F415761

General Info

Members Datasets Scaffolds Average Seq Length
343 186 686 330

Family's Representative Sequence

Representative Sequence 3300050489|nmdc:mga03683_19539_c1|nmdc:mga03683_19539_c1_492_1538
Length 348
Sequence MTRRHSLPLGPLRKAVFGVALIAALGLSACGKKSAEPAAGAAPKELVFSILSAENQQSMGPLWQPLLDDMSAQIGVKVKPYFATNYTSLVEAMRFKQVQMGWFSAAPALEAINRADGEVLGRVVDAGGDATYKSVIIVKKGSGITLEKLLKCDRTLSFGLGDAQSTSGTLAPMAYLFTPKGIEPSKCFKTVRSASHQANAFSVANGVLDVATNNTVGLVFMRRQNAAAADKLEEPIWTSPPLPESSIVVRRDLDPALKEKIRQFFLTYGTGADAVGEKQREVLKGLAYGGFKPADNSYLDPVREMEAAEELAAAKRSGDAGKVAKAQAEFDKIKADADAHRAKESPAP

Samples

Sample ID Description Type Environment
1 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
2 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
3 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
4 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
5 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
6 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
7 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
8 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
9 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
20 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
21 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
22 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
23 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
24 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
25 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
26 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
27 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
28 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
29 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
30 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
31 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
32 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
33 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
34 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
35 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
36 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
37 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
38 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
39 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
40 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
41 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
42 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
43 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
44 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
45 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
46 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
47 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
48 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
49 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
50 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
51 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
52 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
53 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
54 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
55 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
56 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
57 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
58 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
59 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
60 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
61 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
62 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
88 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
89 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
93 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
94 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
95 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
96 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
97 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
98 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
99 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
100 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
101 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
102 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
103 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
104 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
105 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
