101599 | |||
| 445 | Ga0163163_10027235 | |||
| 446 | Ga0163163_10033743 | |||
| 447 | Ga0163163_10055245 | |||
| 448 | Ga0163163_10258689 | |||
| 449 | Ga0157379_10000416 | |||
| 450 | Ga0157379_10049129 | |||
| 451 | Ga0209026_1000727 | |||
| 452 | Ga0209026_1001921 | |||
| 453 | Ga0209565_1000287 | |||
| 454 | Ga0209673_1000855 | |||
| 455 | Ga0209675_1009044 | |||
| 456 | Ga0209564_1005854 | |||
| 457 | Ga0209564_1031917 | |||
| 458 | Ga0209758_1000984 | |||
| 459 | Ga0209758_1001915 | |||
| 460 | Ga0209758_1003450 | |||
| 461 | Ga0209050_1000053 | |||
| 462 | Ga0209050_1000073 | |||
| 463 | Ga0209050_1019308 | |||
| 464 | Ga0209257_1000036 | |||
| 465 | Ga0209257_1000099 | |||
| 466 | Ga0209257_1000316 | |||
| 467 | Ga0209257_1001003 | |||
| 468 | Ga0207705_10000635 | |||
| 469 | Ga0207705_10275305 | |||
| 470 | Ga0207707_10010929 | |||
| 471 | Ga0207707_10082922 | |||
| 472 | Ga0207695_10011248 | |||
| 473 | Ga0207695_10023356 | |||
| 474 | Ga0207695_10108905 | |||
| 475 | Ga0207695_10121250 | |||
| 476 | Ga0207660_10011956 | |||
| 477 | Ga0207660_10131840 | |||
| 478 | Ga0207657_10008316 | |||
| 479 | Ga0207657_10124250 | |||
| 480 | Ga0207652_10004863 | |||
| 481 | Ga0207694_10014969 | |||
| 482 | Ga0207694_10015927 | |||
| 483 | Ga0207694_10029559 | |||
| 484 | Ga0207650_10000234 | |||
| 485 | Ga0207650_10059612 | |||
| 486 | Ga0207644_10006126 | |||
| 487 | Ga0207644_10392951 | |||
| 488 | Ga0207690_10000196 | |||
| 489 | Ga0207690_10028339 | |||
| 490 | Ga0207686_10016505 | |||
| 491 | Ga0207704_10006022 | |||
| 492 | Ga0207711_10000097 | |||
| 493 | Ga0207711_10000979 | |||
| 494 | Ga0207711_10010553 | |||
| 495 | Ga0207711_10028511 | |||
| 496 | Ga0207711_10031981 | |||
| 497 | Ga0207711_10210099 | |||
| 498 | Ga0207679_10105648 | |||
| 499 | Ga0207667_10055266 | |||
| 500 | Ga0207667_10129752 | |||
| 501 | Ga0207667_10176201 | |||
| 502 | Ga0207667_10593494 | |||
| 503 | Ga0207651_10019751 | |||
| 504 | Ga0207712_10251650 | |||
| 505 | Ga0207668_10000042 | |||
| 506 | Ga0207668_10000090 | |||
| 507 | Ga0207668_10003671 | |||
| 508 | Ga0207668_10003905 | |||
| 509 | Ga0207668_10166392 | |||
| 510 | Ga0207658_10000326 | |||
| 511 | Ga0207658_10002221 | |||
| 512 | Ga0207677_10075671 | |||
| 513 | Ga0207703_10000051 | |||
| 514 | Ga0207703_10002541 | |||
| 515 | Ga0207703_10004406 | |||
| 516 | Ga0207703_10032119 | |||
| 517 | Ga0207641_10000003 | |||
| 518 | Ga0207641_10002068 | |||
| 519 | Ga0207641_10010056 | |||
| 520 | Ga0207641_10015131 | |||
| 521 | Ga0207641_10040636 | |||
| 522 | Ga0207676_10000055 | |||
| 523 | Ga0207676_10000223 | |||
| 524 | Ga0207676_10015352 | |||
| 525 | Ga0207674_10055631 | |||
| 526 | Ga0207698_10036363 | |||
| 527 | Ga0209999_1009691 | |||
| 528 | Ga0209813_10002978 | |||
| 529 | Ga0268266_10000003 | |||
| 530 | Ga0268266_10000705 | |||
| 531 | Ga0268266_10105023 | |||
| 532 | Ga0268266_10190885 | |||
| 533 | Ga0268265_10002759 | |||
| 534 | Ga0268264_10000091 | |||
| 535 | Ga0268264_10000265 | |||
| 536 | Ga0268264_10018632 | |||
| 537 | Ga0268264_10276775 | |||
| 538 | Ga0307517_10000813 | |||
| 539 | Ga0307517_10113086 | |||
| 540 | Ga0307515_10265889 | |||
| 541 | Ga0265338_10238440 | |||
| 542 | Ga0307511_10050117 | |||
| 543 | Ga0265760_10037995 | |||
| 544 | Ga0265327_10019780 | |||
| 545 | Ga0307513_10000100 | |||
| 546 | Ga0307513_10000377 | |||
