F415735
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 343 | 256 | 276 | 370 |
Family's Representative Sequence
| Representative Sequence | 3300048915|Ga0496112_0501513|Ga0496112_0501513_129_1133 |
| Length | 334 |
| Sequence | VANKIEPWEPQSTSVPVLWRYNDLRDHVLRSVELVSPEKAGRRVIYLNNPGRRDVAAAVGWLYSGLQVMHPGEVASAHAHSASALRFIMEGAGAYTVVDGHKMTLGARDFVLTPNGTWHEHGVEPNGSPCIWQDGLDIPLVNALEANFYVVHPKIQQEDSGYRVDDMTKTWGNPGLRPASDSWSKGYSPMFKYEWEPTYESLSKYAETTEGSPFDGVLMNYVNPVTGGPVMQTIGASMQMLRPGETTKAHRHTGSVIYQVAKGQGYSIIGGKRFDWQERDIFCVPSWAWHEHGNTSRSEDACLFSFNDLPVIESLGLYREEAYGDNAGHQPAAA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2513237101 | Bradyrhizobium murdochi WSM1741 | Isolate | Nodule |
| 2 | 2524023228 | Bradyrhizobium sp. Th.b2 | Isolate | Nodule |
| 3 | 2599185317 | Pseudomonas sp. NFACC06-1 | Isolate | Rhizoplane |
| 4 | 2600254930 | Pseudomonas sp. NFIX10 | Isolate | Rhizoplane |
| 5 | 2643221547 | Pseudolabrys sp. Root1462 | Isolate | Unclassified |
| 6 | 2643221736 | Bosea sp. Root483D1 | Isolate | Unclassified |
| 7 | 2721755686 | Mesorhizobium amorphae CCNWGS0123 | Isolate | Nodule |
| 8 | 2721755755 | Bradyrhizobium icense LMTR 13 | Isolate | Nodule |
| 9 | 2728368998 | Bradyrhizobium macuxiense BR 10303 | Isolate | Nodule |
| 10 | 2740892503 | Pseudomonas chlororaphis piscium PCL1391 | Isolate | Unclassified |
| 11 | 2751185846 | Paraburkholderia ribeironis STM 7296 | Isolate | Unclassified |
| 12 | 2791355199 | |||
| 13 | 2838054893 | Variovorax guangxiensis 34/80 | Isolate | Nodule |
| 14 | 2841760612 | Bosea sp. Tri-49 | Isolate | Nodule |
| 15 | 2842482326 | Rhizobium lusitanum SEMIA 4060 | Isolate | Nodule |
| 16 | 2844104063 | Bosea sp. Tri-39 | Isolate | Nodule |
| 17 | 2851246043 | Bosea sp. Tri-54 | Isolate | Nodule |
| 18 | 2856349417 | Mesorhizobium sp. M4A.F.Ca.ET.090.04.2.1 | Isolate | Nodule |
| 19 | 2856356410 | Mesorhizobium sp. M4B.F.Ca.ET.088.02.2.1 | Isolate | Nodule |
| 20 | 2873314349 | Sphaerisporangium siamense DSM 45784 | Isolate | Rhizosphere |
| 21 | 2874604998 | Bradyrhizobium sp. LMTR 3 | Isolate | Nodule |
| 22 | 2876808645 | Bradyrhizobium algeriense RST89 | Isolate | Unclassified |
| 23 | 2878753008 | Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 | Isolate | Nodule |
| 24 | 2879110137 | Bradyrhizobium algeriense RST91 | Isolate | Nodule |
| 25 | 2881155292 | Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 | Isolate | Nodule |
| 26 | 2881853255 | Mesorhizobium sp. M4A.F.Ca.ET.020.02.1.1 | Isolate | Nodule |
| 27 | 2881861095 | Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 | Isolate | Nodule |
| 28 | 2882912400 | Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 | Isolate | Nodule |
| 29 | 2885318864 | Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 | Isolate | Nodule |
| 30 | 2885342637 | Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 | Isolate | Nodule |
| 31 | 2885350715 | Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 | Isolate | Nodule |
| 32 | 2889033259 | Bradyrhizobium sp. CCBAU 051011 | Isolate | Unclassified |
| 33 | 2889914905 | Chelativorans alearense UJN715 | Isolate | Rhizosphere |
| 34 | 2903492973 | Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 | Isolate | Nodule |
| 35 | 2904439833 | Herbaspirillum sp. 1589 | Isolate | Rhizosphere |
| 36 | 2904530477 | Herbaspirillum huttiense 611 | Isolate | Unclassified |
| 37 | 2904584206 | Herbaspirillum sp. 1050 | Isolate | Unclassified |
| 38 | 2904589729 | Herbaspirillum sp. 1130 | Isolate | Unclassified |
| 39 | 2904601388 | Herbaspirillum sp. 1273 | Isolate | Rhizosphere |
| 40 | 2904690495 | Bradyrhizobium ivorense CI-1B | Isolate | Nodule |
| 41 | 2908756301 | Bradyrhizobium ivorense CI-41S | Isolate | Nodule |
| 42 | 2919079590 | Herbaspirillum sp. 1173 | Isolate | Unclassified |
| 43 | 2919509842 | Flavobacterium arsenatis 3773 | Isolate | Unclassified |
| 44 | 2923153595 | Pseudomonas chlororaphis piscium PCL1391 | Isolate | Unclassified |
| 45 | 2924784321 | Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 | Isolate | Nodule |
| 46 | 2928130867 | Herbaspirillum seropedicae 1977 | Isolate | Unclassified |
| 47 | 2935390628 | Streptomyces sp. PvR034 | Isolate | Rhizosphere |
| 48 | 2939631187 | Ottowia thiooxydans 2709 | Isolate | Rhizosphere |
| 49 | 2961127735 | Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 | Isolate | Nodule |
| 50 | 2961170736 | Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 | Isolate | Nodule |
| 51 | 2967996073 | Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 | Isolate | Nodule |
| 52 | 2968003550 | Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 | Isolate | Nodule |
| 53 | 2970503327 | Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 | Isolate | Nodule |