106 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
107 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
108 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
109 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
110 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
111 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
112 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
113 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
114 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
115 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
116 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
117 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
118 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
119 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
120 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
121 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
122 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
123 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
124 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
125 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
126 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
127 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
128 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
129 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
130 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
131 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
132 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
133 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
134 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
135 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
136 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
137 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
138 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
139 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
140 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
141 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
142 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
143 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
144 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
145 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
146 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
147 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
148 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
149 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
150 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
151 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
152 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
153 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
154 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
155 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
156 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
157 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
158 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
159 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
160 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
161 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
162 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
163 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
164 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
165 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
166 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
167 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
168 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
169 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
170 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
171 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
172 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
173 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
174 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
175 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
176 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
177 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
178 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
179 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
180 2643221545 Caulobacter sp. Root1455 Isolate Unclassified
181 2643221552 Caulobacter sp. Root1472 Isolate Unclassified
182 2643221584 Caulobacter sp. Root656 Isolate Unclassified
183 2643221691 Caulobacter sp. Root487D2Y Isolate Unclassified
184 2739367756 Asticcacaulis sp. CF398 Isolate Unclassified
185 2818991435 Caulobacter henricii 536 Isolate Unclassified
186 2818991454 Caulobacter rhizosphaerae 3260 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.67
Metatranscriptomes 0.29
Isolates 2.04

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 22.16
Nodule 0.29
Rhizoplane 3.79
Rhizosphere 67.64
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga03683_19539_c1 3300050489 Bacteria 2143
2 Ga0055537_1003016 3300003773 Bacteria 5318
3 Ga0055524_1007648 3300003775 Bacteria 4568
4 Ga0055528_1006087 3300003790 Bacteria 5513
5 Ga0055530_10000543 3300003791 Bacteria 32746
6 Ga0055530_10001731 3300003791 Bacteria 15324
7 Ga0055531_10003109 3300003794 Bacteria 10718
8 Ga0055531_10003676 3300003794 Bacteria 9665
9 Ga0055543_1009183 3300004625 Bacteria 2142
10 Ga0065165_1000702 3300005262 Bacteria 47623
11 Ga0065165_1001536 3300005262 Bacteria 24140
12 Ga0065165_1002345 3300005262 Bacteria 16457
13 Ga0065715_10157540 3300005293 Bacteria 1661
14 Ga0070658_10053705 3300005327 Bacteria 3271
15 Ga0070670_100000022 3300005331 Bacteria 199146
16 Ga0070670_100313407 3300005331 Bacteria 1374
17 Ga0070680_100032591 3300005336 Bacteria 4195
18 Ga0070680_100193846 3300005336 Bacteria 1713
19 Ga0070668_100000395 3300005347 Bacteria 28917
20 Ga0070668_100000902 3300005347 Bacteria 20661
21 Ga0070668_100001880 3300005347 Bacteria 15351
22 Ga0070669_100013438 3300005353 Bacteria 5820
23 Ga0070669_100081175 3300005353 Bacteria 2415
24 Ga0070671_100007353 3300005355 Bacteria 8798
25 Ga0070671_100060758 3300005355 Bacteria 3146
26 Ga0070673_100193424 3300005364 Bacteria 1748
27 Ga0070659_100000916 3300005366 Bacteria 21579
28 Ga0070659_100086585 3300005366 Bacteria 2507
29 Ga0070667_100000292 3300005367 Bacteria 56417
30 Ga0070667_100003693 3300005367 Bacteria 13027
31 Ga0070667_100081771 3300005367 Bacteria 2764
32 Ga0070681_10041572 3300005458 Bacteria 4607
33 Ga0070681_10047153 3300005458 Bacteria 4307
34 Ga0070681_10131550 3300005458 Bacteria 2434
35 Ga0070679_100012222 3300005530 Bacteria 8202
36 Ga0070679_100084683 3300005530 Bacteria 3158
37 Ga0068853_100079738 3300005539 Bacteria 2863
38 Ga0070665_100000157 3300005548 Bacteria 124344
39 Ga0070665_100000689 3300005548 Bacteria 45116
40 Ga0070665_100004075 3300005548 Bacteria 15363
41 Ga0070665_100021797 3300005548 Bacteria 6441
42 Ga0070665_100031118 3300005548 Bacteria 5371
43 Ga0068855_100019526 3300005563 Bacteria 8142
44 Ga0068855_100146971 3300005563 Bacteria 2682
45 Ga0068855_100515519 3300005563 Bacteria 1298
46 Ga0070664_100341163 3300005564 Bacteria 1361
47 Ga0068857_100040524 3300005577 Bacteria 4130
48 Ga0068852_100043916 3300005616 Bacteria 3793
49 Ga0068859_100222560 3300005617 Bacteria 1975
50 Ga0068864_100000131 3300005618 Bacteria 72744
51 Ga0068864_100000522 3300005618 Bacteria 33095
52 Ga0068864_100029033 3300005618 Bacteria 4679
53 Ga0068863_100000076 3300005841 Bacteria 109412
54 Ga0068863_100000266 3300005841 Bacteria 54663
55 Ga0068863_100008614 3300005841 Bacteria 9970
56 Ga0068863_100044510 3300005841 Bacteria 4214
57 Ga0068858_100000079 3300005842 Bacteria 100753
58 Ga0068858_100000500 3300005842 Bacteria 41083
59 Ga0068858_100030377 3300005842 Bacteria 5017
60 Ga0068860_100000136 3300005843 Bacteria 120083
61 Ga0068860_100000212 3300005843 Bacteria 91248
62 Ga0068860_100036094 3300005843 Bacteria 4738
63 Ga0068860_100052731 3300005843 Bacteria 3868
64 Ga0068862_100002821 3300005844 Bacteria 15242
65 Ga0068862_100029089 3300005844 Bacteria 4654
66 Ga0068862_100123688 3300005844 Bacteria 2282
67 Ga0070717_10046160 3300006028 Bacteria 3564
68 Ga0075363_100137579 3300006048 Bacteria 1373
69 Ga0075364_10014800 3300006051 Bacteria 4826
70 Ga0075366_10067973 3300006195 Bacteria 2121
71 Ga0075366_10213196 3300006195 Bacteria 1176
72 Ga0097621_100315007 3300006237 Bacteria 1385
73 Ga0075370_10081770 3300006353 Bacteria 1857
74 Ga0075370_10186467 3300006353 Bacteria 1221
75 Ga0068865_100022396 3300006881 Bacteria 4122
76 Ga0097620_100222562 3300006931 Bacteria 1975
77 Ga0079104_1005369 3300006946 Bacteria 5140
78 Ga0105240_10021982 3300009093 Bacteria 8473
79 Ga0105240_10037542 3300009093 Bacteria 6225
80 Ga0105240_10088974 3300009093 Bacteria 3777
81 Ga0105242_10016915 3300009176 Bacteria 5675
82 Ga0105248_10006919 3300009177 Bacteria 12428
83 Ga0105248_10047949 3300009177 Bacteria 4791