| 547 | Ga0307513_10001018 | |||
| 548 | Ga0307516_10000035 | |||
| 549 | Ga0307411_10331195 | |||
| 550 | Ga0307510_10009033 | |||
| 551 | Ga0373926_0024723 | |||
| 552 | Ga0373944_0016285 | |||
| 553 | Ga0373946_0120060 | |||
| 554 | Ga0373935_0029101 | |||
| 555 | Ga0373927_0002775 | |||
| 556 | Ga0373925_0000135 | |||
| 557 | Ga0395899_0000052 | |||
| 558 | Ga0395899_0026607 | |||
| 559 | Ga0395899_0123938 | |||
| 560 | Ga0395899_0178054 | |||
| 561 | Ga0395900_0000002 | |||
| 562 | Ga0395900_0020140 | |||
| 563 | Ga0395900_0177460 | |||
| 564 | Ga0395900_0212175 | |||
| 565 | Ga0395898_0003902 | |||
| 566 | Ga0395898_0060663 | |||
| 567 | Ga0395905_0039814 | |||
| 568 | Ga0395905_0057762 | |||
| 569 | Ga0395905_0073327 | |||
| 570 | Ga0395905_0081429 | |||
| 571 | Ga0395905_0128918 | |||
| 572 | Ga0395905_0530582 | |||
| 573 | Ga0395901_0000013 | |||
| 574 | Ga0395901_0176457 | |||
| 575 | Ga0436365_0369424 | |||
| 576 | Ga0439446_0001784 | |||
| 577 | Ga0495638_0002290 | |||
| 578 | Ga0495638_0011140 | |||
| 579 | Ga0495650_0066136 | |||
| 580 | Ga0495583_0000025 | |||
| 581 | Ga0495583_0024795 | |||
| 582 | Ga0495616_0007045 | |||
| 583 | Ga0495620_0008408 | |||
| 584 | Ga0495637_0040719 | |||
| 585 | Ga0495643_0030085 | |||
| 586 | Ga0495643_0085010 | |||
| 587 | Ga0495642_0009632 | |||
| 588 | Ga0495587_0216897 | |||
| 589 | Ga0495609_0033952 | |||
| 590 | Ga0495621_0003731 | |||
| 591 | Ga0495597_0013653 | |||
| 592 | Ga0495645_0026904 | |||
| 593 | Ga0495622_0014049 | |||
| 594 | Ga0495668_0005607 | |||
| 595 | Ga0495668_0018834 | |||
| 596 | Ga0495611_0002865 | |||
| 597 | Ga0495625_0000233 | |||
| 598 | Ga0495625_0032514 | |||
| 599 | Ga0495625_0071042 | |||
| 600 | Ga0495599_0162953 | |||
| 601 | Ga0495669_0000006 | |||
| 602 | Ga0495669_0000237 | |||
| 603 | Ga0495669_0011314 | |||
| 604 | Ga0495613_0001433 | |||
| 605 | Ga0495581_0058651 | |||
| 606 | Ga0495687_042060 | |||
| 607 | Ga0495679_005668 | |||
| 608 | Ga0495673_0000102 | |||
| 609 | Ga0495686_0016384 | |||
| 610 | Ga0495686_0044105 | |||
| 611 | Ga0495593_0145830 | |||
| 612 | Ga0496102_0017140 | |||
| 613 | Ga0496103_0034329 | |||
| 614 | Ga0496106_0022925 | |||
| 615 | Ga0496107_0000028 | |||
| 616 | Ga0496107_0113533 | |||
| 617 | Ga0496108_0087687 | |||
| 618 | Ga0496112_0010553 | |||
| 619 | Ga0496112_0247472 | |||
| 620 | Ga0496115_0009139 | |||
| 621 | Ga0496115_0017776 | |||
| 622 | Ga0496115_0079594 | |||
| 623 | Ga0496115_0108240 | |||
| 624 | Ga0496115_0109260 | |||
| 625 | Ga0496117_0014293 | |||
| 626 | Ga0496121_0000874 | |||
| 627 | Ga0496121_0001627 | |||
| 628 | Ga0501033_0006243 | |||
| 629 | Ga0501043_0151050 | |||
| 630 | Ga0501047_0009801 | |||
| 631 | Ga0501047_0015970 | |||
| 632 | Ga0501047_0098910 | |||
| 633 | Ga0501047_0131488 | |||
| 634 | Ga0501047_0397262 | |||
| 635 | Ga0501257_000402 | |||
| 636 | Ga0501044_0003386 | |||
| 637 | Ga0501044_0028059 | |||
| 638 | nmdc:mga00v17_1499_c1 | |||
| 639 | nmdc:mga0k408_92538_c1 | |||
| 640 | nmdc:mga06z11_9322_c1 | |||
| 641 | nmdc:mga04h51_3263_c1 | |||
| 642 | nmdc:mga07m45_101316_c1 | |||
| 643 | nmdc:mga07m45_3735_c1 | |||
| 644 | Ga0500635_0000659 | |||
| 645 | Ga0500643_000633 | |||
| 646 | Ga0500643_004778 | |||
| 647 | Ga0500643_045035 | |||
| 648 | Ga0500566_0148077 | |||
| 649 | Ga0500641_0000233 | |||
| 650 | Ga0500641_0000841 | |||
| 651 | Ga0500650_0178831 | |||
