F415749

General Info

Members Datasets Scaffolds Average Seq Length
343 221 339 211

Family's Representative Sequence

Representative Sequence 3300049573|Ga0501037_0001385|Ga0501037_0001385_7705_8409
Length 234
Sequence MMALFYPTCFFKQISRRIYMIKVLIADDHTVVRQGLRFMLERQADISVVGECSNGEEAIALASDLLPEVILLDLLMPKMDGISAIREIKRLTPATQIIVLTSYIEDDYIFNAIKAGALSYLLKDTSPQSLIEAVRAGARAESILHPMVAKRVLQEMHSSDRSPLNDLTPRELEVLSHIARGRSNYEIAVELGISEGTVKMHVSNILSKLHLADRTQAAIYALQKRLIPLKDALE

Samples

Sample ID Description Type Environment
1 2600254943 Staphylococcus pasteuri NFIX07 Isolate Rhizoplane
2 2675903060 Nonomuraea wenchangensis CGMCC 4.5598 Isolate Rhizosphere
3 2884215851 Edaphobacter sp. 12200R-103 Isolate Rhizosphere
4 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
5 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
6 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
7 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
16 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
17 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
18 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
19 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
20 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
21 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
22 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
23 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
24 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
25 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
26 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
27 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
28 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
29 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
30 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
31 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
32 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
33 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
34 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
35 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
36 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
37 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
38 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
39 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
40 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
41 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
42 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
43 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
44 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
45 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
46 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
47 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
48 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
49 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
50 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
51 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
52 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
53 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
54 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
55 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
56 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
57 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
58 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
59 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
60 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
61 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
92 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
94 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
95 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
96 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
97 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
98 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
99 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
100 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
101 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
102 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
103 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
104 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
105 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
106 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
107 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
108 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
109 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
110 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
111 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
112 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
113 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
114 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
115 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
116 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
117 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
118 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
119 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
120 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
121 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
122 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
123 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
124 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
125 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
126 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
127 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
128 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
129 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
130 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
131 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
132 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
133 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
134 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
135 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
136 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
137 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
138 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
139 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
140 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
141 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
142 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
143 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
144 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
145 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
146 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
147 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
148 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
149 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
150 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
151 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
152 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
153 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
154 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
155 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
156 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
157 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
158 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
159 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
160 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
161 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
162 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
163 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
164 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
165 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
166 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
167 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
168 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
169 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
170 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
171 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
172 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
173 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
174 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
175 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
176 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
177 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
178 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
179 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
180 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
181 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
182 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
183 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
184 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
185 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
186 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
187 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
188 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
189 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
190 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
191 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
192 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
193 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
194 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
195 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
196 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
197 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
198 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
199 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
200 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
201 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
202 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
203 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
204 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
205 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
206 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
207 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
208 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
209 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
210 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
211 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
212 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
213 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
214 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
215 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
216 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
217 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
218 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
219 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
220 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
221 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.83
Metatranscriptomes 0.29
Isolates 0.87

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.04
Nodule 0
Rhizoplane 2.62
Rhizosphere 89.21
Stem 0
Stem Tuber 0
Unclassified 6.12