| 54 | 2977821940 | Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 | Isolate | Nodule |
| 55 | 2977828996 | Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 | Isolate | Nodule |
| 56 | 2979808191 | Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 | Isolate | Nodule |
| 57 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 58 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 59 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 60 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 61 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 62 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 63 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 64 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 65 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 66 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 67 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 68 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 69 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 73 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 74 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 76 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 78 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 79 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 80 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 81 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 82 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 83 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 84 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 85 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 86 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 87 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 88 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 89 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 90 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 91 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 92 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 93 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 94 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 96 | 3300006943 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW | Metagenome | Nodule |
| 97 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 98 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 115 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 116 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 117 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 118 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 119 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 120 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 121 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 122 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 123 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 124 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 125 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 126 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 127 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 128 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 153 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 154 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 155 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 157 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 158 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 159 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 160 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 161 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 162 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 163 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 164 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 165 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 166 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 167 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 168 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 169 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 170 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 171 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 172 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 173 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 174 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 175 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 176 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 177 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 178 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 179 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 180 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 181 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 182 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 183 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 184 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 185 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 198 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 199 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 200 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 201 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 202 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 203 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 204 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 205 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 206 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 207 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 208 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 209 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 210 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 211 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 212 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 213 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 214 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 215 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 216 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 217 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 218 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 219 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 220 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 221 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 222 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 223 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 224 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 225 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 226 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 227 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 228 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 229 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 230 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 231 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 232 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 233 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 234 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 235 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 236 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 237 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 238 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 239 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 240 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 241 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 242 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 243 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 244 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 245 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 246 | 8002392321 | Alcaligenes faecalis Mc250 | Isolate | Rhizosphere |
| 247 | 8004374579 | Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 | Isolate | Nodule |
| 248 | 8006933436 | Bradyrhizobium septentrionale 7(2017) | Isolate | Unclassified |
| 249 | 8006964411 | Bradyrhizobium sp. sBnM-33 | Isolate | Nodule |
| 250 | 8006973647 | Bradyrhizobium septentrionale 162S2 | Isolate | Nodule |
| 251 | 8006984368 | Bradyrhizobium sp. SRL28 | Isolate | Unclassified |
| 252 | 8006994254 | Bradyrhizobium sp. sGM-13 | Isolate | Nodule |
| 253 | 8055266321 | Paraburkholderia rhynchosiae LMG 27174 | Isolate | Nodule |
| 254 | 8056673599 | Bradyrhizobium hereditatis WSM 1738 | Isolate | Nodule |
| 255 | 8056689827 | Bradyrhizobium semiaridum WSM 1704 | Isolate | Nodule |
| 256 | 8057529695 | Bosea vestrisii A18/4-2 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 80.7 |
| Metatranscriptomes | 0 |
| Isolates | 19.3 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 13.7 |
| Nodule | 13.7 |
| Rhizoplane | 2.33 |
| Rhizosphere | 58.89 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 11.37 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25156J39149_1000789 | 3300002705 | Bacteria | 16296 |
| 2 | JGI25159J45721_1006094 | 3300002987 | Bacteria | 3662 |
| 3 | JGI25406J46586_10005542 | 3300003203 | Bacteria | 5846 |
| 4 | JGI25406J46586_10008043 | 3300003203 | Bacteria | 4789 |
| 5 | JGI25153J46596_10022066 | 3300003215 | Bacteria | 2358 |
| 6 | JGI25404J52841_10000914 | 3300003659 | Bacteria | 4798 |
