F415735

General Info

Members Datasets Scaffolds Average Seq Length
343 256 276 370

Family's Representative Sequence

Representative Sequence 3300048915|Ga0496112_0501513|Ga0496112_0501513_129_1133
Length 334
Sequence VANKIEPWEPQSTSVPVLWRYNDLRDHVLRSVELVSPEKAGRRVIYLNNPGRRDVAAAVGWLYSGLQVMHPGEVASAHAHSASALRFIMEGAGAYTVVDGHKMTLGARDFVLTPNGTWHEHGVEPNGSPCIWQDGLDIPLVNALEANFYVVHPKIQQEDSGYRVDDMTKTWGNPGLRPASDSWSKGYSPMFKYEWEPTYESLSKYAETTEGSPFDGVLMNYVNPVTGGPVMQTIGASMQMLRPGETTKAHRHTGSVIYQVAKGQGYSIIGGKRFDWQERDIFCVPSWAWHEHGNTSRSEDACLFSFNDLPVIESLGLYREEAYGDNAGHQPAAA

Samples

Sample ID Description Type Environment
1 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
2 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
3 2599185317 Pseudomonas sp. NFACC06-1 Isolate Rhizoplane
4 2600254930 Pseudomonas sp. NFIX10 Isolate Rhizoplane
5 2643221547 Pseudolabrys sp. Root1462 Isolate Unclassified
6 2643221736 Bosea sp. Root483D1 Isolate Unclassified
7 2721755686 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
8 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
9 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
10 2740892503 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
11 2751185846 Paraburkholderia ribeironis STM 7296 Isolate Unclassified
12 2791355199
13 2838054893 Variovorax guangxiensis 34/80 Isolate Nodule
14 2841760612 Bosea sp. Tri-49 Isolate Nodule
15 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
16 2844104063 Bosea sp. Tri-39 Isolate Nodule
17 2851246043 Bosea sp. Tri-54 Isolate Nodule
18 2856349417 Mesorhizobium sp. M4A.F.Ca.ET.090.04.2.1 Isolate Nodule
19 2856356410 Mesorhizobium sp. M4B.F.Ca.ET.088.02.2.1 Isolate Nodule
20 2873314349 Sphaerisporangium siamense DSM 45784 Isolate Rhizosphere
21 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
22 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
23 2878753008 Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 Isolate Nodule
24 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
25 2881155292 Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 Isolate Nodule
26 2881853255 Mesorhizobium sp. M4A.F.Ca.ET.020.02.1.1 Isolate Nodule
27 2881861095 Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 Isolate Nodule
28 2882912400 Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 Isolate Nodule
29 2885318864 Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 Isolate Nodule
30 2885342637 Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 Isolate Nodule
31 2885350715 Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 Isolate Nodule
32 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
33 2889914905 Chelativorans alearense UJN715 Isolate Rhizosphere
34 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
35 2904439833 Herbaspirillum sp. 1589 Isolate Rhizosphere
36 2904530477 Herbaspirillum huttiense 611 Isolate Unclassified
37 2904584206 Herbaspirillum sp. 1050 Isolate Unclassified
38 2904589729 Herbaspirillum sp. 1130 Isolate Unclassified
39 2904601388 Herbaspirillum sp. 1273 Isolate Rhizosphere
40 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
41 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
42 2919079590 Herbaspirillum sp. 1173 Isolate Unclassified
43 2919509842 Flavobacterium arsenatis 3773 Isolate Unclassified
44 2923153595 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
45 2924784321 Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 Isolate Nodule
46 2928130867 Herbaspirillum seropedicae 1977 Isolate Unclassified
47 2935390628 Streptomyces sp. PvR034 Isolate Rhizosphere
48 2939631187 Ottowia thiooxydans 2709 Isolate Rhizosphere
49 2961127735 Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 Isolate Nodule
50 2961170736 Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 Isolate Nodule
51 2967996073 Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 Isolate Nodule
52 2968003550 Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 Isolate Nodule
53 2970503327 Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 Isolate Nodule
54 2977821940 Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 Isolate Nodule
55 2977828996 Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 Isolate Nodule
56 2979808191 Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 Isolate Nodule
57 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
58 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
59 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
60 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
61 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
62 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
63 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
64 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
65 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
66 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
67 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
68 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
69 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
70 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
71 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
72 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
73 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
74 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
75 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
76 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
77 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
78 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
79 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
80 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
81 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
82 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
83 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
84 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
85 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
86 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
87 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
88 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
89 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
90 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
91 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
92 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
93 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
94 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
95 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
96 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
97 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
98 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
99 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
100 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
101 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
102 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
103 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
104 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
105 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
106 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
107 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
108 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
109 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
110 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
111 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
112 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
113 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
114 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
115 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
116 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
117 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
118 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
119 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
120 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
121 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
122 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
123 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
124 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
125 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
126 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
127 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
128 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
152 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
153 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
154 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
155 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
157 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
158 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
159 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
160 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
161 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
162 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
163 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
164 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
165 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
166 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
167 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
168 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
169 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
170 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
171 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
172 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
173 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
174 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
175 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
176 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
177 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
178 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
179 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
180 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
181 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
182 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
183 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
184 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
185 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
186 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
187 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
188 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
189 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
190 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
191 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
192 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
193 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
194 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
195 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
196 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
197 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
198 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
199 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
200 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
201 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
202 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
203 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
204 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
205 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
206 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
207 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
208 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
209 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
210 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
211 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
212 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
213 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
214 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
215 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
216 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
217 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
218 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
219 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
220 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
221 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
222 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
223 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
224 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
225 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
226 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
227 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
228 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
229 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
230 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
231 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
232 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
233 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
234 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
235 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
236 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
237 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
238 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
239 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
240 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
241 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
242 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
243 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
244 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
245 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
246 8002392321 Alcaligenes faecalis Mc250 Isolate Rhizosphere
247 8004374579 Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 Isolate Nodule
248 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
249 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
250 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
251 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
252 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
253 8055266321 Paraburkholderia rhynchosiae LMG 27174 Isolate Nodule
254 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
255 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule
256 8057529695 Bosea vestrisii A18/4-2 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 80.7
Metatranscriptomes 0
Isolates 19.3

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.7
Nodule 13.7
Rhizoplane 2.33
Rhizosphere 58.89
Stem 0
Stem Tuber 0
Unclassified 11.37