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 LJNas_1000524 3300000546 Bacteria 6674
2 rootH2_10025975 3300003320 Bacteria 14017
3 rootH2_10119810 3300003320 Bacteria 1393
4 rootH2_10252040 3300003320 Bacteria 1563
5 rootH2_10300152 3300003320 Unclassified 1084
6 rootL2_10067629 3300003322 Bacteria 6350
7 rootH1_10143234 3300003323 Bacteria 1879
8 Ga0070658_10026711 3300005327 Bacteria 4634
9 Ga0070658_10153361 3300005327 Unclassified 1930
10 Ga0070658_10191085 3300005327 Bacteria 1726
11 Ga0070658_10203295 3300005327 Bacteria 1672
12 Ga0070683_100065684 3300005329 Bacteria 3378
13 Ga0070666_10014816 3300005335 Bacteria 4968
14 Ga0070666_10076058 3300005335 Bacteria 2290
15 Ga0070680_100559364 3300005336 Bacteria 980
16 Ga0068868_100725344 3300005338 Bacteria 891
17 Ga0070660_100149825 3300005339 Bacteria 1875
18 Ga0070660_100646833 3300005339 Bacteria 885
19 Ga0070661_100060465 3300005344 Bacteria 2780
20 Ga0070667_100069953 3300005367 Bacteria 2987
21 Ga0070709_10146691 3300005434 Bacteria 1626
22 Ga0070714_100001484 3300005435 Bacteria 17070
23 Ga0070714_100036259 3300005435 Bacteria 4135
24 Ga0070714_100148098 3300005435 Bacteria 2113
25 Ga0070713_100012358 3300005436 Bacteria 6258
26 Ga0070713_100077850 3300005436 Bacteria 2821
27 Ga0070713_100594630 3300005436 Bacteria 1051
28 Ga0070711_100225186 3300005439 Bacteria 1460
29 Ga0070705_100747524 3300005440 Bacteria 773
30 Ga0070708_100060562 3300005445 Bacteria 3379
31 Ga0070663_100024811 3300005455 Bacteria 4040
32 Ga0070663_100484624 3300005455 Bacteria 1024
33 Ga0070681_10237468 3300005458 Bacteria 1736
34 Ga0070685_10019295 3300005466 Bacteria 3677
35 Ga0070707_100000750 3300005468 Bacteria 31996
36 Ga0070679_100146545 3300005530 Bacteria 2338
37 Ga0070684_100061410 3300005535 Bacteria 3289
38 Ga0068853_100420511 3300005539 Bacteria 1253
39 Ga0070665_100010831 3300005548 Bacteria 9224
40 Ga0070665_100068705 3300005548 Bacteria 3552
41 Ga0070665_100122369 3300005548 Bacteria 2604
42 Ga0070665_100679616 3300005548 Bacteria 1042
43 Ga0070665_100923193 3300005548 Bacteria 885
44 Ga0068855_100029644 3300005563 Bacteria 6541
45 Ga0068857_100045578 3300005577 Bacteria 3891
46 Ga0068852_100471632 3300005616 Bacteria 1246
47 Ga0068864_100025300 3300005618 Bacteria 4998
48 Ga0068863_100012291 3300005841 Bacteria 8264
49 Ga0081540_1018270 3300005983 Bacteria 4308
50 Ga0070717_10115502 3300006028 Bacteria 2294
51 Ga0070717_10172052 3300006028 Bacteria 1884
52 Ga0070717_10323398 3300006028 Bacteria 1375
53 Ga0070717_10654901 3300006028 Bacteria 953
54 Ga0070712_100188316 3300006175 Unclassified 1613
55 Ga0075428_100006196 3300006844 Bacteria 13305
56 Ga0075428_100076455 3300006844 Unclassified 3655
57 Ga0075428_100816174 3300006844 Bacteria 991
58 Ga0075430_100144585 3300006846 Bacteria 1981
59 Ga0075431_100143568 3300006847 Bacteria 2460
60 Ga0075433_10113377 3300006852 Unclassified 2405
61 Ga0075434_100028333 3300006871 Bacteria 5502
62 Ga0075434_100632122 3300006871 Bacteria 1089
63 Ga0099794_10052282 3300007265 Bacteria 1969
64 Ga0105240_10000002 3300009093 Bacteria 1924170
65 Ga0105240_10084506 3300009093 Bacteria 3891
66 Ga0111539_10004918 3300009094 Bacteria 17384
67 Ga0111539_10057651 3300009094 Bacteria 4611
68 Ga0105243_10060997 3300009148 Bacteria 3014
69 Ga0105248_10000011 3300009177 Bacteria 339183
70 Ga0105248_10006022 3300009177 Bacteria 13314
71 Ga0105248_10018740 3300009177 Bacteria 7653
72 Ga0105248_10038898 3300009177 Bacteria 5326
73 Ga0105248_10050210 3300009177 Bacteria 4678
74 Ga0105248_10204817 3300009177 Bacteria 2223
75 Ga0105238_10007119 3300009551 Bacteria 11192
76 Ga0105239_11586553 3300010375 Bacteria 757
77 Ga0157370_10024353 3300013104 Bacteria 5994
78 Ga0157370_10185062 3300013104 Unclassified 1934
79 Ga0157369_10028617 3300013105 Bacteria 6166
80 Ga0157369_10154873 3300013105 Unclassified 2421
81 Ga0157374_10006046 3300013296 Bacteria 10243
82 Ga0157374_10007602 3300013296 Bacteria 9249
83 Ga0157374_10017683 3300013296 Bacteria 6282
84 Ga0157374_10082213 3300013296 Bacteria 3058
85 Ga0157374_10280709 3300013296 Bacteria 1644
86 Ga0157378_11120778 3300013297 Unclassified 824
87 Ga0163162_10004778 3300013306 Bacteria 13076
88 Ga0157372_10007812 3300013307 Bacteria 11362
89 Ga0157372_11031117 3300013307 Bacteria 952
90 Ga0157372_11734844 3300013307 Bacteria 718
91 Ga0157375_10473467 3300013308 Unclassified 1418
92 Ga0157375_10661759 3300013308 Bacteria 1200
93 Ga0163163_10014110 3300014325 Bacteria 7337
94 Ga0163163_10128566 3300014325 Bacteria 2572
95 Ga0157379_10056044 3300014968 Bacteria 3523
96 Ga0157379_10068810 3300014968 Bacteria 3165
97 Ga0157379_10757728 3300014968 Unclassified 914
98 Ga0157376_10003342 3300014969 Bacteria 11029
99 Ga0157376_10011596 3300014969 Bacteria 6506
100 Ga0157376_10039767 3300014969 Bacteria 3838
101 Ga0157376_10177183 3300014969 Bacteria 1946
102 Ga0224712_10060267 3300022467 Bacteria 1510
103 Ga0207692_10429798 3300025898 Bacteria 828
104 Ga0207692_10559995 3300025898 Unclassified 731
105 Ga0207680_10006826 3300025903 Bacteria 5540
106 Ga0207680_10008610 3300025903 Bacteria 5019
107 Ga0207647_10002001 3300025904 Bacteria 15592
108 Ga0207647_10015277 3300025904 Bacteria 5269
109 Ga0207699_10097221 3300025906 Bacteria 1860
110 Ga0207699_10156017 3300025906 Bacteria 1515
111 Ga0207705_10018044 3300025909 Bacteria 5046
112 Ga0207705_10375643 3300025909 Unclassified 1097
113 Ga0207705_10496491 3300025909 Bacteria 948