| 7 | Ga0055533_1000665 | 3300003756 | Bacteria | 11414 |
| 8 | Ga0055526_1000755 | 3300003771 | Bacteria | 24181 |
| 9 | Ga0055524_1000208 | 3300003775 | Bacteria | 63030 |
| 10 | Ga0065165_1000240 | 3300005262 | Bacteria | 93895 |
| 11 | Ga0068869_100253374 | 3300005334 | Bacteria | 1407 |
| 12 | Ga0070680_100119994 | 3300005336 | Bacteria | 2194 |
| 13 | Ga0068868_100049781 | 3300005338 | Bacteria | 3288 |
| 14 | Ga0070660_100003172 | 3300005339 | Bacteria | 11294 |
| 15 | Ga0070668_100041440 | 3300005347 | Bacteria | 3527 |
| 16 | Ga0070678_100024448 | 3300005456 | Bacteria | 4044 |
| 17 | Ga0070679_100275745 | 3300005530 | Bacteria | 1635 |
| 18 | Ga0070686_100221065 | 3300005544 | Bacteria | 1369 |
| 19 | Ga0070665_100018220 | 3300005548 | Bacteria | 7043 |
| 20 | Ga0068855_100009931 | 3300005563 | Bacteria | 11479 |
| 21 | Ga0068855_100011516 | 3300005563 | Bacteria | 10688 |
| 22 | Ga0068855_100102442 | 3300005563 | Bacteria | 3295 |
| 23 | Ga0068855_100228708 | 3300005563 | Bacteria | 2083 |
| 24 | Ga0070664_100106615 | 3300005564 | Bacteria | 2441 |
| 25 | Ga0068857_100112077 | 3300005577 | Bacteria | 2453 |
| 26 | Ga0068854_100007947 | 3300005578 | Bacteria | 6792 |
| 27 | Ga0068852_100051109 | 3300005616 | Bacteria | 3545 |
| 28 | Ga0068859_100048944 | 3300005617 | Bacteria | 4245 |
| 29 | Ga0068859_100168761 | 3300005617 | Bacteria | 2269 |
| 30 | Ga0068861_100046879 | 3300005719 | Bacteria | 3260 |
| 31 | Ga0068861_100081508 | 3300005719 | Bacteria | 2534 |
| 32 | Ga0081455_10003864 | 3300005937 | Bacteria | 17077 |
| 33 | Ga0081455_10012043 | 3300005937 | Bacteria | 8655 |
| 34 | Ga0081455_10021557 | 3300005937 | Bacteria | 6040 |
| 35 | Ga0081455_10033377 | 3300005937 | Bacteria | 4626 |
| 36 | Ga0081540_1001736 | 3300005983 | Bacteria | 18346 |
| 37 | Ga0081540_1023610 | 3300005983 | Bacteria | 3592 |
| 38 | Ga0081540_1029904 | 3300005983 | Bacteria | 3026 |
| 39 | Ga0081539_10000466 | 3300005985 | Bacteria | 85716 |
| 40 | Ga0081539_10002040 | 3300005985 | Bacteria | 30429 |
| 41 | Ga0081539_10023321 | 3300005985 | Bacteria | 4057 |
| 42 | Ga0075365_10010066 | 3300006038 | Bacteria | 5482 |
| 43 | Ga0075365_10010109 | 3300006038 | Bacteria | 5475 |
| 44 | Ga0075363_100004113 | 3300006048 | Bacteria | 6311 |
| 45 | Ga0075363_100063203 | 3300006048 | Bacteria | 1997 |
| 46 | Ga0075364_10006585 | 3300006051 | Bacteria | 6837 |
| 47 | Ga0075364_10016348 | 3300006051 | Bacteria | 4615 |
| 48 | Ga0075362_10000112 | 3300006177 | Bacteria | 22525 |
| 49 | Ga0075362_10046156 | 3300006177 | Bacteria | 1937 |
| 50 | Ga0075367_10117920 | 3300006178 | Bacteria | 1634 |
| 51 | Ga0075369_10016193 | 3300006186 | Bacteria | 3004 |
| 52 | Ga0075369_10074834 | 3300006186 | Bacteria | 1495 |
| 53 | Ga0075366_10004774 | 3300006195 | Bacteria | 7306 |
| 54 | Ga0075366_10087849 | 3300006195 | Bacteria | 1861 |
| 55 | Ga0075370_10014421 | 3300006353 | Bacteria | 4216 |
| 56 | Ga0075434_100001388 | 3300006871 | Bacteria | 20316 |
| 57 | Ga0097620_100048939 | 3300006931 | Bacteria | 4245 |
| 58 | Ga0097620_100168756 | 3300006931 | Bacteria | 2269 |
| 59 | Ga0099824_1019122 | 3300006942 | Bacteria | 5432 |
| 60 | Ga0099822_1001679 | 3300006943 | Bacteria | 26417 |
| 61 | Ga0075435_100002597 | 3300007076 | Bacteria | 12050 |
| 62 | Ga0105244_10044801 | 3300009036 | Bacteria | 2278 |
| 63 | Ga0105240_10000791 | 3300009093 | Bacteria | 57291 |
| 64 | Ga0105240_10021237 | 3300009093 | Bacteria | 8640 |
| 65 | Ga0105240_10023240 | 3300009093 | Bacteria | 8207 |
| 66 | Ga0105240_10060813 | 3300009093 | Bacteria | 4708 |
| 67 | Ga0105245_10016233 | 3300009098 | Bacteria | 6491 |
| 68 | Ga0105247_10217140 | 3300009101 | Bacteria | 1293 |
| 69 | Ga0114129_10138219 | 3300009147 | Bacteria | 3342 |
| 70 | Ga0105242_10002748 | 3300009176 | Bacteria | 13770 |
| 71 | Ga0105237_10003012 | 3300009545 | Bacteria | 20328 |
| 72 | Ga0105237_10006659 | 3300009545 | Bacteria | 12767 |
| 73 | Ga0105238_10000031 | 3300009551 | Bacteria | 179497 |
| 74 | Ga0105238_10028589 | 3300009551 | Bacteria | 5679 |
| 75 | Ga0105238_10132779 | 3300009551 | Bacteria | 2468 |
| 76 | Ga0105239_10000539 | 3300010375 | Bacteria | 54773 |
| 77 | Ga0105239_10231830 | 3300010375 | Bacteria | 2071 |
| 78 | Ga0105246_10195627 | 3300011119 | Bacteria | 1568 |
| 79 | Ga0157369_10233159 | 3300013105 | Bacteria | 1924 |
| 80 | Ga0157369_10369977 | 3300013105 | Bacteria | 1488 |
| 81 | Ga0163162_10129220 | 3300013306 | Bacteria | 2635 |
| 82 | Ga0157372_10406570 | 3300013307 | Bacteria | 1586 |
| 83 | Ga0163163_10164897 | 3300014325 | Bacteria | 2262 |
| 84 | Ga0157380_10377741 | 3300014326 | Bacteria | 1336 |