| 652 | Ga0500555_014197 | |||
| 653 | Ga0500556_0001837 | |||
| 654 | Ga0500556_0027944 | |||
| 655 | Ga0500562_000482 | |||
| 656 | Ga0500562_000574 | |||
| 657 | Ga0500562_013925 | |||
| 658 | Ga0500595_011196 | |||
| 659 | Ga0500595_057773 | |||
| 660 | Ga0500608_000246 | |||
| 661 | Ga0500618_000299 | |||
| 662 | Ga0500658_0115621 | |||
| 663 | Ga0500559_0000048 | |||
| 664 | Ga0500559_0000271 | |||
| 665 | Ga0500559_0006853 | |||
| 666 | Ga0500559_0036141 | |||
| 667 | Ga0500577_0085778 | |||
| 668 | Ga0500616_0035660 | |||
| 669 | Ga0500622_0006244 | |||
| 670 | Ga0500622_0023321 | |||
| 671 | Ga0500636_0157515 | |||
| 672 | Ga0500637_0017665 | |||
| 673 | Ga0500637_0134038 | |||
| 674 | Ga0500625_036548 | |||
| 675 | Ga0500645_000264 | |||
| 676 | Ga0500645_000275 | |||
| 677 | Ga0500645_002129 | |||
| 678 | Ga0500645_012676 | |||
| 679 | Ga0500645_022346 | |||
| 680 | 2643749020 | |||
| 681 | 2643779826 | |||
| 682 | 2643930224 | |||
| 683 | 2644509220 | |||
| 684 | 2739792623 | |||
| 685 | 2819537575 | |||
| 686 | 2819647351 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
PF12974
Phosphonate-bd
ABC transporter, phosphonate, periplasmic substrate-binding protein
48
299
0.98
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2yxh-assembly1.cif.gz_B | crystal structure of mazg-related protein from thermotoga maritima | 0.9554 | 276 | 319 |
| 3quj-assembly1.cif.gz_A | crystal structure of the phosphonate binding protein, phnd, from escherichia coli | 0.9512 | 25 | 321 |
| 6j2l-assembly1.cif.gz_B | crystal structure of bi-functional enzyme | 0.9503 | 277 | 317 |
| 1cpq-assembly1.cif.gz_A | cytochrome c' from rhodopseudomonas capsulata | 0.9465 | 276 | 317 |
| 3quj-assembly2.cif.gz_C | crystal structure of the phosphonate binding protein, phnd, from escherichia coli | 0.9453 | 25 | 321 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A0A1D6E5W7_1_92_1.20.120.290 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Oxygen-evolving enhancer protein 3 (PsbQ), four-helix up-down bundle | 0.9557 | 277 | 319 | 1.20.120.290 |
| af_K7MSJ4_110_274_3.90.1600.10 | Alpha Beta;Alpha-Beta Complex;Palm domain of DNA polymerase;B family DNA polymerase, palm domain | 0.9502 | 277 | 319 | 3.90.1600.10 |
| af_Q23194_451_1026_1.25.40.10 | Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain | 0.9488 | 277 | 317 | 1.25.40.10 |
| 1yzmA00 | Few Secondary Structures;Irregular;DNA Excision Repair, Uvrb; Chain A;Rabenosyn, Rab binding domain | 0.9389 | 280 | 321 | 4.10.860.20 |
| af_Q2G1L7_48_134_3.40.190.10 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.9281 | 26 | 93 | 3.40.190.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A658IC04-F1-model_v4 | Phosphonate ABC transporter substrate-binding protein | 0.9588 | 78 | 288 |
GO:0015716
GO:0030313 GO:0043190 GO:0055085 |
| AF-A0A658IC04-F1-model_v4 | Phosphonate ABC transporter substrate-binding protein | 0.9497 | 78 | 288 |
GO:0015716
GO:0030313 GO:0043190 GO:0055085 |
| AF-A0A5D0MJI8-F1-model_v4 | Phosphonate ABC transporter substrate-binding protein | 0.9421 | 15 | 319 |
GO:0015716
GO:0043190 GO:0055085 |
| AF-A0A1V4X780-F1-model_v4 | Phosphate-import protein PhnD | 0.9343 | 65 | 292 |
GO:0015716
GO:0043190 GO:0055085 |
| AF-A0A524GRR3-F1-model_v4 | Phosphate/phosphite/phosphonate ABC transporter substrate-binding protein | 0.9306 | 24 | 288 |
GO:0043190
GO:0055085 |