84 Ga0105248_10048937 3300009177 Bacteria 4741
85 Ga0105248_10239524 3300009177 Bacteria 2042
86 Ga0105248_10297951 3300009177 Bacteria 1816
87 Ga0105238_10014977 3300009551 Bacteria 7852
88 Ga0105238_10023558 3300009551 Bacteria 6273
89 Ga0105238_10028622 3300009551 Bacteria 5676
90 Ga0105238_10297823 3300009551 Bacteria 1596
91 Ga0105249_10000296 3300009553 Bacteria 51256
92 Ga0105249_10116903 3300009553 Bacteria 2529
93 Ga0105249_10327638 3300009553 Bacteria 1544
94 Ga0105239_10151117 3300010375 Bacteria 2591
95 Ga0105239_10517704 3300010375 Bacteria 1357
96 Ga0157370_10062209 3300013104 Bacteria 3541
97 Ga0157369_10265393 3300013105 Bacteria 1790
98 Ga0157369_10501120 3300013105 Bacteria 1256
99 Ga0157369_10567121 3300013105 Bacteria 1173
100 Ga0163162_10202728 3300013306 Bacteria 2113
101 Ga0157372_10101599 3300013307 Bacteria 3283
102 Ga0163163_10027235 3300014325 Bacteria 5473
103 Ga0163163_10033743 3300014325 Bacteria 4953
104 Ga0163163_10055245 3300014325 Bacteria 3925
105 Ga0163163_10258689 3300014325 Bacteria 1791
106 Ga0157379_10000416 3300014968 Bacteria 34546
107 Ga0157379_10049129 3300014968 Bacteria 3766
108 Ga0209026_1000727 3300025250 Bacteria 19294
109 Ga0209026_1001921 3300025250 Bacteria 8405
110 Ga0209565_1000287 3300025263 Bacteria 49357
111 Ga0209673_1000855 3300025273 Bacteria 39566
112 Ga0209675_1009044 3300025291 Bacteria 3566
113 Ga0209564_1005854 3300025295 Bacteria 6838
114 Ga0209564_1031917 3300025295 Bacteria 1597
115 Ga0209758_1000984 3300025297 Bacteria 38314
116 Ga0209758_1001915 3300025297 Bacteria 22656
117 Ga0209758_1003450 3300025297 Bacteria 14357
118 Ga0209050_1000053 3300025298 Bacteria 349521
119 Ga0209050_1000073 3300025298 Bacteria 292046
120 Ga0209050_1019308 3300025298 Bacteria 2594
121 Ga0209257_1000036 3300025304 Bacteria 616006
122 Ga0209257_1000099 3300025304 Bacteria 255304
123 Ga0209257_1000316 3300025304 Bacteria 102171
124 Ga0209257_1001003 3300025304 Bacteria 38243
125 Ga0207705_10000635 3300025909 Bacteria 29374
126 Ga0207705_10275305 3300025909 Bacteria 1287
127 Ga0207707_10010929 3300025912 Bacteria 7895
128 Ga0207707_10082922 3300025912 Bacteria 2799
129 Ga0207695_10011248 3300025913 Bacteria 10851
130 Ga0207695_10023356 3300025913 Bacteria 6988
131 Ga0207695_10108905 3300025913 Bacteria 2754
132 Ga0207695_10121250 3300025913 Bacteria 2582
133 Ga0207660_10011956 3300025917 Bacteria 5666
134 Ga0207660_10131840 3300025917 Bacteria 1903
135 Ga0207657_10008316 3300025919 Bacteria 10557
136 Ga0207657_10124250 3300025919 Bacteria 2120
137 Ga0207652_10004863 3300025921 Bacteria 10881
138 Ga0207694_10014969 3300025924 Bacteria 5849
139 Ga0207694_10015927 3300025924 Bacteria 5673
140 Ga0207694_10029559 3300025924 Bacteria 4182
141 Ga0207650_10000234 3300025925 Bacteria 61636
142 Ga0207650_10059612 3300025925 Bacteria 2846
143 Ga0207644_10006126 3300025931 Bacteria 7845
144 Ga0207644_10392951 3300025931 Bacteria 1132
145 Ga0207690_10000196 3300025932 Bacteria 47111
146 Ga0207690_10028339 3300025932 Bacteria 3550
147 Ga0207686_10016505 3300025934 Bacteria 4145
148 Ga0207704_10006022 3300025938 Bacteria 5623
149 Ga0207711_10000097 3300025941 Bacteria 92721
150 Ga0207711_10000979 3300025941 Bacteria 27387
151 Ga0207711_10010553 3300025941 Bacteria 7677
152 Ga0207711_10028511 3300025941 Bacteria 4698
153 Ga0207711_10031981 3300025941 Bacteria 4446
154 Ga0207711_10210099 3300025941 Bacteria 1778
155 Ga0207679_10105648 3300025945 Bacteria 2212
156 Ga0207667_10055266 3300025949 Bacteria 4174
157 Ga0207667_10129752 3300025949 Bacteria 2596
158 Ga0207667_10176201 3300025949 Bacteria 2197
159 Ga0207667_10593494 3300025949 Bacteria 1117
160 Ga0207651_10019751 3300025960 Bacteria 4048
161 Ga0207712_10251650 3300025961 Bacteria 1428
162 Ga0207668_10000042 3300025972 Bacteria 103877
163 Ga0207668_10000090 3300025972 Bacteria 68790
164 Ga0207668_10003671 3300025972 Bacteria 9021
165 Ga0207668_10003905 3300025972 Bacteria 8786
166 Ga0207668_10166392 3300025972 Bacteria 1724
167 Ga0207658_10000326 3300025986 Bacteria 48082
168 Ga0207658_10002221 3300025986 Bacteria 14418
169 Ga0207677_10075671 3300026023 Bacteria 2394
170 Ga0207703_10000051 3300026035 Bacteria 145390
171 Ga0207703_10002541 3300026035 Bacteria 15765
172 Ga0207703_10004406 3300026035 Bacteria 11582
173 Ga0207703_10032119 3300026035 Bacteria 4155
174 Ga0207641_10000003 3300026088 Bacteria 496984
175 Ga0207641_10002068 3300026088 Bacteria 19042