| 85 | Ga0157379_10028238 | 3300014968 | Bacteria | 4994 |
| 86 | Ga0157379_10156389 | 3300014968 | Bacteria | 2057 |
| 87 | Ga0182006_1001130 | 3300015261 | Bacteria | 16976 |
| 88 | Ga0213874_10024527 | 3300021377 | Bacteria | 1692 |
| 89 | Ga0213876_10001486 | 3300021384 | Bacteria | 14588 |
| 90 | Ga0213876_10018284 | 3300021384 | Bacteria | 3700 |
| 91 | Ga0213875_10002788 | 3300021388 | Bacteria | 10304 |
| 92 | Ga0209674_100214 | 3300025226 | Bacteria | 55846 |
| 93 | Ga0209148_1000882 | 3300025254 | Bacteria | 20579 |
| 94 | Ga0209759_1000251 | 3300025256 | Bacteria | 79885 |
| 95 | Ga0209759_1000413 | 3300025256 | Bacteria | 52782 |
| 96 | Ga0209455_1008123 | 3300025272 | Bacteria | 2885 |
| 97 | Ga0209130_1000061 | 3300025284 | Bacteria | 200990 |
| 98 | Ga0209675_1000262 | 3300025291 | Bacteria | 51344 |
| 99 | Ga0209025_1001266 | 3300025294 | Bacteria | 34874 |
| 100 | Ga0209564_1000403 | 3300025295 | Bacteria | 76834 |
| 101 | Ga0209758_1000139 | 3300025297 | Bacteria | 175148 |
| 102 | Ga0209758_1006318 | 3300025297 | Bacteria | 8593 |
| 103 | Ga0209256_1000436 | 3300025299 | Bacteria | 64360 |
| 104 | Ga0207710_10036628 | 3300025900 | Bacteria | 2164 |
| 105 | Ga0207645_10028942 | 3300025907 | Bacteria | 3572 |
| 106 | Ga0207643_10119418 | 3300025908 | Bacteria | 1560 |
| 107 | Ga0207695_10000480 | 3300025913 | Bacteria | 85456 |
| 108 | Ga0207695_10004295 | 3300025913 | Bacteria | 19526 |
| 109 | Ga0207695_10397080 | 3300025913 | Bacteria | 1263 |
| 110 | Ga0207671_10006025 | 3300025914 | Bacteria | 10954 |
| 111 | Ga0207671_10019471 | 3300025914 | Bacteria | 5189 |
| 112 | Ga0207660_10145352 | 3300025917 | Bacteria | 1817 |
| 113 | Ga0207657_10010531 | 3300025919 | Bacteria | 9220 |
| 114 | Ga0207652_10131490 | 3300025921 | Bacteria | 2232 |
| 115 | Ga0207681_10279837 | 3300025923 | Bacteria | 1313 |
| 116 | Ga0207694_10000062 | 3300025924 | Bacteria | 140156 |
| 117 | Ga0207694_10089956 | 3300025924 | Bacteria | 2421 |
| 118 | Ga0207694_10111463 | 3300025924 | Bacteria | 2177 |
| 119 | Ga0207687_10012740 | 3300025927 | Bacteria | 5494 |
| 120 | Ga0207711_10075893 | 3300025941 | Bacteria | 2926 |
| 121 | Ga0207689_10195071 | 3300025942 | Bacteria | 1671 |
| 122 | Ga0207661_10136254 | 3300025944 | Bacteria | 2109 |
| 123 | Ga0207667_10000044 | 3300025949 | Bacteria | 248251 |
| 124 | Ga0207667_10007621 | 3300025949 | Bacteria | 12970 |
| 125 | Ga0207667_10007851 | 3300025949 | Bacteria | 12743 |
| 126 | Ga0207712_10053162 | 3300025961 | Bacteria | 2840 |
| 127 | Ga0207668_10101412 | 3300025972 | Bacteria | 2139 |
| 128 | Ga0207639_10010317 | 3300026041 | Bacteria | 6467 |
| 129 | Ga0207708_10326483 | 3300026075 | Bacteria | 1253 |
| 130 | Ga0207674_10156491 | 3300026116 | Bacteria | 2234 |
| 131 | Ga0207675_100066780 | 3300026118 | Bacteria | 3362 |
| 132 | Ga0207675_100099492 | 3300026118 | Bacteria | 2739 |
| 133 | Ga0207683_10119160 | 3300026121 | Bacteria | 2368 |
| 134 | Ga0207698_10078175 | 3300026142 | Bacteria | 2655 |
| 135 | Ga0209371_1009655 | 3300027312 | Bacteria | 3046 |
| 136 | Ga0209589_1000001 | 3300027357 | Bacteria | 794224 |
| 137 | Ga0209489_100001 | 3300027361 | Bacteria | 794224 |
| 138 | Ga0209700_100001 | 3300027363 | Bacteria | 794224 |
| 139 | Ga0268266_10004589 | 3300028379 | Bacteria | 13186 |
| 140 | Ga0268266_10005936 | 3300028379 | Bacteria | 11292 |
| 141 | Ga0307517_10002374 | 3300028786 | Bacteria | 30296 |
| 142 | Ga0307515_10002752 | 3300028794 | Bacteria | 37583 |
| 143 | Ga0307515_10011951 | 3300028794 | Bacteria | 16399 |
| 144 | Ga0307515_10030402 | 3300028794 | Bacteria | 9069 |
| 145 | Ga0307515_10174978 | 3300028794 | Bacteria | 2121 |
| 146 | Ga0268256_1010264 | 3300030500 | Bacteria | 3046 |
| 147 | Ga0307513_10013361 | 3300031456 | Bacteria | 10083 |
| 148 | Ga0265342_10000546 | 3300031712 | Bacteria | 39732 |
| 149 | Ga0307516_10006465 | 3300031730 | Bacteria | 13722 |
| 150 | Ga0307516_10184811 | 3300031730 | Bacteria | 1815 |
| 151 | Ga0307413_10061517 | 3300031824 | Bacteria | 2317 |
| 152 | Ga0307409_100194971 | 3300031995 | Bacteria | 1807 |
| 153 | Ga0307411_10010884 | 3300032005 | Bacteria | 4876 |
| 154 | Ga0307415_100038093 | 3300032126 | Bacteria | 3166 |
| 155 | Ga0373941_0044184 | 3300035115 | Bacteria | 1389 |
| 156 | Ga0395900_0011759 | 3300037418 | Bacteria | 8949 |
| 157 | Ga0395900_0198953 | 3300037418 | Bacteria | 2029 |
| 158 | Ga0395898_0058614 | 3300037466 | Bacteria | 3748 |
| 159 | Ga0395905_0056567 | 3300037471 | Bacteria | 3669 |
| 160 | Ga0436364_0421164 | 3300037853 | Bacteria | 10341 |
| 161 | Ga0436364_1107253 | 3300037853 | Bacteria | 3693 |
| 162 | Ga0436365_1253031 | 3300039437 | Bacteria | 47093 |
| 163 | Ga0436360_0511683 | 3300039438 | Bacteria | 2798 |