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25156J39149_1000789 3300002705 Bacteria 16296
2 JGI25159J45721_1006094 3300002987 Bacteria 3662
3 JGI25406J46586_10005542 3300003203 Bacteria 5846
4 JGI25406J46586_10008043 3300003203 Bacteria 4789
5 JGI25153J46596_10022066 3300003215 Bacteria 2358
6 JGI25404J52841_10000914 3300003659 Bacteria 4798
7 Ga0055533_1000665 3300003756 Bacteria 11414
8 Ga0055526_1000755 3300003771 Bacteria 24181
9 Ga0055524_1000208 3300003775 Bacteria 63030
10 Ga0065165_1000240 3300005262 Bacteria 93895
11 Ga0068869_100253374 3300005334 Bacteria 1407
12 Ga0070680_100119994 3300005336 Bacteria 2194
13 Ga0068868_100049781 3300005338 Bacteria 3288
14 Ga0070660_100003172 3300005339 Bacteria 11294
15 Ga0070668_100041440 3300005347 Bacteria 3527
16 Ga0070678_100024448 3300005456 Bacteria 4044
17 Ga0070679_100275745 3300005530 Bacteria 1635
18 Ga0070686_100221065 3300005544 Bacteria 1369
19 Ga0070665_100018220 3300005548 Bacteria 7043
20 Ga0068855_100009931 3300005563 Bacteria 11479
21 Ga0068855_100011516 3300005563 Bacteria 10688
22 Ga0068855_100102442 3300005563 Bacteria 3295
23 Ga0068855_100228708 3300005563 Bacteria 2083
24 Ga0070664_100106615 3300005564 Bacteria 2441
25 Ga0068857_100112077 3300005577 Bacteria 2453
26 Ga0068854_100007947 3300005578 Bacteria 6792
27 Ga0068852_100051109 3300005616 Bacteria 3545
28 Ga0068859_100048944 3300005617 Bacteria 4245
29 Ga0068859_100168761 3300005617 Bacteria 2269
30 Ga0068861_100046879 3300005719 Bacteria 3260
31 Ga0068861_100081508 3300005719 Bacteria 2534
32 Ga0081455_10003864 3300005937 Bacteria 17077
33 Ga0081455_10012043 3300005937 Bacteria 8655
34 Ga0081455_10021557 3300005937 Bacteria 6040
35 Ga0081455_10033377 3300005937 Bacteria 4626
36 Ga0081540_1001736 3300005983 Bacteria 18346
37 Ga0081540_1023610 3300005983 Bacteria 3592
38 Ga0081540_1029904 3300005983 Bacteria 3026
39 Ga0081539_10000466 3300005985 Bacteria 85716
40 Ga0081539_10002040 3300005985 Bacteria 30429
41 Ga0081539_10023321 3300005985 Bacteria 4057
42 Ga0075365_10010066 3300006038 Bacteria 5482
43 Ga0075365_10010109 3300006038 Bacteria 5475
44 Ga0075363_100004113 3300006048 Bacteria 6311
45 Ga0075363_100063203 3300006048 Bacteria 1997
46 Ga0075364_10006585 3300006051 Bacteria 6837
47 Ga0075364_10016348 3300006051 Bacteria 4615
48 Ga0075362_10000112 3300006177 Bacteria 22525
49 Ga0075362_10046156 3300006177 Bacteria 1937
50 Ga0075367_10117920 3300006178 Bacteria 1634
51 Ga0075369_10016193 3300006186 Bacteria 3004
52 Ga0075369_10074834 3300006186 Bacteria 1495
53 Ga0075366_10004774 3300006195 Bacteria 7306
54 Ga0075366_10087849 3300006195 Bacteria 1861
55 Ga0075370_10014421 3300006353 Bacteria 4216
56 Ga0075434_100001388 3300006871 Bacteria 20316
57 Ga0097620_100048939 3300006931 Bacteria 4245
58 Ga0097620_100168756 3300006931 Bacteria 2269
59 Ga0099824_1019122 3300006942 Bacteria 5432
60 Ga0099822_1001679 3300006943 Bacteria 26417
61 Ga0075435_100002597 3300007076 Bacteria 12050
62 Ga0105244_10044801 3300009036 Bacteria 2278
63 Ga0105240_10000791 3300009093 Bacteria 57291
64 Ga0105240_10021237 3300009093 Bacteria 8640
65 Ga0105240_10023240 3300009093 Bacteria 8207
66 Ga0105240_10060813 3300009093 Bacteria 4708
67 Ga0105245_10016233 3300009098 Bacteria 6491
68 Ga0105247_10217140 3300009101 Bacteria 1293
69 Ga0114129_10138219 3300009147 Bacteria 3342
70 Ga0105242_10002748 3300009176 Bacteria 13770
71 Ga0105237_10003012 3300009545 Bacteria 20328
72 Ga0105237_10006659 3300009545 Bacteria 12767
73 Ga0105238_10000031 3300009551 Bacteria 179497
74 Ga0105238_10028589 3300009551 Bacteria 5679
75 Ga0105238_10132779 3300009551 Bacteria 2468
76 Ga0105239_10000539 3300010375 Bacteria 54773
77 Ga0105239_10231830 3300010375 Bacteria 2071
78 Ga0105246_10195627 3300011119 Bacteria 1568
79 Ga0157369_10233159 3300013105 Bacteria 1924
80 Ga0157369_10369977 3300013105 Bacteria 1488
81 Ga0163162_10129220 3300013306 Bacteria 2635
82 Ga0157372_10406570 3300013307 Bacteria 1586
83 Ga0163163_10164897 3300014325 Bacteria 2262
84 Ga0157380_10377741 3300014326 Bacteria 1336
85 Ga0157379_10028238 3300014968 Bacteria 4994
86 Ga0157379_10156389 3300014968 Bacteria 2057
87 Ga0182006_1001130 3300015261 Bacteria 16976
88 Ga0213874_10024527 3300021377 Bacteria 1692
89 Ga0213876_10001486 3300021384 Bacteria 14588
90 Ga0213876_10018284 3300021384 Bacteria 3700
91 Ga0213875_10002788 3300021388 Bacteria 10304
92 Ga0209674_100214 3300025226 Bacteria 55846
93 Ga0209148_1000882 3300025254 Bacteria 20579
94 Ga0209759_1000251 3300025256 Bacteria 79885
95 Ga0209759_1000413 3300025256 Bacteria 52782
96 Ga0209455_1008123 3300025272 Bacteria 2885
97 Ga0209130_1000061 3300025284 Bacteria 200990
98 Ga0209675_1000262 3300025291 Bacteria 51344
99 Ga0209025_1001266 3300025294 Bacteria 34874
100 Ga0209564_1000403 3300025295 Bacteria 76834
101 Ga0209758_1000139 3300025297 Bacteria 175148
102 Ga0209758_1006318 3300025297 Bacteria 8593
103 Ga0209256_1000436 3300025299 Bacteria 64360
104 Ga0207710_10036628 3300025900 Bacteria 2164
105 Ga0207645_10028942 3300025907 Bacteria 3572
106 Ga0207643_10119418 3300025908 Bacteria 1560
107 Ga0207695_10000480 3300025913 Bacteria 85456
108 Ga0207695_10004295 3300025913 Bacteria 19526
109 Ga0207695_10397080 3300025913 Bacteria 1263
110 Ga0207671_10006025 3300025914 Bacteria 10954
111 Ga0207671_10019471 3300025914 Bacteria 5189
112 Ga0207660_10145352 3300025917 Bacteria 1817
113 Ga0207657_10010531 3300025919 Bacteria 9220
114 Ga0207652_10131490 3300025921 Bacteria 2232
115 Ga0207681_10279837 3300025923 Bacteria 1313
116 Ga0207694_10000062 3300025924 Bacteria 140156
117 Ga0207694_10089956 3300025924 Bacteria 2421
118 Ga0207694_10111463 3300025924 Bacteria 2177
119 Ga0207687_10012740 3300025927 Bacteria 5494
120 Ga0207711_10075893 3300025941 Bacteria 2926
121 Ga0207689_10195071 3300025942 Bacteria 1671
122 Ga0207661_10136254 3300025944 Bacteria 2109
123 Ga0207667_10000044 3300025949 Bacteria 248251
124 Ga0207667_10007621 3300025949 Bacteria 12970
125 Ga0207667_10007851 3300025949 Bacteria 12743
126 Ga0207712_10053162 3300025961 Bacteria 2840
127 Ga0207668_10101412 3300025972 Bacteria 2139
128 Ga0207639_10010317 3300026041 Bacteria 6467
129 Ga0207708_10326483 3300026075 Bacteria 1253
130 Ga0207674_10156491 3300026116 Bacteria 2234
131 Ga0207675_100066780 3300026118 Bacteria 3362
132 Ga0207675_100099492 3300026118 Bacteria 2739
133 Ga0207683_10119160 3300026121 Bacteria 2368
134 Ga0207698_10078175 3300026142 Bacteria 2655
135 Ga0209371_1009655 3300027312 Bacteria 3046
136 Ga0209589_1000001 3300027357 Bacteria 794224
137 Ga0209489_100001 3300027361 Bacteria 794224
138 Ga0209700_100001 3300027363 Bacteria 794224