176 Ga0207641_10010056 3300026088 Bacteria 7779
177 Ga0207641_10015131 3300026088 Bacteria 6322
178 Ga0207641_10040636 3300026088 Bacteria 3895
179 Ga0207676_10000055 3300026095 Bacteria 124678
180 Ga0207676_10000223 3300026095 Bacteria 48952
181 Ga0207676_10015352 3300026095 Bacteria 5521
182 Ga0207674_10055631 3300026116 Bacteria 4022
183 Ga0207698_10036363 3300026142 Bacteria 3614
184 Ga0209999_1009691 3300027543 Bacteria 1738
185 Ga0209813_10002978 3300027866 Bacteria 3923
186 Ga0268266_10000003 3300028379 Bacteria 1701703
187 Ga0268266_10000705 3300028379 Bacteria 45155
188 Ga0268266_10105023 3300028379 Bacteria 2495
189 Ga0268266_10190885 3300028379 Bacteria 1870
190 Ga0268265_10002759 3300028380 Bacteria 12966
191 Ga0268264_10000091 3300028381 Bacteria 233338
192 Ga0268264_10000265 3300028381 Bacteria 92655
193 Ga0268264_10018632 3300028381 Bacteria 5676
194 Ga0268264_10276775 3300028381 Bacteria 1570
195 Ga0307517_10000813 3300028786 Bacteria 53669
196 Ga0307517_10113086 3300028786 Bacteria 2051
197 Ga0307515_10265889 3300028794 Bacteria 1443
198 Ga0265338_10238440 3300028800 Bacteria 1348
199 Ga0307511_10050117 3300030521 Bacteria 3367
200 Ga0265760_10037995 3300031090 Bacteria 1430
201 Ga0265327_10019780 3300031251 Bacteria 4125
202 Ga0307513_10000100 3300031456 Bacteria 125183
203 Ga0307513_10000377 3300031456 Bacteria 64679
204 Ga0307513_10001018 3300031456 Bacteria 40592
205 Ga0307516_10000035 3300031730 Bacteria 152658
206 Ga0307411_10331195 3300032005 Bacteria 1234
207 Ga0307510_10009033 3300033180 Bacteria 11868
208 Ga0373926_0024723 3300035083 Bacteria 2093
209 Ga0373944_0016285 3300035089 Bacteria 2094
210 Ga0373946_0120060 3300035171 Bacteria 1199
211 Ga0373935_0029101 3300035692 Bacteria 3418
212 Ga0373927_0002775 3300035695 Bacteria 12786
213 Ga0373925_0000135 3300037068 Bacteria 78245
214 Ga0395899_0000052 3300037312 Bacteria 221643
215 Ga0395899_0026607 3300037312 Bacteria 4364
216 Ga0395899_0123938 3300037312 Bacteria 1849
217 Ga0395899_0178054 3300037312 Bacteria 1494
218 Ga0395900_0000002 3300037418 Bacteria 671103
219 Ga0395900_0020140 3300037418 Bacteria 6805
220 Ga0395900_0177460 3300037418 Bacteria 2166
221 Ga0395900_0212175 3300037418 Bacteria 1955
222 Ga0395898_0003902 3300037466 Bacteria 16468
223 Ga0395898_0060663 3300037466 Bacteria 3675
224 Ga0395905_0039814 3300037471 Bacteria 4410
225 Ga0395905_0057762 3300037471 Bacteria 3629
226 Ga0395905_0073327 3300037471 Bacteria 3209
227 Ga0395905_0081429 3300037471 Bacteria 3034
228 Ga0395905_0128918 3300037471 Bacteria 2379
229 Ga0395905_0530582 3300037471 Bacteria 1078
230 Ga0395901_0000013 3300038443 Bacteria 375733
231 Ga0395901_0176457 3300038443 Bacteria 2241
232 Ga0436365_0369424 3300039437 Bacteria 2862
233 Ga0439446_0001784 3300042156 Bacteria 5017
234 Ga0495638_0002290 3300046460 Bacteria 15795
235 Ga0495638_0011140 3300046460 Bacteria 6211
236 Ga0495650_0066136 3300046471 Bacteria 1432
237 Ga0495583_0000025 3300046506 Bacteria 263775
238 Ga0495583_0024795 3300046506 Bacteria 3007
239 Ga0495616_0007045 3300046513 Bacteria 6758
240 Ga0495620_0008408 3300046515 Bacteria 5545
241 Ga0495637_0040719 3300046520 Bacteria 1998
242 Ga0495643_0030085 3300046522 Bacteria 3034
243 Ga0495643_0085010 3300046522 Bacteria 1641
244 Ga0495642_0009632 3300046528 Bacteria 3697
245 Ga0495587_0216897 3300046536 Bacteria 1080
246 Ga0495609_0033952 3300046538 Bacteria 2314
247 Ga0495621_0003731 3300046539 Bacteria 4222
248 Ga0495597_0013653 3300046542 Bacteria 3885
249 Ga0495645_0026904 3300046543 Bacteria 4178
250 Ga0495622_0014049 3300046557 Bacteria 3715
251 Ga0495668_0005607 3300046616 Bacteria 8443
252 Ga0495668_0018834 3300046616 Bacteria 3989
253 Ga0495611_0002865 3300046648 Bacteria 7697
254 Ga0495625_0000233 3300046660 Bacteria 86941
255 Ga0495625_0032514 3300046660 Bacteria 3866
256 Ga0495625_0071042 3300046660 Bacteria 2443
257 Ga0495599_0162953 3300046678 Bacteria 1378
258 Ga0495669_0000006 3300046684 Bacteria 190838
259 Ga0495669_0000237 3300046684 Bacteria 32456
260 Ga0495669_0011314 3300046684 Bacteria 3787
261 Ga0495613_0001433 3300046689 Bacteria 18206
262 Ga0495581_0058651 3300047315 Bacteria 2223
263 Ga0495687_042060 3300047443 Bacteria 2000
264 Ga0495679_005668 3300047446 Bacteria 5507
265 Ga0495673_0000102 3300047469 Bacteria 173343
266 Ga0495686_0016384 3300047472 Bacteria 5026
267 Ga0495686_0044105 3300047472 Bacteria 2823
268 Ga0495593_0145830 3300047673 Bacteria 1198
269 Ga0496102_0017140 3300048905 Bacteria 6343