| 164 | Ga0436363_1230015 | 3300039450 | Bacteria | 36424 |
| 165 | Ga0436363_1330926 | 3300039450 | Bacteria | 7516 |
| 166 | Ga0436362_0207695 | 3300039453 | Bacteria | 5197 |
| 167 | Ga0466969_0019810 | 3300044656 | Bacteria | 3490 |
| 168 | Ga0466972_0004102 | 3300044658 | Bacteria | 7270 |
| 169 | Ga0466972_0048755 | 3300044658 | Bacteria | 2046 |
| 170 | Ga0466965_0008271 | 3300044683 | Bacteria | 4808 |
| 171 | Ga0466963_0003572 | 3300044694 | Bacteria | 8932 |
| 172 | Ga0466964_0004424 | 3300044706 | Bacteria | 5188 |
| 173 | Ga0466968_0000262 | 3300044735 | Bacteria | 16806 |
| 174 | Ga0466957_0176622 | 3300044842 | Bacteria | 1393 |
| 175 | Ga0466960_0091675 | 3300044901 | Bacteria | 1550 |
| 176 | Ga0466959_0119276 | 3300045049 | Bacteria | 1877 |
| 177 | Ga0466967_0013872 | 3300045976 | Bacteria | 6249 |
| 178 | Ga0495638_0136700 | 3300046460 | Bacteria | 1434 |
| 179 | Ga0495582_0081436 | 3300046473 | Bacteria | 1798 |
| 180 | Ga0495598_0004278 | 3300046537 | Bacteria | 3081 |
| 181 | Ga0495621_0011237 | 3300046539 | Bacteria | 2763 |
| 182 | Ga0495645_0018054 | 3300046543 | Bacteria | 5062 |
| 183 | Ga0495633_0032731 | 3300046558 | Bacteria | 2511 |
| 184 | Ga0495656_0001705 | 3300046615 | Bacteria | 7199 |
| 185 | Ga0495589_0047078 | 3300046794 | Bacteria | 2138 |
| 186 | Ga0495672_0006976 | 3300047320 | Bacteria | 8585 |
| 187 | Ga0495686_0057027 | 3300047472 | Bacteria | 2439 |
| 188 | Ga0495593_0043790 | 3300047673 | Bacteria | 2397 |
| 189 | Ga0495615_0011057 | 3300048090 | Bacteria | 1824 |
| 190 | Ga0496101_0179050 | 3300048904 | Bacteria | 1632 |
| 191 | Ga0496104_0000193 | 3300048907 | Bacteria | 55038 |
| 192 | Ga0496109_0055328 | 3300048912 | Bacteria | 3620 |
| 193 | Ga0496109_0197898 | 3300048912 | Bacteria | 1889 |
| 194 | Ga0496111_0072617 | 3300048914 | Bacteria | 2505 |
| 195 | Ga0496112_0501513 | 3300048915 | Bacteria | 1149 |
| 196 | Ga0496122_0042805 | 3300048925 | Bacteria | 3557 |
| 197 | Ga0496123_0012523 | 3300048926 | Bacteria | 7224 |
| 198 | Ga0496126_0073108 | 3300048929 | Bacteria | 3049 |
| 199 | Ga0501031_0192051 | 3300049568 | Bacteria | 1333 |
| 200 | Ga0501032_0021396 | 3300049569 | Bacteria | 4495 |
| 201 | Ga0501033_0011208 | 3300049570 | Bacteria | 6865 |
| 202 | Ga0501033_0011580 | 3300049570 | Bacteria | 6749 |
| 203 | Ga0501033_0022968 | 3300049570 | Bacteria | 4702 |
| 204 | Ga0501034_0006365 | 3300049571 | Bacteria | 12715 |
| 205 | Ga0501034_0011735 | 3300049571 | Bacteria | 9065 |
| 206 | Ga0501034_0021229 | 3300049571 | Bacteria | 6622 |
| 207 | Ga0501034_0022706 | 3300049571 | Bacteria | 6391 |
| 208 | Ga0501034_0027684 | 3300049571 | Bacteria | 5764 |
| 209 | Ga0501034_0048783 | 3300049571 | Bacteria | 4272 |
| 210 | Ga0501034_0164396 | 3300049571 | Bacteria | 2188 |
| 211 | Ga0501034_0195737 | 3300049571 | Bacteria | 1981 |
| 212 | Ga0501036_0012010 | 3300049572 | Bacteria | 7178 |
| 213 | Ga0501036_0050248 | 3300049572 | Bacteria | 3531 |
| 214 | Ga0501037_0038360 | 3300049573 | Bacteria | 3529 |
| 215 | Ga0501037_0167703 | 3300049573 | Bacteria | 1562 |
| 216 | Ga0501038_0019660 | 3300049574 | Bacteria | 6080 |
| 217 | Ga0501039_0013349 | 3300049575 | Bacteria | 6279 |
| 218 | Ga0501039_0106455 | 3300049575 | Bacteria | 2190 |
| 219 | Ga0501043_0003934 | 3300049579 | Bacteria | 12187 |
| 220 | Ga0501043_0054152 | 3300049579 | Bacteria | 3151 |
| 221 | Ga0501043_0076602 | 3300049579 | Bacteria | 2628 |
| 222 | Ga0501046_0010415 | 3300049580 | Bacteria | 7988 |
| 223 | Ga0501047_0000016 | 3300049581 | Bacteria | 284621 |
| 224 | Ga0501047_0000136 | 3300049581 | Bacteria | 89236 |
| 225 | Ga0501047_0015389 | 3300049581 | Bacteria | 7286 |
| 226 | Ga0501047_0021961 | 3300049581 | Bacteria | 6129 |
| 227 | Ga0501069_0102660 | 3300049585 | Bacteria | 1624 |
| 228 | Ga0501069_0136467 | 3300049585 | Bacteria | 1406 |
| 229 | Ga0501070_0010669 | 3300049586 | Bacteria | 7771 |
| 230 | Ga0501070_0017659 | 3300049586 | Bacteria | 5989 |
| 231 | Ga0501070_0030491 | 3300049586 | Bacteria | 4519 |
| 232 | Ga0501070_0040598 | 3300049586 | Bacteria | 3880 |
| 233 | Ga0501071_0010577 | 3300049587 | Bacteria | 6189 |
| 234 | Ga0501072_0023012 | 3300049588 | Bacteria | 4838 |
| 235 | Ga0501072_0139119 | 3300049588 | Bacteria | 1936 |
| 236 | Ga0501073_0034825 | 3300049589 | Bacteria | 3581 |
| 237 | Ga0501073_0090503 | 3300049589 | Bacteria | 2126 |
| 238 | Ga0501074_0068157 | 3300049590 | Bacteria | 2558 |
| 239 | Ga0501249_001307 | 3300049679 | Bacteria | 5185 |
| 240 | Ga0501079_0216659 | 3300049741 | Bacteria | 1495 |
| 241 | Ga0501080_0003134 | 3300049742 | Bacteria | 14562 |
| 242 | Ga0501080_0052627 | 3300049742 | Bacteria | 3789 |