139 Ga0268266_10004589 3300028379 Bacteria 13186
140 Ga0268266_10005936 3300028379 Bacteria 11292
141 Ga0307517_10002374 3300028786 Bacteria 30296
142 Ga0307515_10002752 3300028794 Bacteria 37583
143 Ga0307515_10011951 3300028794 Bacteria 16399
144 Ga0307515_10030402 3300028794 Bacteria 9069
145 Ga0307515_10174978 3300028794 Bacteria 2121
146 Ga0268256_1010264 3300030500 Bacteria 3046
147 Ga0307513_10013361 3300031456 Bacteria 10083
148 Ga0265342_10000546 3300031712 Bacteria 39732
149 Ga0307516_10006465 3300031730 Bacteria 13722
150 Ga0307516_10184811 3300031730 Bacteria 1815
151 Ga0307413_10061517 3300031824 Bacteria 2317
152 Ga0307409_100194971 3300031995 Bacteria 1807
153 Ga0307411_10010884 3300032005 Bacteria 4876
154 Ga0307415_100038093 3300032126 Bacteria 3166
155 Ga0373941_0044184 3300035115 Bacteria 1389
156 Ga0395900_0011759 3300037418 Bacteria 8949
157 Ga0395900_0198953 3300037418 Bacteria 2029
158 Ga0395898_0058614 3300037466 Bacteria 3748
159 Ga0395905_0056567 3300037471 Bacteria 3669
160 Ga0436364_0421164 3300037853 Bacteria 10341
161 Ga0436364_1107253 3300037853 Bacteria 3693
162 Ga0436365_1253031 3300039437 Bacteria 47093
163 Ga0436360_0511683 3300039438 Bacteria 2798
164 Ga0436363_1230015 3300039450 Bacteria 36424
165 Ga0436363_1330926 3300039450 Bacteria 7516
166 Ga0436362_0207695 3300039453 Bacteria 5197
167 Ga0466969_0019810 3300044656 Bacteria 3490
168 Ga0466972_0004102 3300044658 Bacteria 7270
169 Ga0466972_0048755 3300044658 Bacteria 2046
170 Ga0466965_0008271 3300044683 Bacteria 4808
171 Ga0466963_0003572 3300044694 Bacteria 8932
172 Ga0466964_0004424 3300044706 Bacteria 5188
173 Ga0466968_0000262 3300044735 Bacteria 16806
174 Ga0466957_0176622 3300044842 Bacteria 1393
175 Ga0466960_0091675 3300044901 Bacteria 1550
176 Ga0466959_0119276 3300045049 Bacteria 1877
177 Ga0466967_0013872 3300045976 Bacteria 6249
178 Ga0495638_0136700 3300046460 Bacteria 1434
179 Ga0495582_0081436 3300046473 Bacteria 1798
180 Ga0495598_0004278 3300046537 Bacteria 3081
181 Ga0495621_0011237 3300046539 Bacteria 2763
182 Ga0495645_0018054 3300046543 Bacteria 5062
183 Ga0495633_0032731 3300046558 Bacteria 2511
184 Ga0495656_0001705 3300046615 Bacteria 7199
185 Ga0495589_0047078 3300046794 Bacteria 2138
186 Ga0495672_0006976 3300047320 Bacteria 8585
187 Ga0495686_0057027 3300047472 Bacteria 2439
188 Ga0495593_0043790 3300047673 Bacteria 2397
189 Ga0495615_0011057 3300048090 Bacteria 1824
190 Ga0496101_0179050 3300048904 Bacteria 1632
191 Ga0496104_0000193 3300048907 Bacteria 55038
192 Ga0496109_0055328 3300048912 Bacteria 3620
193 Ga0496109_0197898 3300048912 Bacteria 1889
194 Ga0496111_0072617 3300048914 Bacteria 2505
195 Ga0496112_0501513 3300048915 Bacteria 1149
196 Ga0496122_0042805 3300048925 Bacteria 3557
197 Ga0496123_0012523 3300048926 Bacteria 7224
198 Ga0496126_0073108 3300048929 Bacteria 3049
199 Ga0501031_0192051 3300049568 Bacteria 1333
200 Ga0501032_0021396 3300049569 Bacteria 4495
201 Ga0501033_0011208 3300049570 Bacteria 6865
202 Ga0501033_0011580 3300049570 Bacteria 6749
203 Ga0501033_0022968 3300049570 Bacteria 4702
204 Ga0501034_0006365 3300049571 Bacteria 12715
205 Ga0501034_0011735 3300049571 Bacteria 9065
206 Ga0501034_0021229 3300049571 Bacteria 6622
207 Ga0501034_0022706 3300049571 Bacteria 6391
208 Ga0501034_0027684 3300049571 Bacteria 5764
209 Ga0501034_0048783 3300049571 Bacteria 4272
210 Ga0501034_0164396 3300049571 Bacteria 2188
211 Ga0501034_0195737 3300049571 Bacteria 1981
212 Ga0501036_0012010 3300049572 Bacteria 7178
213 Ga0501036_0050248 3300049572 Bacteria 3531
214 Ga0501037_0038360 3300049573 Bacteria 3529
215 Ga0501037_0167703 3300049573 Bacteria 1562
216 Ga0501038_0019660 3300049574 Bacteria 6080
217 Ga0501039_0013349 3300049575 Bacteria 6279
218 Ga0501039_0106455 3300049575 Bacteria 2190
219 Ga0501043_0003934 3300049579 Bacteria 12187
220 Ga0501043_0054152 3300049579 Bacteria 3151
221 Ga0501043_0076602 3300049579 Bacteria 2628
222 Ga0501046_0010415 3300049580 Bacteria 7988
223 Ga0501047_0000016 3300049581 Bacteria 284621
224 Ga0501047_0000136 3300049581 Bacteria 89236
225 Ga0501047_0015389 3300049581 Bacteria 7286
226 Ga0501047_0021961 3300049581 Bacteria 6129
227 Ga0501069_0102660 3300049585 Bacteria 1624
228 Ga0501069_0136467 3300049585 Bacteria 1406
229 Ga0501070_0010669 3300049586 Bacteria 7771
230 Ga0501070_0017659 3300049586 Bacteria 5989
231 Ga0501070_0030491 3300049586 Bacteria 4519
232 Ga0501070_0040598 3300049586 Bacteria 3880
233 Ga0501071_0010577 3300049587 Bacteria 6189
234 Ga0501072_0023012 3300049588 Bacteria 4838
235 Ga0501072_0139119 3300049588 Bacteria 1936
236 Ga0501073_0034825 3300049589 Bacteria 3581
237 Ga0501073_0090503 3300049589 Bacteria 2126
238 Ga0501074_0068157 3300049590 Bacteria 2558
239 Ga0501249_001307 3300049679 Bacteria 5185
240 Ga0501079_0216659 3300049741 Bacteria 1495
241 Ga0501080_0003134 3300049742 Bacteria 14562
242 Ga0501080_0052627 3300049742 Bacteria 3789
243 Ga0501080_0146539 3300049742 Bacteria 2182
244 Ga0501080_0198459 3300049742 Bacteria 1842
245 Ga0501083_0010987 3300049744 Bacteria 6364
246 Ga0501035_0007097 3300049822 Bacteria 10475
247 Ga0501035_0042187 3300049822 Bacteria 4116
248 Ga0501035_0120271 3300049822 Bacteria 2297
249 Ga0501044_0005059 3300049823 Bacteria 14717
250 Ga0501044_0009381 3300049823 Bacteria 10665
251 Ga0501044_0142663 3300049823 Bacteria 2383
252 Ga0501044_0211866 3300049823 Bacteria 1891
253 nmdc:mga03683_18482_c1 3300050489 Bacteria 2651
254 nmdc:mga03n38_12414_c1 3300050490 Bacteria 3205
255 nmdc:mga03n38_38383_c1 3300050490 Bacteria 2071
256 nmdc:mga00v17_51400_c1 3300050491 Bacteria 2506
257 nmdc:mga00v17_83682_c1 3300050491 Bacteria 1996
258 nmdc:mga0yw44_24944_c1 3300050492 Bacteria 3392
259 nmdc:mga0yw44_38707_c1 3300050492 Bacteria 2824
260 nmdc:mga0k408_515_c1 3300050493 Bacteria 21248
261 nmdc:mga06z11_26328_c1 3300050494 Bacteria 2767
262 nmdc:mga07m45_128265_c1 3300050496 Bacteria 1467
263 nmdc:mga07m45_60197_c1 3300050496 Bacteria 2149
264 nmdc:mga05p37_136263_c1 3300050507 Bacteria 3010
265 nmdc:mga05p37_152608_c1 3300050507 Bacteria 2824
266 nmdc:mga0n895_30327_c1 3300050512 Bacteria 5167
267 nmdc:mga0rr50_10912_c1 3300050513 Bacteria 5792
268 nmdc:mga0sz30_99387_c1 3300050516 Bacteria 1270
269 Ga0500641_0101958 3300053096 Bacteria 1231
270 Ga0500595_003730 3300053119 Bacteria 7025
271 Ga0500616_0078759 3300053153 Bacteria 1661
272 Ga0500627_0073930 3300053158 Bacteria 1513
273 Ga0500645_018811 3300053730 Bacteria 2153
274 Ga0590071_004390 3300059421 Bacteria 3428
275 Ga0501082_0045517 3300060353 Bacteria 3784
276 Ga0501082_0168815 3300060353 Bacteria 1902