114 Ga0207707_10057494 3300025912 Bacteria 3385
115 Ga0207695_10000002 3300025913 Bacteria 2188391
116 Ga0207695_10152344 3300025913 Bacteria 2250
117 Ga0207693_10069947 3300025915 Bacteria 2746
118 Ga0207663_10006083 3300025916 Bacteria 6137
119 Ga0207657_10139071 3300025919 Bacteria 1985
120 Ga0207657_10211639 3300025919 Unclassified 1556
121 Ga0207694_10383035 3300025924 Unclassified 1168
122 Ga0207700_10024268 3300025928 Bacteria 4194
123 Ga0207700_10055725 3300025928 Bacteria 2972
124 Ga0207700_10130155 3300025928 Bacteria 2054
125 Ga0207664_10006672 3300025929 Bacteria 7960
126 Ga0207664_10067240 3300025929 Bacteria 2875
127 Ga0207664_10192018 3300025929 Bacteria 1758
128 Ga0207644_10087930 3300025931 Bacteria 2310
129 Ga0207690_10068117 3300025932 Bacteria 2444
130 Ga0207709_10094506 3300025935 Bacteria 1962
131 Ga0207665_10244180 3300025939 Bacteria 1324
132 Ga0207711_10000028 3300025941 Bacteria 214107
133 Ga0207711_10000799 3300025941 Bacteria 30947
134 Ga0207711_10007157 3300025941 Bacteria 9351
135 Ga0207711_10374844 3300025941 Bacteria 1320
136 Ga0207661_10030624 3300025944 Bacteria 4147
137 Ga0207667_10060423 3300025949 Bacteria 3967
138 Ga0207651_10347584 3300025960 Bacteria 1248
139 Ga0207668_10181725 3300025972 Bacteria 1660
140 Ga0207677_10745694 3300026023 Bacteria 872
141 Ga0207703_11138787 3300026035 Unclassified 750
142 Ga0207678_10038431 3300026067 Bacteria 4158
143 Ga0207678_10075179 3300026067 Bacteria 2894
144 Ga0207678_10436400 3300026067 Bacteria 1137
145 Ga0207702_10260073 3300026078 Bacteria 1634
146 Ga0207676_10873338 3300026095 Bacteria 881
147 Ga0207674_10099230 3300026116 Bacteria 2894
148 Ga0207674_10190731 3300026116 Bacteria 1999
149 Ga0207683_10561833 3300026121 Bacteria 1055
150 Ga0207698_10239682 3300026142 Bacteria 1652
151 Ga0207428_10070535 3300027907 Bacteria 2746
152 Ga0268266_10048088 3300028379 Bacteria 3655
153 Ga0268266_10218647 3300028379 Bacteria 1750
154 Ga0268266_10372905 3300028379 Bacteria 1344
155 Ga0265337_1000724 3300028556 Bacteria 17359
156 Ga0265326_10003204 3300028558 Bacteria 5410
157 Ga0265319_1000344 3300028563 Bacteria 34100
158 Ga0265334_10000169 3300028573 Bacteria 39242
159 Ga0265318_10013652 3300028577 Bacteria 3424
160 Ga0265322_10027702 3300028654 Bacteria 1619
161 Ga0265336_10001450 3300028666 Bacteria 10813
162 Ga0265338_10009106 3300028800 Bacteria 11929
163 Ga0265338_10047633 3300028800 Bacteria 3913
164 Ga0265338_10428701 3300028800 Bacteria 939
165 Ga0265324_10001071 3300029957 Bacteria 16485
166 Ga0265332_10000552 3300031238 Bacteria 25311
167 Ga0265320_10000904 3300031240 Bacteria 22273
168 Ga0265325_10031732 3300031241 Bacteria 2824
169 Ga0265340_10002411 3300031247 Bacteria 10637
170 Ga0265339_10008304 3300031249 Bacteria 6614
171 Ga0265316_10021630 3300031344 Bacteria 5442
172 Ga0265313_10071058 3300031595 Bacteria 1602
173 Ga0265314_10021826 3300031711 Bacteria 4914
174 Ga0265342_10002562 3300031712 Bacteria 15599
175 Ga0307516_10153147 3300031730 Bacteria 2064
176 Ga0307510_10123553 3300033180 Bacteria 2285
177 Ga0373925_0000237 3300037068 Bacteria 58351
178 Ga0395898_0042991 3300037466 Bacteria 4454
179 Ga0436365_1093612 3300039437 Bacteria 3316
180 Ga0436363_0369426 3300039450 Bacteria 1908
181 Ga0436363_0904025 3300039450 Bacteria 2379
182 Ga0436363_1402423 3300039450 Bacteria 6261
183 Ga0436363_1470202 3300039450 Bacteria 1576
184 Ga0436362_0470105 3300039453 Bacteria 1515
185 Ga0466969_0205706 3300044656 Bacteria 897
186 Ga0466966_0015900 3300044684 Bacteria 4974
187 Ga0466961_0232682 3300044693 Unclassified 1134
188 Ga0466963_0010699 3300044694 Bacteria 5566
189 Ga0466971_0203531 3300044719 Unclassified 935
190 Ga0466957_0106658 3300044842 Unclassified 1772
191 Ga0466957_0358480 3300044842 Bacteria 991
192 Ga0466959_0023371 3300045049 Bacteria 4574
193 Ga0466959_0048799 3300045049 Unclassified 3111
194 Ga0466959_0278587 3300045049 Bacteria 1148
195 Ga0466959_0337838 3300045049 Bacteria 1028
196 Ga0466959_0338710 3300045049 Bacteria 1026
197 Ga0466958_0005419 3300045836 Bacteria 6864
198 Ga0466958_0022703 3300045836 Bacteria 3679
199 Ga0495592_0027103 3300046454 Bacteria 4344
200 Ga0495603_0022103 3300046455 Bacteria 3852
201 Ga0495603_0251102 3300046455 Bacteria 1018
202 Ga0495629_0075717 3300046459 Unclassified 2350
203 Ga0495651_0032232 3300046462 Bacteria 4088
204 Ga0495653_0035969 3300046463 Unclassified 3904
205 Ga0495650_0000041 3300046471 Bacteria 363945
206 Ga0495650_0016795 3300046471 Bacteria 3690
207 Ga0495580_0133643 3300046472 Bacteria 1720
208 Ga0495582_0005369 3300046473 Bacteria 7150
209 Ga0495582_0029195 3300046473 Bacteria 3027
210 Ga0495639_0000562 3300046475 Bacteria 17320
211 Ga0495662_0008124 3300046476 Bacteria 5169
212 Ga0495585_0033646 3300046492 Bacteria 2901
213 Ga0495594_0006385 3300046499 Bacteria 6065
214 Ga0495594_0009942 3300046499 Bacteria 4925
215 Ga0495594_0011280 3300046499 Bacteria 4642
216 Ga0495596_0082601 3300046500 Unclassified 1247
217 Ga0495583_0147603 3300046506 Unclassified 976
218 Ga0495606_0072478 3300046507 Bacteria 2164
219 Ga0495606_0117000 3300046507 Bacteria 1600
220 Ga0495606_0225942 3300046507 Unclassified 1052
221 Ga0495618_0288326 3300046514 Bacteria 1022
222 Ga0495628_0007867 3300046516 Bacteria 9187
223 Ga0495630_0186376 3300046517 Bacteria 1583
224 Ga0495631_0139694 3300046518 Bacteria 1040
225 Ga0495643_0010109 3300046522 Bacteria 5822
226 Ga0495644_0000358 3300046523 Bacteria 20656