| 243 | Ga0501080_0146539 | 3300049742 | Bacteria | 2182 |
| 244 | Ga0501080_0198459 | 3300049742 | Bacteria | 1842 |
| 245 | Ga0501083_0010987 | 3300049744 | Bacteria | 6364 |
| 246 | Ga0501035_0007097 | 3300049822 | Bacteria | 10475 |
| 247 | Ga0501035_0042187 | 3300049822 | Bacteria | 4116 |
| 248 | Ga0501035_0120271 | 3300049822 | Bacteria | 2297 |
| 249 | Ga0501044_0005059 | 3300049823 | Bacteria | 14717 |
| 250 | Ga0501044_0009381 | 3300049823 | Bacteria | 10665 |
| 251 | Ga0501044_0142663 | 3300049823 | Bacteria | 2383 |
| 252 | Ga0501044_0211866 | 3300049823 | Bacteria | 1891 |
| 253 | nmdc:mga03683_18482_c1 | 3300050489 | Bacteria | 2651 |
| 254 | nmdc:mga03n38_12414_c1 | 3300050490 | Bacteria | 3205 |
| 255 | nmdc:mga03n38_38383_c1 | 3300050490 | Bacteria | 2071 |
| 256 | nmdc:mga00v17_51400_c1 | 3300050491 | Bacteria | 2506 |
| 257 | nmdc:mga00v17_83682_c1 | 3300050491 | Bacteria | 1996 |
| 258 | nmdc:mga0yw44_24944_c1 | 3300050492 | Bacteria | 3392 |
| 259 | nmdc:mga0yw44_38707_c1 | 3300050492 | Bacteria | 2824 |
| 260 | nmdc:mga0k408_515_c1 | 3300050493 | Bacteria | 21248 |
| 261 | nmdc:mga06z11_26328_c1 | 3300050494 | Bacteria | 2767 |
| 262 | nmdc:mga07m45_128265_c1 | 3300050496 | Bacteria | 1467 |
| 263 | nmdc:mga07m45_60197_c1 | 3300050496 | Bacteria | 2149 |
| 264 | nmdc:mga05p37_136263_c1 | 3300050507 | Bacteria | 3010 |
| 265 | nmdc:mga05p37_152608_c1 | 3300050507 | Bacteria | 2824 |
| 266 | nmdc:mga0n895_30327_c1 | 3300050512 | Bacteria | 5167 |
| 267 | nmdc:mga0rr50_10912_c1 | 3300050513 | Bacteria | 5792 |
| 268 | nmdc:mga0sz30_99387_c1 | 3300050516 | Bacteria | 1270 |
| 269 | Ga0500641_0101958 | 3300053096 | Bacteria | 1231 |
| 270 | Ga0500595_003730 | 3300053119 | Bacteria | 7025 |
| 271 | Ga0500616_0078759 | 3300053153 | Bacteria | 1661 |
| 272 | Ga0500627_0073930 | 3300053158 | Bacteria | 1513 |
| 273 | Ga0500645_018811 | 3300053730 | Bacteria | 2153 |
| 274 | Ga0590071_004390 | 3300059421 | Bacteria | 3428 |
| 275 | Ga0501082_0045517 | 3300060353 | Bacteria | 3784 |
| 276 | Ga0501082_0168815 | 3300060353 | Bacteria | 1902 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300050490 | nmdc:mga03n38_12414_c1 | nmdc:mga03n38_12414_c1_2240_3172 | 310 |
| 2 | iso_pu_bacteria | 2876808645 | 2876818409 | 313 |
| 3 | iso_pu_bacteria | 2879110137 | 2879113181 | 313 |
| 4 | 3300048915 | Ga0496112_0501513 | Ga0496112_0501513_129_1133 | 333 |
| 5 | 3300044656 | Ga0466969_0019810 | Ga0466969_0019810_2324_3448 | 348 |
| 6 | 3300005937 | Ga0081455_10003864 | Ga0081455_1000386410 | 349 |
| 7 | 3300049570 | Ga0501033_0011208 | Ga0501033_0011208_2417_3544 | 349 |
| 8 | 3300049571 | Ga0501034_0022706 | Ga0501034_0022706_439_1566 | 349 |
| 9 | 3300049579 | Ga0501043_0076602 | Ga0501043_0076602_458_1585 | 349 |
| 10 | 3300049823 | Ga0501044_0005059 | Ga0501044_0005059_6318_7445 | 349 |
| 11 | 3300049571 | Ga0501034_0021229 | Ga0501034_0021229_1022_2146 | 350 |
| 12 | 3300049572 | Ga0501036_0012010 | Ga0501036_0012010_4364_5488 | 350 |
| 13 | 3300049573 | Ga0501037_0167703 | Ga0501037_0167703_207_1352 | 350 |
| 14 | 3300049579 | Ga0501043_0003934 | Ga0501043_0003934_5347_6471 | 350 |
| 15 | 3300049581 | Ga0501047_0000136 | Ga0501047_0000136_5317_6441 | 350 |
| 16 | 3300049742 | Ga0501080_0003134 | Ga0501080_0003134_8175_9299 | 350 |
| 17 | 3300049744 | Ga0501083_0010987 | Ga0501083_0010987_5198_6322 | 350 |
| 18 | 3300049823 | Ga0501044_0009381 | Ga0501044_0009381_5303_6427 | 350 |
| 19 | 3300049571 | Ga0501034_0164396 | Ga0501034_0164396_631_1755 | 351 |
| 20 | 3300049569 | Ga0501032_0021396 | Ga0501032_0021396_2228_3373 | 353 |
| 21 | 3300049570 | Ga0501033_0011580 | Ga0501033_0011580_1893_3038 | 353 |
| 22 | 3300049571 | Ga0501034_0006365 | Ga0501034_0006365_4648_5772 | 353 |
| 23 | 3300049571 | Ga0501034_0048783 | Ga0501034_0048783_722_1867 | 353 |
| 24 | 3300049572 | Ga0501036_0050248 | Ga0501036_0050248_1187_2332 | 353 |
| 25 | 3300049573 | Ga0501037_0038360 | Ga0501037_0038360_157_1302 | 353 |
| 26 | 3300049580 | Ga0501046_0010415 | Ga0501046_0010415_4859_6004 | 353 |
| 27 | 3300049581 | Ga0501047_0021961 | Ga0501047_0021961_3624_4769 | 353 |
| 28 | 3300049587 | Ga0501071_0010577 | Ga0501071_0010577_2307_3452 | 353 |
| 29 | 3300049589 | Ga0501073_0034825 | Ga0501073_0034825_2013_3158 | 353 |
| 30 | 3300049742 | Ga0501080_0052627 | Ga0501080_0052627_2013_3158 | 353 |
| 31 | 3300060353 | Ga0501082_0168815 | Ga0501082_0168815_699_1844 | 353 |
| 32 | 3300039438 | Ga0436360_0511683 | Ga0436360_0511683_1282_2385 | 355 |
| 33 | 3300049823 | Ga0501044_0142663 | Ga0501044_0142663_540_1643 | 356 |
| 34 | 3300006186 | Ga0075369_10016193 | Ga0075369_100161933 | 357 |