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300050490 nmdc:mga03n38_12414_c1 nmdc:mga03n38_12414_c1_2240_3172 310
2 iso_pu_bacteria 2876808645 2876818409 313
3 iso_pu_bacteria 2879110137 2879113181 313
4 3300048915 Ga0496112_0501513 Ga0496112_0501513_129_1133 333
5 3300044656 Ga0466969_0019810 Ga0466969_0019810_2324_3448 348
6 3300005937 Ga0081455_10003864 Ga0081455_1000386410 349
7 3300049570 Ga0501033_0011208 Ga0501033_0011208_2417_3544 349
8 3300049571 Ga0501034_0022706 Ga0501034_0022706_439_1566 349
9 3300049579 Ga0501043_0076602 Ga0501043_0076602_458_1585 349
10 3300049823 Ga0501044_0005059 Ga0501044_0005059_6318_7445 349
11 3300049571 Ga0501034_0021229 Ga0501034_0021229_1022_2146 350
12 3300049572 Ga0501036_0012010 Ga0501036_0012010_4364_5488 350
13 3300049573 Ga0501037_0167703 Ga0501037_0167703_207_1352 350
14 3300049579 Ga0501043_0003934 Ga0501043_0003934_5347_6471 350
15 3300049581 Ga0501047_0000136 Ga0501047_0000136_5317_6441 350
16 3300049742 Ga0501080_0003134 Ga0501080_0003134_8175_9299 350
17 3300049744 Ga0501083_0010987 Ga0501083_0010987_5198_6322 350
18 3300049823 Ga0501044_0009381 Ga0501044_0009381_5303_6427 350
19 3300049571 Ga0501034_0164396 Ga0501034_0164396_631_1755 351
20 3300049569 Ga0501032_0021396 Ga0501032_0021396_2228_3373 353
21 3300049570 Ga0501033_0011580 Ga0501033_0011580_1893_3038 353
22 3300049571 Ga0501034_0006365 Ga0501034_0006365_4648_5772 353
23 3300049571 Ga0501034_0048783 Ga0501034_0048783_722_1867 353
24 3300049572 Ga0501036_0050248 Ga0501036_0050248_1187_2332 353
25 3300049573 Ga0501037_0038360 Ga0501037_0038360_157_1302 353
26 3300049580 Ga0501046_0010415 Ga0501046_0010415_4859_6004 353
27 3300049581 Ga0501047_0021961 Ga0501047_0021961_3624_4769 353
28 3300049587 Ga0501071_0010577 Ga0501071_0010577_2307_3452 353
29 3300049589 Ga0501073_0034825 Ga0501073_0034825_2013_3158 353
30 3300049742 Ga0501080_0052627 Ga0501080_0052627_2013_3158 353
31 3300060353 Ga0501082_0168815 Ga0501082_0168815_699_1844 353
32 3300039438 Ga0436360_0511683 Ga0436360_0511683_1282_2385 355
33 3300049823 Ga0501044_0142663 Ga0501044_0142663_540_1643 356
34 3300006186 Ga0075369_10016193 Ga0075369_100161933 357
35 3300025914 Ga0207671_10019471 Ga0207671_100194713 358
36 3300025924 Ga0207694_10089956 Ga0207694_100899563 358
37 3300026041 Ga0207639_10010317 Ga0207639_100103175 358
38 3300049570 Ga0501033_0022968 Ga0501033_0022968_967_2091 358
39 3300049571 Ga0501034_0011735 Ga0501034_0011735_3949_5073 358
40 3300049575 Ga0501039_0106455 Ga0501039_0106455_879_2003 358
41 3300049586 Ga0501070_0010669 Ga0501070_0010669_1055_2179 358
42 3300005336 Ga0070680_100119994 Ga0070680_1001199942 359
43 3300005339 Ga0070660_100003172 Ga0070660_1000031722 359
44 3300005563 Ga0068855_100228708 Ga0068855_1002287082 359
45 3300025919 Ga0207657_10010531 Ga0207657_100105314 359
46 3300031712 Ga0265342_10000546 Ga0265342_1000054619 359
47 3300037853 Ga0436364_0421164 Ga0436364_0421164_1484_2608 359
48 3300049822 Ga0501035_0120271 Ga0501035_0120271_785_1906 359
49 3300013105 Ga0157369_10233159 Ga0157369_102331592 360
50 3300005563 Ga0068855_100011516 Ga0068855_1000115164 361
51 3300005563 Ga0068855_100102442 Ga0068855_1001024424 361
52 3300025944 Ga0207661_10136254 Ga0207661_101362542 361
53 3300025949 Ga0207667_10007621 Ga0207667_100076213 361
54 3300026142 Ga0207698_10078175 Ga0207698_100781754 361
55 3300044842 Ga0466957_0176622 Ga0466957_0176622_38_1243 361
56 3300049581 Ga0501047_0015389 Ga0501047_0015389_5949_7073 361
57 3300049588 Ga0501072_0139119 Ga0501072_0139119_738_1862 361
58 3300049589 Ga0501073_0090503 Ga0501073_0090503_815_1939 361
59 3300060353 Ga0501082_0045517 Ga0501082_0045517_829_1953 361
60 3300025917 Ga0207660_10145352 Ga0207660_101453522 362
61 iso_pu_bacteria 2873314349 2873319457 362
62 iso_pu_bacteria 8055266321 8055272014 362
63 3300046794 Ga0495589_0047078 Ga0495589_0047078_1036_2127 363
64 3300005563 Ga0068855_100009931 Ga0068855_1000099313 364
65 3300005937 Ga0081455_10021557 Ga0081455_100215577 364
66 3300009093 Ga0105240_10000791 Ga0105240_1000079134 364
67 3300009545 Ga0105237_10003012 Ga0105237_100030126 364
68 3300010375 Ga0105239_10231830 Ga0105239_102318302 364
69 3300013105 Ga0157369_10369977 Ga0157369_103699772 364
70 3300013307 Ga0157372_10406570 Ga0157372_104065702 364
71 3300025913 Ga0207695_10004295 Ga0207695_100042959 364
72 3300025949 Ga0207667_10007851 Ga0207667_100078514 364
73 3300028379 Ga0268266_10004589 Ga0268266_100045899 364
74 iso_pu_bacteria 2740892503 2743738585 364
75 iso_pu_bacteria 2919509842 2919511303 364
76 iso_pu_bacteria 2923153595 2923157648 364
77 3300047472 Ga0495686_0057027 Ga0495686_0057027_322_1419 365
78 3300021377 Ga0213874_10024527 Ga0213874_100245272 366
79 3300021384 Ga0213876_10001486 Ga0213876_1000148611 366
80 3300021384 Ga0213876_10018284 Ga0213876_100182843 366
81 3300021388 Ga0213875_10002788 Ga0213875_100027887 366
82 3300027312 Ga0209371_1009655 Ga0209371_10096553 366
83 3300030500 Ga0268256_1010264 Ga0268256_10102642 366