227 Ga0495666_0034689 3300046526 Bacteria 2461
228 Ga0495652_0009905 3300046529 Bacteria 8641
229 Ga0495652_0522115 3300046529 Unclassified 820
230 Ga0495665_0002285 3300046531 Bacteria 10356
231 Ga0495640_0060521 3300046533 Bacteria 2574
232 Ga0495586_0002809 3300046535 Bacteria 9400
233 Ga0495587_0044334 3300046536 Unclassified 2646
234 Ga0495645_0006000 3300046543 Bacteria 8401
235 Ga0495645_0028515 3300046543 Bacteria 4058
236 Ga0495622_0010687 3300046557 Bacteria 4235
237 Ga0495667_0020975 3300046559 Bacteria 4407
238 Ga0495634_0001474 3300046642 Bacteria 20844
239 Ga0495625_0000182 3300046660 Bacteria 98244
240 Ga0495625_0033605 3300046660 Bacteria 3791
241 Ga0495625_0184631 3300046660 Unclassified 1385
242 Ga0495625_0240523 3300046660 Unclassified 1179
243 Ga0495625_0293336 3300046660 Bacteria 1043
244 Ga0495635_0113974 3300046663 Bacteria 1845
245 Ga0495659_0013461 3300046664 Bacteria 2665
246 Ga0495588_0071667 3300046674 Bacteria 1802
247 Ga0495588_0082724 3300046674 Bacteria 1677
248 Ga0495599_0001550 3300046678 Bacteria 13236
249 Ga0495669_0009097 3300046684 Bacteria 4187
250 Ga0495613_0004845 3300046689 Bacteria 10098
251 Ga0495624_0006688 3300046690 Bacteria 8147
252 Ga0495670_0131012 3300046691 Unclassified 1307
253 Ga0495649_0004675 3300046694 Bacteria 8897
254 Ga0495649_0251309 3300046694 Unclassified 908
255 Ga0495581_0006119 3300047315 Bacteria 6975
256 Ga0495604_0053193 3300047317 Bacteria 3131
257 Ga0495636_0045478 3300047318 Bacteria 1830
258 Ga0495636_0195032 3300047318 Bacteria 923
259 Ga0495674_0070704 3300047319 Bacteria 3015
260 Ga0495672_0006880 3300047320 Bacteria 8676
261 Ga0495672_0068013 3300047320 Bacteria 2027
262 Ga0495676_0029507 3300047321 Bacteria 4668
263 Ga0495676_0690986 3300047321 Bacteria 660
264 Ga0495680_0067803 3300047322 Unclassified 2727
265 Ga0495675_0004931 3300047444 Bacteria 8128
266 Ga0495677_0107962 3300047445 Unclassified 1056
267 Ga0495684_0015069 3300047471 Bacteria 5954
268 Ga0495686_0002102 3300047472 Bacteria 19526
269 Ga0495686_0014262 3300047472 Bacteria 5475
270 Ga0495686_0048735 3300047472 Bacteria 2669
271 Ga0495686_0162900 3300047472 Bacteria 1302
272 Ga0495593_0009533 3300047673 Bacteria 5634
273 Ga0495614_0002378 3300048089 Bacteria 8363
274 Ga0496102_0196956 3300048905 Bacteria 1899
275 Ga0496102_1004281 3300048905 Unclassified 755
276 Ga0496104_0232374 3300048907 Bacteria 1756
277 Ga0496109_0585299 3300048912 Bacteria 1052
278 Ga0496112_0154996 3300048915 Bacteria 2258
279 Ga0496112_0548027 3300048915 Bacteria 1090
280 Ga0496113_0638079 3300048916 Bacteria 852
281 Ga0496115_0263866 3300048918 Bacteria 1416
282 Ga0496120_0039284 3300048923 Bacteria 2794
283 Ga0496126_0000005 3300048929 Bacteria 891906
284 Ga0496126_0002190 3300048929 Bacteria 27165
285 Ga0496126_0002782 3300048929 Bacteria 23057
286 Ga0496126_0046490 3300048929 Unclassified 3980
287 Ga0496126_0120966 3300048929 Bacteria 2270
288 Ga0496126_0165711 3300048929 Unclassified 1886
289 Ga0496126_0347075 3300048929 Bacteria 1215
290 Ga0501032_0003816 3300049569 Bacteria 11441
291 Ga0501032_0355528 3300049569 Bacteria 943
292 Ga0501033_0000675 3300049570 Bacteria 31467
293 Ga0501034_0034230 3300049571 Bacteria 5151
294 Ga0501036_0002489 3300049572 Bacteria 14444
295 Ga0501037_0001385 3300049573 Bacteria 17783
296 Ga0501037_0001892 3300049573 Bacteria 15220
297 Ga0501037_0470554 3300049573 Bacteria 855
298 Ga0501038_0005942 3300049574 Bacteria 11289
299 Ga0501038_0168938 3300049574 Unclassified 1772
300 Ga0501039_0036438 3300049575 Bacteria 3796
301 Ga0501042_0253797 3300049578 Bacteria 1269
302 Ga0501043_0001924 3300049579 Bacteria 17773
303 Ga0501046_0000389 3300049580 Bacteria 44043
304 Ga0501047_0005145 3300049581 Bacteria 12274
305 Ga0501068_0039968 3300049584 Bacteria 2815
306 Ga0501070_0304507 3300049586 Bacteria 1298
307 Ga0501070_0311068 3300049586 Bacteria 1282
308 Ga0501071_0175921 3300049587 Bacteria 1603
309 Ga0501073_0001170 3300049589 Bacteria 19167
310 Ga0501073_0313084 3300049589 Bacteria 1083
311 Ga0501074_0062404 3300049590 Bacteria 2684
312 Ga0501074_0390062 3300049590 Unclassified 988
313 Ga0501075_0071198 3300049591 Bacteria 2628
314 Ga0501075_1090446 3300049591 Unclassified 606
315 Ga0501077_0182112 3300049593 Bacteria 1335
316 Ga0501079_0095736 3300049741 Bacteria 2301
317 Ga0501079_0516856 3300049741 Bacteria 939
318 Ga0501080_0011888 3300049742 Bacteria 7976
319 Ga0501080_0462189 3300049742 Bacteria 1137
320 Ga0501083_0234523 3300049744 Bacteria 1195
321 Ga0501035_0000357 3300049822 Bacteria 52667
322 Ga0501035_0130070 3300049822 Bacteria 2195
323 Ga0501044_0001820 3300049823 Bacteria 24832
324 Ga0501044_0018210 3300049823 Bacteria 7532
325 Ga0501044_0415564 3300049823 Bacteria 1256
326 nmdc:mga06r32_279325_c1 3300050510 Bacteria 1657
327 nmdc:mga08y16_251999_c1 3300050511 Bacteria 1824
328 nmdc:mga0n895_1432_c1 3300050512 Bacteria 17817
329 nmdc:mga0n895_19191_c1 3300050512 Bacteria 6348
330 nmdc:mga0rr50_12080_c1 3300050513 Bacteria 5562
331 nmdc:mga08x19_648510_c1 3300050514 Unclassified 749
332 Ga0500644_0021320 3300053088 Bacteria 1940
333 Ga0500651_0000002 3300053093 Bacteria 476609
334 Ga0500595_000014 3300053119 Bacteria 247996
335 Ga0500595_015861 3300053119 Bacteria 2818
336 Ga0500595_023857 3300053119 Bacteria 2143
337 Ga0500655_016642 3300053133 Bacteria 1355
338 Ga0500637_0012102 3300053178 Unclassified 4488
339 Ga0530510_0001889 3300061734 Bacteria 14306