270 Ga0496103_0034329 3300048906 Bacteria 3102
271 Ga0496106_0022925 3300048909 Bacteria 4637
272 Ga0496107_0000028 3300048910 Bacteria 105641
273 Ga0496107_0113533 3300048910 Bacteria 1993
274 Ga0496108_0087687 3300048911 Bacteria 2643
275 Ga0496112_0010553 3300048915 Bacteria 8389
276 Ga0496112_0247472 3300048915 Bacteria 1734
277 Ga0496115_0009139 3300048918 Bacteria 7356
278 Ga0496115_0017776 3300048918 Bacteria 5444
279 Ga0496115_0079594 3300048918 Bacteria 2667
280 Ga0496115_0108240 3300048918 Bacteria 2282
281 Ga0496115_0109260 3300048918 Bacteria 2271
282 Ga0496117_0014293 3300048920 Bacteria 6850
283 Ga0496121_0000874 3300048924 Bacteria 54498
284 Ga0496121_0001627 3300048924 Bacteria 37176
285 Ga0501033_0006243 3300049570 Bacteria 9339
286 Ga0501043_0151050 3300049579 Bacteria 1818
287 Ga0501047_0009801 3300049581 Bacteria 9052
288 Ga0501047_0015970 3300049581 Bacteria 7159
289 Ga0501047_0098910 3300049581 Bacteria 2796
290 Ga0501047_0131488 3300049581 Bacteria 2383
291 Ga0501047_0397262 3300049581 Bacteria 1212
292 Ga0501257_000402 3300049686 Bacteria 8450
293 Ga0501044_0003386 3300049823 Bacteria 17962
294 Ga0501044_0028059 3300049823 Bacteria 5940
295 nmdc:mga00v17_1499_c1 3300050491 Bacteria 12193
296 nmdc:mga0k408_92538_c1 3300050493 Bacteria 1777
297 nmdc:mga06z11_9322_c1 3300050494 Bacteria 4132
298 nmdc:mga04h51_3263_c1 3300050495 Bacteria 3923
299 nmdc:mga07m45_101316_c1 3300050496 Bacteria 1653
300 nmdc:mga07m45_3735_c1 3300050496 Bacteria 7370
301 Ga0500635_0000659 3300053080 Bacteria 8776
302 Ga0500643_000633 3300053087 Bacteria 23691
303 Ga0500643_004778 3300053087 Bacteria 6003
304 Ga0500643_045035 3300053087 Bacteria 1280
305 Ga0500566_0148077 3300053094 Bacteria 1238
306 Ga0500641_0000233 3300053096 Bacteria 20852
307 Ga0500641_0000841 3300053096 Bacteria 11070
308 Ga0500650_0178831 3300053098 Bacteria 972
309 Ga0500555_014197 3300053103 Bacteria 2296
310 Ga0500556_0001837 3300053104 Bacteria 7741
311 Ga0500556_0027944 3300053104 Bacteria 1889
312 Ga0500562_000482 3300053108 Bacteria 9663
313 Ga0500562_000574 3300053108 Bacteria 8810
314 Ga0500562_013925 3300053108 Bacteria 2057
315 Ga0500595_011196 3300053119 Bacteria 3523
316 Ga0500595_057773 3300053119 Bacteria 1181
317 Ga0500608_000246 3300053122 Bacteria 21323
318 Ga0500618_000299 3300053125 Bacteria 37630
319 Ga0500658_0115621 3300053134 Bacteria 1185
320 Ga0500559_0000048 3300053136 Bacteria 93755
321 Ga0500559_0000271 3300053136 Bacteria 40434
322 Ga0500559_0006853 3300053136 Bacteria 5107
323 Ga0500559_0036141 3300053136 Bacteria 2135
324 Ga0500577_0085778 3300053142 Bacteria 1264
325 Ga0500616_0035660 3300053153 Bacteria 2704
326 Ga0500622_0006244 3300053156 Bacteria 6964
327 Ga0500622_0023321 3300053156 Bacteria 3277
328 Ga0500636_0157515 3300053177 Bacteria 1241
329 Ga0500637_0017665 3300053178 Bacteria 3822
330 Ga0500637_0134038 3300053178 Bacteria 1435
331 Ga0500625_036548 3300053729 Bacteria 2324
332 Ga0500645_000264 3300053730 Bacteria 37805
333 Ga0500645_000275 3300053730 Bacteria 36860
334 Ga0500645_002129 3300053730 Bacteria 9109
335 Ga0500645_012676 3300053730 Bacteria 2722
336 Ga0500645_022346 3300053730 Bacteria 1947
337 2643749020 2643221545 Bacteria 5083237
338 2643779826 2643221552 Bacteria 5708754
339 2643930224 2643221584 Bacteria 5511711
340 2644509220 2643221691 Bacteria 5093099
341 2739792623 2739367756 Bacteria 4553612
342 2819537575 2818991435 Bacteria 5433759
343 2819647351 2818991454 Bacteria 5563326
344 nmdc:mga03683_19539_c1
345 Ga0055537_1003016
346 Ga0055524_1007648
347 Ga0055528_1006087
348 Ga0055530_10000543
349 Ga0055530_10001731
350 Ga0055531_10003109
351 Ga0055531_10003676
352 Ga0055543_1009183
353 Ga0065165_1000702
354 Ga0065165_1001536
355 Ga0065165_1002345
356 Ga0065715_10157540
357 Ga0070658_10053705
358 Ga0070670_100000022
359 Ga0070670_100313407
360 Ga0070680_100032591
361 Ga0070680_100193846
362 Ga0070668_100000395
363 Ga0070668_100000902
364 Ga0070668_100001880
365 Ga0070669_100013438
366 Ga0070669_100081175
367 Ga0070671_100007353
368 Ga0070671_100060758
369 Ga0070673_100193424
370 Ga0070659_100000916
371 Ga0070659_100086585
372 Ga0070667_100000292
373 Ga0070667_100003693
374 Ga0070667_100081771
375 Ga0070681_10041572
376 Ga0070681_10047153
377 Ga0070681_10131550
378 Ga0070679_100012222
379 Ga0070679_100084683
380 Ga0068853_100079738
381 Ga0070665_100000157
382 Ga0070665_100000689
383 Ga0070665_100004075
384 Ga0070665_100021797