84 3300037853 Ga0436364_1107253 Ga0436364_1107253_1157_2257 366
85 3300039437 Ga0436365_1253031 Ga0436365_1253031_4983_6083 366
86 3300039450 Ga0436363_1230015 Ga0436363_1230015_19920_21020 366
87 3300039450 Ga0436363_1330926 Ga0436363_1330926_1244_2344 366
88 3300039453 Ga0436362_0207695 Ga0436362_0207695_96_1196 366
89 iso_pu_bacteria 2856356410 2856360551 366
90 iso_pu_bacteria 2935390628 2935393157 366
91 3300005530 Ga0070679_100275745 Ga0070679_1002757451 367
92 3300009551 Ga0105238_10132779 Ga0105238_101327793 367
93 3300025921 Ga0207652_10131490 Ga0207652_101314902 367
94 3300025924 Ga0207694_10111463 Ga0207694_101114632 367
95 3300048907 Ga0496104_0000193 Ga0496104_0000193_19895_21001 367
96 3300049575 Ga0501039_0013349 Ga0501039_0013349_3047_4150 367
97 3300049579 Ga0501043_0054152 Ga0501043_0054152_290_1393 367
98 3300049581 Ga0501047_0000016 Ga0501047_0000016_96268_97371 367
99 3300049586 Ga0501070_0030491 Ga0501070_0030491_2551_3654 367
100 3300049588 Ga0501072_0023012 Ga0501072_0023012_3074_4177 367
101 3300049590 Ga0501074_0068157 Ga0501074_0068157_70_1173 367
102 3300049742 Ga0501080_0198459 Ga0501080_0198459_599_1702 367
103 3300049822 Ga0501035_0042187 Ga0501035_0042187_2404_3507 367
104 3300050507 nmdc:mga05p37_136263_c1 nmdc:mga05p37_136263_c1_1406_2512 367
105 3300002987 JGI25159J45721_1006094 JGI25159J45721_10060942 368
106 3300005262 Ga0065165_1000240 Ga0065165_100024044 368
107 3300025284 Ga0209130_1000061 Ga0209130_1000061124 368
108 3300005616 Ga0068852_100051109 Ga0068852_1000511093 369
109 3300006048 Ga0075363_100063203 Ga0075363_1000632032 369
110 3300014968 Ga0157379_10028238 Ga0157379_100282385 369
111 iso_pu_bacteria 2721755686 2723578136 369
112 iso_pu_bacteria 2856349417 2856353197 369
113 iso_pu_bacteria 2878753008 2878754100 369
114 iso_pu_bacteria 2881155292 2881158096 369
115 iso_pu_bacteria 2881853255 2881855602 369
116 iso_pu_bacteria 2881861095 2881864146 369
117 iso_pu_bacteria 2882912400 2882917133 369
118 iso_pu_bacteria 2885318864 2885324420 369
119 iso_pu_bacteria 2885342637 2885347305 369
120 iso_pu_bacteria 2885350715 2885354901 369
121 iso_pu_bacteria 2889914905 2889918642 369
122 iso_pu_bacteria 2903492973 2903494597 369
123 iso_pu_bacteria 2924784321 2924788822 369
124 iso_pu_bacteria 2961127735 2961132734 369
125 iso_pu_bacteria 2961170736 2961171732 369
126 iso_pu_bacteria 2967996073 2967996563 369
127 iso_pu_bacteria 2968003550 2968010226 369
128 iso_pu_bacteria 2970503327 2970504328 369
129 iso_pu_bacteria 2977821940 2977823315 369
130 iso_pu_bacteria 2977828996 2977831947 369
131 iso_pu_bacteria 2979808191 2979808965 369
132 iso_pu_bacteria 8004374579 8004375676 369
133 3300046543 Ga0495645_0018054 Ga0495645_0018054_542_1660 370
134 iso_pu_bacteria 2643221547 2643754709 370
135 iso_pu_bacteria 2643221736 2644744833 370
136 iso_pu_bacteria 2841760612 2841764338 370
137 iso_pu_bacteria 2842482326 2842486489 370
138 iso_pu_bacteria 2844104063 2844108207 370
139 iso_pu_bacteria 2851246043 2851250773 370
140 iso_pu_bacteria 2904690495 2904698451 370
141 iso_pu_bacteria 8002392321 8002392383 370
142 iso_pu_bacteria 8006984368 8006988304 370
143 iso_pu_bacteria 8056673599 8056679734 370
144 iso_pu_bacteria 8057529695 8057532233 370
145 iso_pu_bacteria 2513237101 2513698244 371
146 iso_pu_bacteria 2524023228 2524533992 371
147 iso_pu_bacteria 2599185317 2600028829 371
148 iso_pu_bacteria 2600254930 2600357996 371
149 iso_pu_bacteria 2721755755 2723848574 371
150 iso_pu_bacteria 2728368998 2728755227 371
151 iso_pu_bacteria 2751185846 2753568313 371
152 iso_pu_bacteria 2791355199 2793077552 371
153 iso_pu_bacteria 2874604998 2874606251 371
154 iso_pu_bacteria 2889033259 2889036843 371
155 iso_pu_bacteria 2908756301 2908762537 371
156 iso_pu_bacteria 8006933436 8006940050 371
157 iso_pu_bacteria 8006964411 8006968543 371
158 iso_pu_bacteria 8006973647 8006979832 371
159 iso_pu_bacteria 8006994254 8006999543 371
160 iso_pu_bacteria 8056689827 8056692759 371
161 3300003203 JGI25406J46586_10005542 JGI25406J46586_100055422 372
162 3300005334 Ga0068869_100253374 Ga0068869_1002533741 372
163 3300005338 Ga0068868_100049781 Ga0068868_1000497813 372
164 3300005564 Ga0070664_100106615 Ga0070664_1001066152 372
165 3300005577 Ga0068857_100112077 Ga0068857_1001120772 372
166 3300005617 Ga0068859_100048944 Ga0068859_1000489443 372
167 3300005617 Ga0068859_100168761 Ga0068859_1001687612 372
168 3300005985 Ga0081539_10000466 Ga0081539_1000046648 372
169 3300005985 Ga0081539_10023321 Ga0081539_100233214 372
170 3300006931 Ga0097620_100048939 Ga0097620_1000489393 372
171 3300006931 Ga0097620_100168756 Ga0097620_1001687562 372
172 3300009093 Ga0105240_10060813 Ga0105240_100608133 372
173 3300009098 Ga0105245_10016233 Ga0105245_100162337 372
174 3300009101 Ga0105247_10217140 Ga0105247_102171401 372
175 3300025913 Ga0207695_10397080 Ga0207695_103970801 372
176 3300025927 Ga0207687_10012740 Ga0207687_100127406 372
177 3300025941 Ga0207711_10075893 Ga0207711_100758932 372
178 3300025942 Ga0207689_10195071 Ga0207689_101950712 372