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049591 Ga0501075_1090446 Ga0501075_1090446_19_591 164
2 3300044842 Ga0466957_0358480 Ga0466957_0358480_67_669 176
3 3300049742 Ga0501080_0462189 Ga0501080_0462189_539_1093 177
4 3300005434 Ga0070709_10146691 Ga0070709_101466912 183
5 3300005435 Ga0070714_100036259 Ga0070714_1000362593 183
6 3300006028 Ga0070717_10654901 Ga0070717_106549012 183
7 3300025906 Ga0207699_10156017 Ga0207699_101560172 183
8 3300025928 Ga0207700_10130155 Ga0207700_101301552 183
9 3300025929 Ga0207664_10067240 Ga0207664_100672402 183
10 3300049823 Ga0501044_0415564 Ga0501044_0415564_25_615 186
11 3300047318 Ga0495636_0195032 Ga0495636_0195032_13_588 191
12 3300048905 Ga0496102_1004281 Ga0496102_1004281_32_607 191
13 3300031730 Ga0307516_10153147 Ga0307516_101531472 193
14 iso_pu_bacteria 2600254943 2600402215 197
15 3300049742 Ga0501080_0011888 Ga0501080_0011888_7049_7657 201
16 3300044656 Ga0466969_0205706 Ga0466969_0205706_50_724 202
17 3300044684 Ga0466966_0015900 Ga0466966_0015900_3842_4516 202
18 3300044842 Ga0466957_0106658 Ga0466957_0106658_400_1080 202
19 3300045049 Ga0466959_0023371 Ga0466959_0023371_1925_2599 202
20 3300045049 Ga0466959_0048799 Ga0466959_0048799_2084_2764 202
21 3300045049 Ga0466959_0278587 Ga0466959_0278587_74_745 202
22 3300045049 Ga0466959_0338710 Ga0466959_0338710_109_780 202
23 3300045836 Ga0466958_0005419 Ga0466958_0005419_1438_2118 202
24 3300045836 Ga0466958_0022703 Ga0466958_0022703_2213_2893 202
25 iso_pu_bacteria 2675903060 2676495463 202
26 iso_pu_bacteria 2884215851 2884216515 203
27 3300005466 Ga0070685_10019295 Ga0070685_100192954 204
28 3300005327 Ga0070658_10191085 Ga0070658_101910851 205
29 3300005329 Ga0070683_100065684 Ga0070683_1000656843 205
30 3300005336 Ga0070680_100559364 Ga0070680_1005593642 205
31 3300005339 Ga0070660_100149825 Ga0070660_1001498252 205
32 3300005435 Ga0070714_100001484 Ga0070714_1000014848 205
33 3300005436 Ga0070713_100077850 Ga0070713_1000778502 205
34 3300005436 Ga0070713_100594630 Ga0070713_1005946302 205
35 3300005439 Ga0070711_100225186 Ga0070711_1002251862 205
36 3300005445 Ga0070708_100060562 Ga0070708_1000605622 205
37 3300005455 Ga0070663_100024811 Ga0070663_1000248113 205
38 3300005455 Ga0070663_100484624 Ga0070663_1004846241 205
39 3300005458 Ga0070681_10237468 Ga0070681_102374681 205
40 3300005468 Ga0070707_100000750 Ga0070707_10000075034 205
41 3300005530 Ga0070679_100146545 Ga0070679_1001465452 205
42 3300005535 Ga0070684_100061410 Ga0070684_1000614102 205
43 3300005577 Ga0068857_100045578 Ga0068857_1000455782 205
44 3300005616 Ga0068852_100471632 Ga0068852_1004716322 205
45 3300006028 Ga0070717_10115502 Ga0070717_101155022 205
46 3300006028 Ga0070717_10323398 Ga0070717_103233981 205
47 3300006844 Ga0075428_100816174 Ga0075428_1008161742 205
48 3300006847 Ga0075431_100143568 Ga0075431_1001435682 205
49 3300006871 Ga0075434_100028333 Ga0075434_1000283335 205
50 3300006871 Ga0075434_100632122 Ga0075434_1006321222 205
51 3300007265 Ga0099794_10052282 Ga0099794_100522821 205
52 3300013104 Ga0157370_10024353 Ga0157370_100243536 205
53 3300022467 Ga0224712_10060267 Ga0224712_100602672 205
54 3300025898 Ga0207692_10429798 Ga0207692_104297981 205
55 3300025906 Ga0207699_10097221 Ga0207699_100972212 205
56 3300025912 Ga0207707_10057494 Ga0207707_100574941 205
57 3300025915 Ga0207693_10069947 Ga0207693_100699473 205
58 3300025916 Ga0207663_10006083 Ga0207663_100060836 205
59 3300025919 Ga0207657_10139071 Ga0207657_101390711 205
60 3300025928 Ga0207700_10055725 Ga0207700_100557252 205
61 3300025929 Ga0207664_10006672 Ga0207664_100066722 205
62 3300025929 Ga0207664_10192018 Ga0207664_101920181 205
63 3300025932 Ga0207690_10068117 Ga0207690_100681172 205
64 3300025939 Ga0207665_10244180 Ga0207665_102441802 205
65 3300025944 Ga0207661_10030624 Ga0207661_100306243 205
66 3300026067 Ga0207678_10038431 Ga0207678_100384313 205
67 3300026067 Ga0207678_10436400 Ga0207678_104364001 205
68 3300026116 Ga0207674_10099230 Ga0207674_100992302 205
69 3300026116 Ga0207674_10190731 Ga0207674_101907312 205
70 3300026142 Ga0207698_10239682 Ga0207698_102396822 205
71 3300028556 Ga0265337_1000724 Ga0265337_100072418 205
72 3300028558 Ga0265326_10003204 Ga0265326_100032044 205
73 3300028563 Ga0265319_1000344 Ga0265319_100034433 205
74 3300028573 Ga0265334_10000169 Ga0265334_1000016927 205
75 3300028577 Ga0265318_10013652 Ga0265318_100136524 205
76 3300028654 Ga0265322_10027702 Ga0265322_100277023 205
77 3300028666 Ga0265336_10001450 Ga0265336_100014504 205
78 3300028800 Ga0265338_10009106 Ga0265338_1000910611 205
79 3300028800 Ga0265338_10047633 Ga0265338_100476333 205
80 3300028800 Ga0265338_10428701 Ga0265338_104287011 205
81 3300029957 Ga0265324_10001071 Ga0265324_1000107117 205
82 3300031238 Ga0265332_10000552 Ga0265332_1000055215 205
83 3300031240 Ga0265320_10000904 Ga0265320_1000090410 205
84 3300031241 Ga0265325_10031732 Ga0265325_100317324 205
85 3300031247 Ga0265340_10002411 Ga0265340_100024113 205
86 3300031249 Ga0265339_10008304 Ga0265339_100083049 205
87 3300031344 Ga0265316_10021630 Ga0265316_100216303 205
88 3300031595 Ga0265313_10071058 Ga0265313_100710582 205
89 3300031711 Ga0265314_10021826 Ga0265314_100218265 205
90 3300031712 Ga0265342_10002562 Ga0265342_1000256210 205
91 3300037068 Ga0373925_0000237 Ga0373925_0000237_15549_16199 205
92 3300037466 Ga0395898_0042991 Ga0395898_0042991_1743_2393 205
93 3300039437 Ga0436365_1093612 Ga0436365_1093612_2325_2984 205
94 3300039450 Ga0436363_0369426 Ga0436363_0369426_209_868 205
95 3300039450 Ga0436363_0904025 Ga0436363_0904025_299_955 205
96 3300039450 Ga0436363_1402423 Ga0436363_1402423_1085_1738 205
97 3300039450 Ga0436363_1470202 Ga0436363_1470202_610_1308 205
98 3300039453 Ga0436362_0470105 Ga0436362_0470105_542_1213 205
99 3300044694 Ga0466963_0010699 Ga0466963_0010699_2434_3084 205
100 3300044719 Ga0466971_0203531 Ga0466971_0203531_174_839 205
101 3300048929 Ga0496126_0120966 Ga0496126_0120966_1488_2162 205
102 3300048929 Ga0496126_0165711 Ga0496126_0165711_1082_1741 205
103 3300050510 nmdc:mga06r32_279325_c1 nmdc:mga06r32_279325_c1_335_988 205
104 3300050512 nmdc:mga0n895_19191_c1 nmdc:mga0n895_19191_c1_5133_5780 205
105 3300053178 Ga0500637_0012102 Ga0500637_0012102_506_1171 205
106 3300005440 Ga0070705_100747524 Ga0070705_1007475241 206
107 3300006844 Ga0075428_100006196 Ga0075428_1000061964 206
108 3300009094 Ga0111539_10004918 Ga0111539_1000491813 206
109 3300027907 Ga0207428_10070535 Ga0207428_100705353 206
110 3300048929 Ga0496126_0002782 Ga0496126_0002782_12963_13583 206
111 3300049578 Ga0501042_0253797 Ga0501042_0253797_30_671 206
112 3300049587 Ga0501071_0175921 Ga0501071_0175921_892_1533 206
113 3300049590 Ga0501074_0062404 Ga0501074_0062404_1487_2128 206
114 3300049591 Ga0501075_0071198 Ga0501075_0071198_441_1082 206
115 3300049593 Ga0501077_0182112 Ga0501077_0182112_365_1006 206
116 3300049741 Ga0501079_0095736 Ga0501079_0095736_1383_2024 206
117 3300049744 Ga0501083_0234523 Ga0501083_0234523_384_1025 206