385 Ga0070665_100031118
386 Ga0068855_100019526
387 Ga0068855_100146971
388 Ga0068855_100515519
389 Ga0070664_100341163
390 Ga0068857_100040524
391 Ga0068852_100043916
392 Ga0068859_100222560
393 Ga0068864_100000131
394 Ga0068864_100000522
395 Ga0068864_100029033
396 Ga0068863_100000076
397 Ga0068863_100000266
398 Ga0068863_100008614
399 Ga0068863_100044510
400 Ga0068858_100000079
401 Ga0068858_100000500
402 Ga0068858_100030377
403 Ga0068860_100000136
404 Ga0068860_100000212
405 Ga0068860_100036094
406 Ga0068860_100052731
407 Ga0068862_100002821
408 Ga0068862_100029089
409 Ga0068862_100123688
410 Ga0070717_10046160
411 Ga0075363_100137579
412 Ga0075364_10014800
413 Ga0075366_10067973
414 Ga0075366_10213196
415 Ga0097621_100315007
416 Ga0075370_10081770
417 Ga0075370_10186467
418 Ga0068865_100022396
419 Ga0097620_100222562
420 Ga0079104_1005369
421 Ga0105240_10021982
422 Ga0105240_10037542
423 Ga0105240_10088974
424 Ga0105242_10016915
425 Ga0105248_10006919
426 Ga0105248_10047949
427 Ga0105248_10048937
428 Ga0105248_10239524
429 Ga0105248_10297951
430 Ga0105238_10014977
431 Ga0105238_10023558
432 Ga0105238_10028622
433 Ga0105238_10297823
434 Ga0105249_10000296
435 Ga0105249_10116903
436 Ga0105249_10327638
437 Ga0105239_10151117
438 Ga0105239_10517704
439 Ga0157370_10062209
440 Ga0157369_10265393
441 Ga0157369_10501120
442 Ga0157369_10567121
443 Ga0163162_10202728
444 Ga0157372_10101599
445 Ga0163163_10027235
446 Ga0163163_10033743
447 Ga0163163_10055245
448 Ga0163163_10258689
449 Ga0157379_10000416
450 Ga0157379_10049129
451 Ga0209026_1000727
452 Ga0209026_1001921
453 Ga0209565_1000287
454 Ga0209673_1000855
455 Ga0209675_1009044
456 Ga0209564_1005854
457 Ga0209564_1031917
458 Ga0209758_1000984
459 Ga0209758_1001915
460 Ga0209758_1003450
461 Ga0209050_1000053
462 Ga0209050_1000073
463 Ga0209050_1019308
464 Ga0209257_1000036
465 Ga0209257_1000099
466 Ga0209257_1000316
467 Ga0209257_1001003
468 Ga0207705_10000635
469 Ga0207705_10275305
470 Ga0207707_10010929
471 Ga0207707_10082922
472 Ga0207695_10011248
473 Ga0207695_10023356
474 Ga0207695_10108905
475 Ga0207695_10121250
476 Ga0207660_10011956
477 Ga0207660_10131840
478 Ga0207657_10008316
479 Ga0207657_10124250
480 Ga0207652_10004863
481 Ga0207694_10014969
482 Ga0207694_10015927
483 Ga0207694_10029559
484 Ga0207650_10000234
485 Ga0207650_10059612
486 Ga0207644_10006126
487 Ga0207644_10392951
488 Ga0207690_10000196
489 Ga0207690_10028339
490 Ga0207686_10016505
491 Ga0207704_10006022
492 Ga0207711_10000097
493 Ga0207711_10000979
494 Ga0207711_10010553
495 Ga0207711_10028511
496 Ga0207711_10031981
497 Ga0207711_10210099
498 Ga0207679_10105648
499 Ga0207667_10055266
500 Ga0207667_10129752
501 Ga0207667_10176201
502 Ga0207667_10593494
503 Ga0207651_10019751
504 Ga0207712_10251650
505 Ga0207668_10000042
506 Ga0207668_10000090
507 Ga0207668_10003671
508 Ga0207668_10003905
509 Ga0207668_10166392
510 Ga0207658_10000326
511 Ga0207658_10002221
512 Ga0207677_10075671
513 Ga0207703_10000051
514 Ga0207703_10002541
515 Ga0207703_10004406
516 Ga0207703_10032119
517 Ga0207641_10000003
518 Ga0207641_10002068
519 Ga0207641_10010056
520 Ga0207641_10015131
521 Ga0207641_10040636
522 Ga0207676_10000055
523 Ga0207676_10000223
524 Ga0207676_10015352
525 Ga0207674_10055631
526 Ga0207698_10036363
527 Ga0209999_1009691
528 Ga0209813_10002978
529 Ga0268266_10000003
530 Ga0268266_10000705
531 Ga0268266_10105023
532 Ga0268266_10190885
533 Ga0268265_10002759
534 Ga0268264_10000091
535 Ga0268264_10000265
536 Ga0268264_10018632
537 Ga0268264_10276775
538 Ga0307517_10000813
539 Ga0307517_10113086
540 Ga0307515_10265889
541 Ga0265338_10238440
542 Ga0307511_10050117
543 Ga0265760_10037995
544 Ga0265327_10019780
545 Ga0307513_10000100
546 Ga0307513_10000377
547 Ga0307513_10001018
548 Ga0307516_10000035
549 Ga0307411_10331195
550 Ga0307510_10009033
551 Ga0373926_0024723
552 Ga0373944_0016285
553 Ga0373946_0120060
554 Ga0373935_0029101
555 Ga0373927_0002775
556 Ga0373925_0000135
557 Ga0395899_0000052
558 Ga0395899_0026607
559 Ga0395899_0123938
560 Ga0395899_0178054
561 Ga0395900_0000002
562 Ga0395900_0020140
563 Ga0395900_0177460
564 Ga0395900_0212175
565 Ga0395898_0003902
566 Ga0395898_0060663
567 Ga0395905_0039814
568 Ga0395905_0057762
569 Ga0395905_0073327
570 Ga0395905_0081429
571 Ga0395905_0128918
572 Ga0395905_0530582
573 Ga0395901_0000013
574 Ga0395901_0176457
575 Ga0436365_0369424
576 Ga0439446_0001784
577 Ga0495638_0002290
578 Ga0495638_0011140