179 3300025972 Ga0207668_10101412 Ga0207668_101014122 372
180 3300026075 Ga0207708_10326483 Ga0207708_103264831 372
181 3300028794 Ga0307515_10002752 Ga0307515_100027523 372
182 3300028794 Ga0307515_10011951 Ga0307515_100119515 372
183 3300031456 Ga0307513_10013361 Ga0307513_100133613 372
184 3300035115 Ga0373941_0044184 Ga0373941_0044184_155_1279 372
185 3300037418 Ga0395900_0011759 Ga0395900_0011759_4088_5212 372
186 3300037466 Ga0395898_0058614 Ga0395898_0058614_1961_3085 372
187 3300046460 Ga0495638_0136700 Ga0495638_0136700_251_1375 372
188 3300046473 Ga0495582_0081436 Ga0495582_0081436_559_1680 372
189 3300048912 Ga0496109_0197898 Ga0496109_0197898_339_1463 372
190 3300048914 Ga0496111_0072617 Ga0496111_0072617_593_1717 372
191 3300049568 Ga0501031_0192051 Ga0501031_0192051_105_1250 372
192 3300049571 Ga0501034_0027684 Ga0501034_0027684_3979_5103 372
193 3300049571 Ga0501034_0195737 Ga0501034_0195737_820_1944 372
194 3300049574 Ga0501038_0019660 Ga0501038_0019660_3120_4265 372
195 3300049585 Ga0501069_0102660 Ga0501069_0102660_288_1412 372
196 3300049586 Ga0501070_0017659 Ga0501070_0017659_4652_5836 372
197 3300049586 Ga0501070_0040598 Ga0501070_0040598_597_1721 372
198 3300049741 Ga0501079_0216659 Ga0501079_0216659_323_1447 372
199 3300049742 Ga0501080_0146539 Ga0501080_0146539_122_1246 372
200 3300049822 Ga0501035_0007097 Ga0501035_0007097_4538_5722 372
201 3300049823 Ga0501044_0211866 Ga0501044_0211866_199_1323 372
202 3300050494 nmdc:mga06z11_26328_c1 nmdc:mga06z11_26328_c1_125_1249 372
203 3300053730 Ga0500645_018811 Ga0500645_018811_844_1968 372
204 3300003203 JGI25406J46586_10008043 JGI25406J46586_100080433 373
205 3300003215 JGI25153J46596_10022066 JGI25153J46596_100220663 373
206 3300003659 JGI25404J52841_10000914 JGI25404J52841_100009144 373
207 3300003771 Ga0055526_1000755 Ga0055526_100075523 373
208 3300003775 Ga0055524_1000208 Ga0055524_100020842 373
209 3300005347 Ga0070668_100041440 Ga0070668_1000414402 373
210 3300005456 Ga0070678_100024448 Ga0070678_1000244483 373
211 3300005544 Ga0070686_100221065 Ga0070686_1002210651 373
212 3300005548 Ga0070665_100018220 Ga0070665_1000182206 373
213 3300005719 Ga0068861_100046879 Ga0068861_1000468793 373
214 3300005937 Ga0081455_10012043 Ga0081455_100120434 373
215 3300005937 Ga0081455_10033377 Ga0081455_100333774 373
216 3300005983 Ga0081540_1001736 Ga0081540_10017363 373
217 3300005983 Ga0081540_1023610 Ga0081540_10236102 373
218 3300005983 Ga0081540_1029904 Ga0081540_10299042 373
219 3300005985 Ga0081539_10002040 Ga0081539_1000204016 373
220 3300006038 Ga0075365_10010066 Ga0075365_100100664 373
221 3300006038 Ga0075365_10010109 Ga0075365_100101092 373
222 3300006048 Ga0075363_100004113 Ga0075363_1000041133 373
223 3300006051 Ga0075364_10006585 Ga0075364_100065852 373
224 3300006051 Ga0075364_10016348 Ga0075364_100163484 373
225 3300006177 Ga0075362_10000112 Ga0075362_1000011215 373
226 3300006177 Ga0075362_10046156 Ga0075362_100461562 373
227 3300006178 Ga0075367_10117920 Ga0075367_101179202 373
228 3300006186 Ga0075369_10074834 Ga0075369_100748341 373
229 3300006195 Ga0075366_10004774 Ga0075366_100047742 373
230 3300006195 Ga0075366_10087849 Ga0075366_100878493 373
231 3300006353 Ga0075370_10014421 Ga0075370_100144212 373
232 3300006871 Ga0075434_100001388 Ga0075434_10000138820 373
233 3300006942 Ga0099824_1019122 Ga0099824_10191222 373
234 3300006943 Ga0099822_1001679 Ga0099822_100167923 373
235 3300007076 Ga0075435_100002597 Ga0075435_1000025977 373
236 3300009147 Ga0114129_10138219 Ga0114129_101382194 373
237 3300011119 Ga0105246_10195627 Ga0105246_101956272 373
238 3300013306 Ga0163162_10129220 Ga0163162_101292203 373
239 3300014325 Ga0163163_10164897 Ga0163163_101648972 373
240 3300014326 Ga0157380_10377741 Ga0157380_103777412 373
241 3300014968 Ga0157379_10156389 Ga0157379_101563892 373
242 3300025254 Ga0209148_1000882 Ga0209148_100088216 373
243 3300025272 Ga0209455_1008123 Ga0209455_10081232 373
244 3300025291 Ga0209675_1000262 Ga0209675_100026242 373
245 3300025294 Ga0209025_1001266 Ga0209025_100126617 373
246 3300025295 Ga0209564_1000403 Ga0209564_100040340 373
247 3300025297 Ga0209758_1000139 Ga0209758_100013946 373
248 3300025297 Ga0209758_1006318 Ga0209758_10063186 373
249 3300025299 Ga0209256_1000436 Ga0209256_100043628 373
250 3300025900 Ga0207710_10036628 Ga0207710_100366282 373
251 3300025907 Ga0207645_10028942 Ga0207645_100289424 373
252 3300025908 Ga0207643_10119418 Ga0207643_101194182 373
253 3300025923 Ga0207681_10279837 Ga0207681_102798371 373
254 3300026118 Ga0207675_100066780 Ga0207675_1000667803 373
255 3300026121 Ga0207683_10119160 Ga0207683_101191602 373
256 3300027357 Ga0209589_1000001 Ga0209589_1000001496 373
257 3300027361 Ga0209489_100001 Ga0209489_100001496 373
258 3300027363 Ga0209700_100001 Ga0209700_100001496 373
259 3300028379 Ga0268266_10005936 Ga0268266_100059362 373
260 3300028786 Ga0307517_10002374 Ga0307517_100023746 373
261 3300028794 Ga0307515_10030402 Ga0307515_100304027 373
262 3300028794 Ga0307515_10174978 Ga0307515_101749782 373