118 3300061734 Ga0530510_0001889 Ga0530510_0001889_9269_9910 206
119 3300003320 rootH2_10025975 rootH2_100259757 207
120 3300003320 rootH2_10252040 rootH2_102520402 207
121 3300003320 rootH2_10300152 rootH2_103001522 207
122 3300003322 rootL2_10067629 rootL2_100676292 207
123 3300005327 Ga0070658_10026711 Ga0070658_100267112 207
124 3300005327 Ga0070658_10203295 Ga0070658_102032952 207
125 3300005335 Ga0070666_10014816 Ga0070666_100148162 207
126 3300005335 Ga0070666_10076058 Ga0070666_100760582 207
127 3300005338 Ga0068868_100725344 Ga0068868_1007253442 207
128 3300005344 Ga0070661_100060465 Ga0070661_1000604652 207
129 3300005367 Ga0070667_100069953 Ga0070667_1000699532 207
130 3300005435 Ga0070714_100148098 Ga0070714_1001480982 207
131 3300005436 Ga0070713_100012358 Ga0070713_1000123582 207
132 3300005539 Ga0068853_100420511 Ga0068853_1004205111 207
133 3300005548 Ga0070665_100010831 Ga0070665_1000108319 207
134 3300005548 Ga0070665_100122369 Ga0070665_1001223692 207
135 3300005548 Ga0070665_100679616 Ga0070665_1006796161 207
136 3300005548 Ga0070665_100923193 Ga0070665_1009231931 207
137 3300005563 Ga0068855_100029644 Ga0068855_1000296442 207
138 3300005618 Ga0068864_100025300 Ga0068864_1000253002 207
139 3300005841 Ga0068863_100012291 Ga0068863_1000122912 207
140 3300005983 Ga0081540_1018270 Ga0081540_10182702 207
141 3300006028 Ga0070717_10172052 Ga0070717_101720522 207
142 3300009093 Ga0105240_10000002 Ga0105240_10000002935 207
143 3300009093 Ga0105240_10084506 Ga0105240_100845062 207
144 3300009148 Ga0105243_10060997 Ga0105243_100609972 207
145 3300009177 Ga0105248_10000011 Ga0105248_10000011126 207
146 3300009177 Ga0105248_10006022 Ga0105248_100060229 207
147 3300009177 Ga0105248_10018740 Ga0105248_100187404 207
148 3300009177 Ga0105248_10038898 Ga0105248_100388984 207
149 3300009177 Ga0105248_10050210 Ga0105248_100502102 207
150 3300009551 Ga0105238_10007119 Ga0105238_100071196 207
151 3300010375 Ga0105239_11586553 Ga0105239_115865531 207
152 3300013104 Ga0157370_10185062 Ga0157370_101850622 207
153 3300013105 Ga0157369_10028617 Ga0157369_100286172 207
154 3300013296 Ga0157374_10006046 Ga0157374_100060462 207
155 3300013296 Ga0157374_10007602 Ga0157374_100076024 207
156 3300013296 Ga0157374_10082213 Ga0157374_100822132 207
157 3300013296 Ga0157374_10280709 Ga0157374_102807092 207
158 3300013306 Ga0163162_10004778 Ga0163162_100047784 207
159 3300013307 Ga0157372_10007812 Ga0157372_100078126 207
160 3300013307 Ga0157372_11734844 Ga0157372_117348441 207
161 3300013308 Ga0157375_10473467 Ga0157375_104734671 207
162 3300013308 Ga0157375_10661759 Ga0157375_106617592 207
163 3300014325 Ga0163163_10014110 Ga0163163_100141102 207
164 3300014968 Ga0157379_10056044 Ga0157379_100560443 207
165 3300014968 Ga0157379_10757728 Ga0157379_107577282 207
166 3300014969 Ga0157376_10003342 Ga0157376_100033422 207
167 3300014969 Ga0157376_10011596 Ga0157376_100115966 207
168 3300014969 Ga0157376_10039767 Ga0157376_100397672 207
169 3300014969 Ga0157376_10177183 Ga0157376_101771832 207
170 3300025903 Ga0207680_10006826 Ga0207680_100068262 207
171 3300025903 Ga0207680_10008610 Ga0207680_100086102 207
172 3300025904 Ga0207647_10015277 Ga0207647_100152772 207
173 3300025909 Ga0207705_10018044 Ga0207705_100180442 207
174 3300025909 Ga0207705_10496491 Ga0207705_104964911 207
175 3300025913 Ga0207695_10000002 Ga0207695_10000002939 207
176 3300025913 Ga0207695_10152344 Ga0207695_101523441 207
177 3300025919 Ga0207657_10211639 Ga0207657_102116391 207
178 3300025924 Ga0207694_10383035 Ga0207694_103830351 207
179 3300025928 Ga0207700_10024268 Ga0207700_100242682 207
180 3300025931 Ga0207644_10087930 Ga0207644_100879302 207
181 3300025935 Ga0207709_10094506 Ga0207709_100945062 207
182 3300025941 Ga0207711_10000028 Ga0207711_1000002845 207
183 3300025941 Ga0207711_10007157 Ga0207711_100071576 207
184 3300025941 Ga0207711_10374844 Ga0207711_103748441 207
185 3300025949 Ga0207667_10060423 Ga0207667_100604232 207
186 3300025960 Ga0207651_10347584 Ga0207651_103475841 207
187 3300025972 Ga0207668_10181725 Ga0207668_101817251 207
188 3300026023 Ga0207677_10745694 Ga0207677_107456941 207
189 3300026067 Ga0207678_10075179 Ga0207678_100751792 207
190 3300028379 Ga0268266_10048088 Ga0268266_100480881 207
191 3300028379 Ga0268266_10218647 Ga0268266_102186471 207
192 3300028379 Ga0268266_10372905 Ga0268266_103729052 207
193 3300033180 Ga0307510_10123553 Ga0307510_101235532 207
194 3300044693 Ga0466961_0232682 Ga0466961_0232682_113_736 207
195 3300045049 Ga0466959_0337838 Ga0466959_0337838_63_686 207
196 3300046454 Ga0495592_0027103 Ga0495592_0027103_1683_2306 207
197 3300046455 Ga0495603_0022103 Ga0495603_0022103_1346_1969 207
198 3300046455 Ga0495603_0251102 Ga0495603_0251102_344_967 207
199 3300046459 Ga0495629_0075717 Ga0495629_0075717_1627_2250 207
200 3300046462 Ga0495651_0032232 Ga0495651_0032232_386_1009 207
201 3300046463 Ga0495653_0035969 Ga0495653_0035969_671_1294 207
202 3300046471 Ga0495650_0000041 Ga0495650_0000041_251352_251975 207
203 3300046471 Ga0495650_0016795 Ga0495650_0016795_1406_2029 207
204 3300046472 Ga0495580_0133643 Ga0495580_0133643_898_1521 207
205 3300046473 Ga0495582_0005369 Ga0495582_0005369_2668_3291 207
206 3300046473 Ga0495582_0029195 Ga0495582_0029195_1021_1644 207
207 3300046475 Ga0495639_0000562 Ga0495639_0000562_8980_9603 207
208 3300046476 Ga0495662_0008124 Ga0495662_0008124_822_1445 207
209 3300046492 Ga0495585_0033646 Ga0495585_0033646_401_1024 207
210 3300046499 Ga0495594_0006385 Ga0495594_0006385_5416_6039 207
211 3300046499 Ga0495594_0009942 Ga0495594_0009942_1589_2212 207
212 3300046499 Ga0495594_0011280 Ga0495594_0011280_3993_4616 207
213 3300046500 Ga0495596_0082601 Ga0495596_0082601_440_1063 207
214 3300046506 Ga0495583_0147603 Ga0495583_0147603_305_928 207
215 3300046507 Ga0495606_0072478 Ga0495606_0072478_232_855 207
216 3300046507 Ga0495606_0117000 Ga0495606_0117000_537_1160 207
217 3300046507 Ga0495606_0225942 Ga0495606_0225942_405_1028 207
218 3300046514 Ga0495618_0288326 Ga0495618_0288326_263_886 207
219 3300046516 Ga0495628_0007867 Ga0495628_0007867_6189_6812 207
220 3300046517 Ga0495630_0186376 Ga0495630_0186376_70_693 207
221 3300046518 Ga0495631_0139694 Ga0495631_0139694_340_963 207
222 3300046522 Ga0495643_0010109 Ga0495643_0010109_1027_1650 207
223 3300046523 Ga0495644_0000358 Ga0495644_0000358_18589_19212 207
224 3300046526 Ga0495666_0034689 Ga0495666_0034689_424_1047 207
225 3300046529 Ga0495652_0009905 Ga0495652_0009905_1986_2609 207
226 3300046529 Ga0495652_0522115 Ga0495652_0522115_19_642 207
227 3300046531 Ga0495665_0002285 Ga0495665_0002285_7071_7694 207
228 3300046533 Ga0495640_0060521 Ga0495640_0060521_1416_2039 207
229 3300046535 Ga0495586_0002809 Ga0495586_0002809_5177_5800 207
230 3300046536 Ga0495587_0044334 Ga0495587_0044334_1295_1918 207
231 3300046543 Ga0495645_0006000 Ga0495645_0006000_4359_4982 207
232 3300046543 Ga0495645_0028515 Ga0495645_0028515_2988_3611 207