579 Ga0495650_0066136
580 Ga0495583_0000025
581 Ga0495583_0024795
582 Ga0495616_0007045
583 Ga0495620_0008408
584 Ga0495637_0040719
585 Ga0495643_0030085
586 Ga0495643_0085010
587 Ga0495642_0009632
588 Ga0495587_0216897
589 Ga0495609_0033952
590 Ga0495621_0003731
591 Ga0495597_0013653
592 Ga0495645_0026904
593 Ga0495622_0014049
594 Ga0495668_0005607
595 Ga0495668_0018834
596 Ga0495611_0002865
597 Ga0495625_0000233
598 Ga0495625_0032514
599 Ga0495625_0071042
600 Ga0495599_0162953
601 Ga0495669_0000006
602 Ga0495669_0000237
603 Ga0495669_0011314
604 Ga0495613_0001433
605 Ga0495581_0058651
606 Ga0495687_042060
607 Ga0495679_005668
608 Ga0495673_0000102
609 Ga0495686_0016384
610 Ga0495686_0044105
611 Ga0495593_0145830
612 Ga0496102_0017140
613 Ga0496103_0034329
614 Ga0496106_0022925
615 Ga0496107_0000028
616 Ga0496107_0113533
617 Ga0496108_0087687
618 Ga0496112_0010553
619 Ga0496112_0247472
620 Ga0496115_0009139
621 Ga0496115_0017776
622 Ga0496115_0079594
623 Ga0496115_0108240
624 Ga0496115_0109260
625 Ga0496117_0014293
626 Ga0496121_0000874
627 Ga0496121_0001627
628 Ga0501033_0006243
629 Ga0501043_0151050
630 Ga0501047_0009801
631 Ga0501047_0015970
632 Ga0501047_0098910
633 Ga0501047_0131488
634 Ga0501047_0397262
635 Ga0501257_000402
636 Ga0501044_0003386
637 Ga0501044_0028059
638 nmdc:mga00v17_1499_c1
639 nmdc:mga0k408_92538_c1
640 nmdc:mga06z11_9322_c1
641 nmdc:mga04h51_3263_c1
642 nmdc:mga07m45_101316_c1
643 nmdc:mga07m45_3735_c1
644 Ga0500635_0000659
645 Ga0500643_000633
646 Ga0500643_004778
647 Ga0500643_045035
648 Ga0500566_0148077
649 Ga0500641_0000233
650 Ga0500641_0000841
651 Ga0500650_0178831
652 Ga0500555_014197
653 Ga0500556_0001837
654 Ga0500556_0027944
655 Ga0500562_000482
656 Ga0500562_000574
657 Ga0500562_013925
658 Ga0500595_011196
659 Ga0500595_057773
660 Ga0500608_000246
661 Ga0500618_000299
662 Ga0500658_0115621
663 Ga0500559_0000048
664 Ga0500559_0000271
665 Ga0500559_0006853
666 Ga0500559_0036141
667 Ga0500577_0085778
668 Ga0500616_0035660
669 Ga0500622_0006244
670 Ga0500622_0023321
671 Ga0500636_0157515
672 Ga0500637_0017665
673 Ga0500637_0134038
674 Ga0500625_036548
675 Ga0500645_000264
676 Ga0500645_000275
677 Ga0500645_002129
678 Ga0500645_012676
679 Ga0500645_022346
680 2643749020
681 2643779826
682 2643930224
683 2644509220
684 2739792623
685 2819537575
686 2819647351

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12974

Phosphonate-bd

ABC transporter, phosphonate, periplasmic substrate-binding protein

48

299

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
2yxh-assembly1.cif.gz_B crystal structure of mazg-related protein from thermotoga maritima 0.9554 276 319
3quj-assembly1.cif.gz_A crystal structure of the phosphonate binding protein, phnd, from escherichia coli 0.9512 25 321
6j2l-assembly1.cif.gz_B crystal structure of bi-functional enzyme 0.9503 277 317
1cpq-assembly1.cif.gz_A cytochrome c' from rhodopseudomonas capsulata 0.9465 276 317
3quj-assembly2.cif.gz_C crystal structure of the phosphonate binding protein, phnd, from escherichia coli 0.9453 25 321
ID Description Score Start End Superfamily
af_A0A1D6E5W7_1_92_1.20.120.290 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Oxygen-evolving enhancer protein 3 (PsbQ), four-helix up-down bundle 0.9557 277 319 1.20.120.290
af_K7MSJ4_110_274_3.90.1600.10 Alpha Beta;Alpha-Beta Complex;Palm domain of DNA polymerase;B family DNA polymerase, palm domain 0.9502 277 319 3.90.1600.10
af_Q23194_451_1026_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.9488 277 317 1.25.40.10
1yzmA00 Few Secondary Structures;Irregular;DNA Excision Repair, Uvrb; Chain A;Rabenosyn, Rab binding domain 0.9389 280 321 4.10.860.20
af_Q2G1L7_48_134_3.40.190.10 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9281 26 93 3.40.190.10
ID Description Score Start End GO Terms
AF-A0A658IC04-F1-model_v4 Phosphonate ABC transporter substrate-binding protein 0.9588 78 288 GO:0015716
GO:0030313
GO:0043190
GO:0055085
AF-A0A658IC04-F1-model_v4 Phosphonate ABC transporter substrate-binding protein 0.9497 78 288 GO:0015716
GO:0030313
GO:0043190
GO:0055085
AF-A0A5D0MJI8-F1-model_v4 Phosphonate ABC transporter substrate-binding protein 0.9421 15 319 GO:0015716
GO:0043190
GO:0055085
AF-A0A1V4X780-F1-model_v4 Phosphate-import protein PhnD 0.9343 65 292 GO:0015716
GO:0043190
GO:0055085
AF-A0A524GRR3-F1-model_v4 Phosphate/phosphite/phosphonate ABC transporter substrate-binding protein 0.9306 24 288 GO:0043190
GO:0055085

Map