263 3300031730 Ga0307516_10006465 Ga0307516_100064655 373
264 3300031730 Ga0307516_10184811 Ga0307516_101848112 373
265 3300031824 Ga0307413_10061517 Ga0307413_100615172 373
266 3300032005 Ga0307411_10010884 Ga0307411_100108843 373
267 3300032126 Ga0307415_100038093 Ga0307415_1000380934 373
268 3300037418 Ga0395900_0198953 Ga0395900_0198953_311_1438 373
269 3300037471 Ga0395905_0056567 Ga0395905_0056567_217_1344 373
270 3300044658 Ga0466972_0004102 Ga0466972_0004102_4993_6147 373
271 3300044658 Ga0466972_0048755 Ga0466972_0048755_111_1238 373
272 3300044683 Ga0466965_0008271 Ga0466965_0008271_3233_4387 373
273 3300044706 Ga0466964_0004424 Ga0466964_0004424_690_1844 373
274 3300044735 Ga0466968_0000262 Ga0466968_0000262_2573_3727 373
275 3300044901 Ga0466960_0091675 Ga0466960_0091675_106_1233 373
276 3300045049 Ga0466959_0119276 Ga0466959_0119276_166_1293 373
277 3300046537 Ga0495598_0004278 Ga0495598_0004278_887_2014 373
278 3300046539 Ga0495621_0011237 Ga0495621_0011237_59_1186 373
279 3300046558 Ga0495633_0032731 Ga0495633_0032731_468_1595 373
280 3300046615 Ga0495656_0001705 Ga0495656_0001705_601_1728 373
281 3300047320 Ga0495672_0006976 Ga0495672_0006976_6932_8071 373
282 3300047673 Ga0495593_0043790 Ga0495593_0043790_1058_2185 373
283 3300048090 Ga0495615_0011057 Ga0495615_0011057_500_1627 373
284 3300048904 Ga0496101_0179050 Ga0496101_0179050_280_1407 373
285 3300048912 Ga0496109_0055328 Ga0496109_0055328_1349_2476 373
286 3300049585 Ga0501069_0136467 Ga0501069_0136467_37_1164 373
287 3300050489 nmdc:mga03683_18482_c1 nmdc:mga03683_18482_c1_1223_2350 373
288 3300050490 nmdc:mga03n38_38383_c1 nmdc:mga03n38_38383_c1_868_2007 373
289 3300050491 nmdc:mga00v17_51400_c1 nmdc:mga00v17_51400_c1_1281_2408 373
290 3300050491 nmdc:mga00v17_83682_c1 nmdc:mga00v17_83682_c1_550_1677 373
291 3300050492 nmdc:mga0yw44_24944_c1 nmdc:mga0yw44_24944_c1_164_1291 373
292 3300050492 nmdc:mga0yw44_38707_c1 nmdc:mga0yw44_38707_c1_163_1290 373
293 3300050493 nmdc:mga0k408_515_c1 nmdc:mga0k408_515_c1_16502_17629 373
294 3300050496 nmdc:mga07m45_128265_c1 nmdc:mga07m45_128265_c1_168_1292 373
295 3300050496 nmdc:mga07m45_60197_c1 nmdc:mga07m45_60197_c1_242_1369 373
296 3300050507 nmdc:mga05p37_152608_c1 nmdc:mga05p37_152608_c1_841_1968 373
297 3300050512 nmdc:mga0n895_30327_c1 nmdc:mga0n895_30327_c1_149_1285 373
298 3300050513 nmdc:mga0rr50_10912_c1 nmdc:mga0rr50_10912_c1_1671_2807 373
299 3300050516 nmdc:mga0sz30_99387_c1 nmdc:mga0sz30_99387_c1_66_1190 373
300 3300053096 Ga0500641_0101958 Ga0500641_0101958_16_1143 373
301 3300053119 Ga0500595_003730 Ga0500595_003730_4348_5475 373
302 3300053153 Ga0500616_0078759 Ga0500616_0078759_334_1461 373
303 3300053158 Ga0500627_0073930 Ga0500627_0073930_233_1360 373
304 iso_pu_bacteria 2838054893 2838061609 373
305 iso_pu_bacteria 2939631187 2939631627 373
306 3300044694 Ga0466963_0003572 Ga0466963_0003572_2119_3255 374
307 3300045976 Ga0466967_0013872 Ga0466967_0013872_380_1516 374
308 iso_pu_bacteria 2904439833 2904442673 374
309 iso_pu_bacteria 2904530477 2904535118 374
310 iso_pu_bacteria 2904584206 2904588540 374
311 iso_pu_bacteria 2904589729 2904594386 374
312 iso_pu_bacteria 2904601388 2904604781 374
313 iso_pu_bacteria 2919079590 2919083009 374
314 iso_pu_bacteria 2928130867 2928132886 374
315 3300009176 Ga0105242_10002748 Ga0105242_100027484 375
316 3300048925 Ga0496122_0042805 Ga0496122_0042805_743_1873 375
317 3300048926 Ga0496123_0012523 Ga0496123_0012523_10_1140 375
318 3300048929 Ga0496126_0073108 Ga0496126_0073108_1355_2485 375
319 3300049679 Ga0501249_001307 Ga0501249_001307_909_2042 375
320 3300005578 Ga0068854_100007947 Ga0068854_1000079474 376
321 3300009036 Ga0105244_10044801 Ga0105244_100448011 376
322 3300009093 Ga0105240_10021237 Ga0105240_100212377 376
323 3300009093 Ga0105240_10023240 Ga0105240_100232405 376
324 3300009545 Ga0105237_10006659 Ga0105237_100066592 376
325 3300009551 Ga0105238_10000031 Ga0105238_1000003161 376
326 3300010375 Ga0105239_10000539 Ga0105239_1000053947 376
327 3300015261 Ga0182006_1001130 Ga0182006_100113010 376
328 3300025913 Ga0207695_10000480 Ga0207695_1000048055 376
329 3300025914 Ga0207671_10006025 Ga0207671_100060256 376
330 3300025924 Ga0207694_10000062 Ga0207694_1000006271 376
331 3300025949 Ga0207667_10000044 Ga0207667_10000044134 376
332 3300026116 Ga0207674_10156491 Ga0207674_101564912 376
333 3300002705 JGI25156J39149_1000789 JGI25156J39149_100078911 377
334 3300003756 Ga0055533_1000665 Ga0055533_10006657 377
335 3300005719 Ga0068861_100081508 Ga0068861_1000815083 377
336 3300009551 Ga0105238_10028589 Ga0105238_100285894 377
337 3300025226 Ga0209674_100214 Ga0209674_10021441 377
338 3300025256 Ga0209759_1000251 Ga0209759_100025150 377
339 3300025256 Ga0209759_1000413 Ga0209759_10004137 377
340 3300025961 Ga0207712_10053162 Ga0207712_100531623 377
341 3300026118 Ga0207675_100099492 Ga0207675_1000994923 377
342 3300031995 Ga0307409_100194971 Ga0307409_1001949712 377
343 3300059421 Ga0590071_004390 Ga0590071_004390_669_1826 377