233 3300046557 Ga0495622_0010687 Ga0495622_0010687_3014_3637 207
234 3300046559 Ga0495667_0020975 Ga0495667_0020975_3601_4224 207
235 3300046642 Ga0495634_0001474 Ga0495634_0001474_19514_20137 207
236 3300046660 Ga0495625_0000182 Ga0495625_0000182_3185_3808 207
237 3300046660 Ga0495625_0033605 Ga0495625_0033605_766_1389 207
238 3300046660 Ga0495625_0184631 Ga0495625_0184631_383_1006 207
239 3300046660 Ga0495625_0240523 Ga0495625_0240523_344_967 207
240 3300046660 Ga0495625_0293336 Ga0495625_0293336_310_933 207
241 3300046663 Ga0495635_0113974 Ga0495635_0113974_1166_1789 207
242 3300046664 Ga0495659_0013461 Ga0495659_0013461_1247_1870 207
243 3300046674 Ga0495588_0071667 Ga0495588_0071667_18_641 207
244 3300046674 Ga0495588_0082724 Ga0495588_0082724_227_850 207
245 3300046678 Ga0495599_0001550 Ga0495599_0001550_8662_9285 207
246 3300046684 Ga0495669_0009097 Ga0495669_0009097_1385_2008 207
247 3300046689 Ga0495613_0004845 Ga0495613_0004845_3009_3632 207
248 3300046690 Ga0495624_0006688 Ga0495624_0006688_3739_4362 207
249 3300046691 Ga0495670_0131012 Ga0495670_0131012_528_1151 207
250 3300046694 Ga0495649_0004675 Ga0495649_0004675_7976_8599 207
251 3300046694 Ga0495649_0251309 Ga0495649_0251309_96_719 207
252 3300047315 Ga0495581_0006119 Ga0495581_0006119_2936_3559 207
253 3300047317 Ga0495604_0053193 Ga0495604_0053193_536_1159 207
254 3300047318 Ga0495636_0045478 Ga0495636_0045478_891_1514 207
255 3300047319 Ga0495674_0070704 Ga0495674_0070704_1586_2209 207
256 3300047320 Ga0495672_0006880 Ga0495672_0006880_5686_6309 207
257 3300047320 Ga0495672_0068013 Ga0495672_0068013_217_840 207
258 3300047321 Ga0495676_0029507 Ga0495676_0029507_758_1381 207
259 3300047321 Ga0495676_0690986 Ga0495676_0690986_23_646 207
260 3300047322 Ga0495680_0067803 Ga0495680_0067803_446_1069 207
261 3300047444 Ga0495675_0004931 Ga0495675_0004931_3245_3868 207
262 3300047445 Ga0495677_0107962 Ga0495677_0107962_178_801 207
263 3300047471 Ga0495684_0015069 Ga0495684_0015069_1111_1734 207
264 3300047472 Ga0495686_0002102 Ga0495686_0002102_8130_8753 207
265 3300047472 Ga0495686_0162900 Ga0495686_0162900_52_675 207
266 3300047673 Ga0495593_0009533 Ga0495593_0009533_4378_5001 207
267 3300048089 Ga0495614_0002378 Ga0495614_0002378_5364_5987 207
268 3300048915 Ga0496112_0154996 Ga0496112_0154996_562_1185 207
269 3300048923 Ga0496120_0039284 Ga0496120_0039284_118_741 207
270 3300048929 Ga0496126_0000005 Ga0496126_0000005_609875_610498 207
271 3300048929 Ga0496126_0002190 Ga0496126_0002190_4365_4988 207
272 3300048929 Ga0496126_0347075 Ga0496126_0347075_266_889 207
273 3300049569 Ga0501032_0003816 Ga0501032_0003816_5401_6027 207
274 3300049569 Ga0501032_0355528 Ga0501032_0355528_219_842 207
275 3300049570 Ga0501033_0000675 Ga0501033_0000675_22963_23589 207
276 3300049571 Ga0501034_0034230 Ga0501034_0034230_1937_2563 207
277 3300049572 Ga0501036_0002489 Ga0501036_0002489_10585_11211 207
278 3300049573 Ga0501037_0001892 Ga0501037_0001892_11490_12116 207
279 3300049573 Ga0501037_0470554 Ga0501037_0470554_197_820 207
280 3300049574 Ga0501038_0005942 Ga0501038_0005942_3128_3754 207
281 3300049575 Ga0501039_0036438 Ga0501039_0036438_843_1469 207
282 3300049579 Ga0501043_0001924 Ga0501043_0001924_4624_5250 207
283 3300049580 Ga0501046_0000389 Ga0501046_0000389_20555_21181 207
284 3300049581 Ga0501047_0005145 Ga0501047_0005145_4529_5155 207
285 3300049584 Ga0501068_0039968 Ga0501068_0039968_577_1203 207
286 3300049586 Ga0501070_0304507 Ga0501070_0304507_164_790 207
287 3300049586 Ga0501070_0311068 Ga0501070_0311068_410_1033 207
288 3300049589 Ga0501073_0001170 Ga0501073_0001170_2171_2797 207
289 3300049589 Ga0501073_0313084 Ga0501073_0313084_123_746 207
290 3300049741 Ga0501079_0516856 Ga0501079_0516856_205_831 207
291 3300049822 Ga0501035_0000357 Ga0501035_0000357_40012_40638 207
292 3300049822 Ga0501035_0130070 Ga0501035_0130070_925_1548 207
293 3300049823 Ga0501044_0001820 Ga0501044_0001820_14769_15395 207
294 3300053088 Ga0500644_0021320 Ga0500644_0021320_709_1332 207
295 3300053093 Ga0500651_0000002 Ga0500651_0000002_93402_94025 207
296 3300053119 Ga0500595_000014 Ga0500595_000014_122396_123019 207
297 3300053119 Ga0500595_015861 Ga0500595_015861_59_682 207
298 3300053133 Ga0500655_016642 Ga0500655_016642_113_736 207
299 3300003323 rootH1_10143234 rootH1_101432342 208
300 3300006852 Ga0075433_10113377 Ga0075433_101133772 208
301 3300009177 Ga0105248_10000011 Ga0105248_1000001114 208
302 3300013297 Ga0157378_11120778 Ga0157378_111207781 208
303 3300014968 Ga0157379_10068810 Ga0157379_100688102 208
304 3300025941 Ga0207711_10000799 Ga0207711_100007999 208
305 3300026035 Ga0207703_11138787 Ga0207703_111387871 208
306 3300049590 Ga0501074_0390062 Ga0501074_0390062_93_797 208
307 3300050514 nmdc:mga08x19_648510_c1 nmdc:mga08x19_648510_c1_14_640 208
308 3300053119 Ga0500595_023857 Ga0500595_023857_710_1336 208
309 3300013307 Ga0157372_11031117 Ga0157372_110311172 209
310 3300047472 Ga0495686_0048735 Ga0495686_0048735_1711_2340 209
311 3300050512 nmdc:mga0n895_1432_c1 nmdc:mga0n895_1432_c1_16689_17321 210
312 3300050513 nmdc:mga0rr50_12080_c1 nmdc:mga0rr50_12080_c1_931_1563 210
313 3300000546 LJNas_1000524 LJNas_10005247 211
314 3300003320 rootH2_10119810 rootH2_101198102 211
315 3300005327 Ga0070658_10153361 Ga0070658_101533612 211
316 3300005339 Ga0070660_100646833 Ga0070660_1006468331 211
317 3300005548 Ga0070665_100068705 Ga0070665_1000687053 211
318 3300006175 Ga0070712_100188316 Ga0070712_1001883161 211
319 3300006844 Ga0075428_100076455 Ga0075428_1000764553 211
320 3300006846 Ga0075430_100144585 Ga0075430_1001445853 211
321 3300009094 Ga0111539_10057651 Ga0111539_100576513 211
322 3300009177 Ga0105248_10204817 Ga0105248_102048173 211
323 3300013105 Ga0157369_10154873 Ga0157369_101548732 211
324 3300013296 Ga0157374_10017683 Ga0157374_100176832 211
325 3300014325 Ga0163163_10128566 Ga0163163_101285662 211
326 3300025898 Ga0207692_10559995 Ga0207692_105599951 211
327 3300025904 Ga0207647_10002001 Ga0207647_100020015 211
328 3300025909 Ga0207705_10375643 Ga0207705_103756431 211
329 3300026078 Ga0207702_10260073 Ga0207702_102600733 211
330 3300026095 Ga0207676_10873338 Ga0207676_108733382 211
331 3300026121 Ga0207683_10561833 Ga0207683_105618332 211
332 3300047472 Ga0495686_0014262 Ga0495686_0014262_4000_4680 211
333 3300048905 Ga0496102_0196956 Ga0496102_0196956_556_1191 211
334 3300048907 Ga0496104_0232374 Ga0496104_0232374_1054_1689 211
335 3300048912 Ga0496109_0585299 Ga0496109_0585299_369_1004 211
336 3300048915 Ga0496112_0548027 Ga0496112_0548027_286_921 211
337 3300048916 Ga0496113_0638079 Ga0496113_0638079_151_786 211
338 3300048918 Ga0496115_0263866 Ga0496115_0263866_670_1305 211
339 3300048929 Ga0496126_0046490 Ga0496126_0046490_2058_2693 211
340 3300049573 Ga0501037_0001385 Ga0501037_0001385_7705_8409 211
341 3300049574 Ga0501038_0168938 Ga0501038_0168938_63_767 211
342 3300049823 Ga0501044_0018210 Ga0501044_0018210_831_1535 211
343 3300050511 nmdc:mga08y16_251999_c1 nmdc:mga08y16_251999_c1_696_1484 211