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07883

Cupin_2

Cupin domain

237

306

0.92

PF07883

Cupin_2

Cupin domain

65

139

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
2d40-assembly1.cif.gz_A crystal structure of z3393 from escherichia coli o157:h7 0.9608 50 360
2d40-assembly1.cif.gz_B crystal structure of z3393 from escherichia coli o157:h7 0.9582 50 360
2d40-assembly1.cif.gz_B crystal structure of z3393 from escherichia coli o157:h7 0.9516 50 360
3bu7-assembly1.cif.gz_B crystal structure and biochemical characterization of gdosp, a gentisate 1,2-dioxygenase from silicibacter pomeroyi 0.9482 16 373
2d40-assembly1.cif.gz_A crystal structure of z3393 from escherichia coli o157:h7 0.9479 50 360
ID Description Score Start End Superfamily
af_Q9LUJ7_61_262_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9649 271 347 2.60.120.10
2d40B00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9552 50 360 2.60.120.10
2d40B00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9485 50 360 2.60.120.10
3bu7B00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9482 16 373 2.60.120.10
3bu7B00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9456 16 373 2.60.120.10
ID Description Score Start End GO Terms
AF-A0A7Z7KL54-F1-model_v4 deleted 0.9983 248 373
AF-A0A1M3BFN9-F1-model_v4 NADPH dehydrogenase 0.9946 84 373 GO:0051213
AF-A0A7Y9N6Q1-F1-model_v4 Gentisate 1,2-dioxygenase 0.9938 232 371 GO:0051213
AF-A0A1M3BFN9-F1-model_v4 NADPH dehydrogenase 0.9912 84 373 GO:0051213
AF-A0A381PFN2-F1-model_v4 Cupin type-2 domain-containing protein 0.9911 52 373 GO:0051213

Feature Viewer

pLDDT pTM Quality
91.57 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map