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00072

Response_reg

Response regulator receiver domain

23

135

0.98

PF00196

GerE

Bacterial regulatory proteins, luxR family

165

221

0.97

PF08281

Sigma70_r4_2

Sigma-70, region 4

164

209

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
7ve5-assembly1.cif.gz_B c-terminal domain of vrar 0.9841 148 208
4wul-assembly1.cif.gz_B crystal structure of e. faecalis dna binding domain liard191n complexed with 26bp dna 0.9801 146 208
4wsz-assembly1.cif.gz_B crystal structure of the dna binding domains of wild type liar from e. faecalis 0.9754 147 208
4wsz-assembly1.cif.gz_A crystal structure of the dna binding domains of wild type liar from e. faecalis 0.9754 147 208
4wu4-assembly1.cif.gz_A crystal structure of e. faecalis dna binding domain liard191n complexed with 22bp dna 0.9733 147 209
ID Description Score Start End Superfamily
1yioA02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9722 147 204 1.10.10.10
4if4B02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9703 147 209 1.10.10.10
6ekhY00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9677 7 124 3.40.50.2300
1rnlA02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9647 147 208 1.10.10.10
1zn2A02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9644 147 204 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A352FSP0-F1-model_v4 DNA-binding response regulator 0.9851 6 143 GO:0000160
GO:0003677
AF-X1GPB7-F1-model_v4 Response regulatory domain-containing protein 0.9717 7 143 GO:0000160
GO:0003677
AF-A0A661KWW2-F1-model_v4 Response regulatory domain-containing protein 0.971 5 143 GO:0000160
GO:0003677
AF-A0A4Y9MF76-F1-model_v4 Response regulator transcription factor 0.9706 7 142 GO:0000160
AF-A0A7I8N2C2-F1-model_v4 Transcriptional activator of maltose regulon, MalT 0.9687 7 143 GO:0000160
GO:0003677
GO:0006355

Feature Viewer

pLDDT pTM Quality
89.08 0.66 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map