| 35 | 3300025914 | Ga0207671_10019471 | Ga0207671_100194713 | 358 |
| 36 | 3300025924 | Ga0207694_10089956 | Ga0207694_100899563 | 358 |
| 37 | 3300026041 | Ga0207639_10010317 | Ga0207639_100103175 | 358 |
| 38 | 3300049570 | Ga0501033_0022968 | Ga0501033_0022968_967_2091 | 358 |
| 39 | 3300049571 | Ga0501034_0011735 | Ga0501034_0011735_3949_5073 | 358 |
| 40 | 3300049575 | Ga0501039_0106455 | Ga0501039_0106455_879_2003 | 358 |
| 41 | 3300049586 | Ga0501070_0010669 | Ga0501070_0010669_1055_2179 | 358 |
| 42 | 3300005336 | Ga0070680_100119994 | Ga0070680_1001199942 | 359 |
| 43 | 3300005339 | Ga0070660_100003172 | Ga0070660_1000031722 | 359 |
| 44 | 3300005563 | Ga0068855_100228708 | Ga0068855_1002287082 | 359 |
| 45 | 3300025919 | Ga0207657_10010531 | Ga0207657_100105314 | 359 |
| 46 | 3300031712 | Ga0265342_10000546 | Ga0265342_1000054619 | 359 |
| 47 | 3300037853 | Ga0436364_0421164 | Ga0436364_0421164_1484_2608 | 359 |
| 48 | 3300049822 | Ga0501035_0120271 | Ga0501035_0120271_785_1906 | 359 |
| 49 | 3300013105 | Ga0157369_10233159 | Ga0157369_102331592 | 360 |
| 50 | 3300005563 | Ga0068855_100011516 | Ga0068855_1000115164 | 361 |
| 51 | 3300005563 | Ga0068855_100102442 | Ga0068855_1001024424 | 361 |
| 52 | 3300025944 | Ga0207661_10136254 | Ga0207661_101362542 | 361 |
| 53 | 3300025949 | Ga0207667_10007621 | Ga0207667_100076213 | 361 |
| 54 | 3300026142 | Ga0207698_10078175 | Ga0207698_100781754 | 361 |
| 55 | 3300044842 | Ga0466957_0176622 | Ga0466957_0176622_38_1243 | 361 |
| 56 | 3300049581 | Ga0501047_0015389 | Ga0501047_0015389_5949_7073 | 361 |
| 57 | 3300049588 | Ga0501072_0139119 | Ga0501072_0139119_738_1862 | 361 |
| 58 | 3300049589 | Ga0501073_0090503 | Ga0501073_0090503_815_1939 | 361 |
| 59 | 3300060353 | Ga0501082_0045517 | Ga0501082_0045517_829_1953 | 361 |
| 60 | 3300025917 | Ga0207660_10145352 | Ga0207660_101453522 | 362 |
| 61 | iso_pu_bacteria | 2873314349 | 2873319457 | 362 |
| 62 | iso_pu_bacteria | 8055266321 | 8055272014 | 362 |
| 63 | 3300046794 | Ga0495589_0047078 | Ga0495589_0047078_1036_2127 | 363 |
| 64 | 3300005563 | Ga0068855_100009931 | Ga0068855_1000099313 | 364 |
| 65 | 3300005937 | Ga0081455_10021557 | Ga0081455_100215577 | 364 |
| 66 | 3300009093 | Ga0105240_10000791 | Ga0105240_1000079134 | 364 |
| 67 | 3300009545 | Ga0105237_10003012 | Ga0105237_100030126 | 364 |
| 68 | 3300010375 | Ga0105239_10231830 | Ga0105239_102318302 | 364 |
| 69 | 3300013105 | Ga0157369_10369977 | Ga0157369_103699772 | 364 |
| 70 | 3300013307 | Ga0157372_10406570 | Ga0157372_104065702 | 364 |
| 71 | 3300025913 | Ga0207695_10004295 | Ga0207695_100042959 | 364 |
| 72 | 3300025949 | Ga0207667_10007851 | Ga0207667_100078514 | 364 |
| 73 | 3300028379 | Ga0268266_10004589 | Ga0268266_100045899 | 364 |
| 74 | iso_pu_bacteria | 2740892503 | 2743738585 | 364 |
| 75 | iso_pu_bacteria | 2919509842 | 2919511303 | 364 |
| 76 | iso_pu_bacteria | 2923153595 | 2923157648 | 364 |
| 77 | 3300047472 | Ga0495686_0057027 | Ga0495686_0057027_322_1419 | 365 |
| 78 | 3300021377 | Ga0213874_10024527 | Ga0213874_100245272 | 366 |
| 79 | 3300021384 | Ga0213876_10001486 | Ga0213876_1000148611 | 366 |
| 80 | 3300021384 | Ga0213876_10018284 | Ga0213876_100182843 | 366 |
| 81 | 3300021388 | Ga0213875_10002788 | Ga0213875_100027887 | 366 |
| 82 | 3300027312 | Ga0209371_1009655 | Ga0209371_10096553 | 366 |
| 83 | 3300030500 | Ga0268256_1010264 | Ga0268256_10102642 | 366 |
| 84 | 3300037853 | Ga0436364_1107253 | Ga0436364_1107253_1157_2257 | 366 |
| 85 | 3300039437 | Ga0436365_1253031 | Ga0436365_1253031_4983_6083 | 366 |
| 86 | 3300039450 | Ga0436363_1230015 | Ga0436363_1230015_19920_21020 | 366 |
| 87 | 3300039450 | Ga0436363_1330926 | Ga0436363_1330926_1244_2344 | 366 |
| 88 | 3300039453 | Ga0436362_0207695 | Ga0436362_0207695_96_1196 | 366 |
| 89 | iso_pu_bacteria | 2856356410 | 2856360551 | 366 |
| 90 | iso_pu_bacteria | 2935390628 | 2935393157 | 366 |
| 91 | 3300005530 | Ga0070679_100275745 | Ga0070679_1002757451 | 367 |
| 92 | 3300009551 | Ga0105238_10132779 | Ga0105238_101327793 | 367 |
| 93 | 3300025921 | Ga0207652_10131490 | Ga0207652_101314902 | 367 |
| 94 | 3300025924 | Ga0207694_10111463 | Ga0207694_101114632 | 367 |
| 95 | 3300048907 | Ga0496104_0000193 | Ga0496104_0000193_19895_21001 | 367 |
| 96 | 3300049575 | Ga0501039_0013349 | Ga0501039_0013349_3047_4150 | 367 |
| 97 | 3300049579 | Ga0501043_0054152 | Ga0501043_0054152_290_1393 | 367 |
| 98 | 3300049581 | Ga0501047_0000016 | Ga0501047_0000016_96268_97371 | 367 |
| 99 | 3300049586 | Ga0501070_0030491 | Ga0501070_0030491_2551_3654 | 367 |
| 100 | 3300049588 | Ga0501072_0023012 | Ga0501072_0023012_3074_4177 | 367 |
| 101 | 3300049590 | Ga0501074_0068157 | Ga0501074_0068157_70_1173 | 367 |
| 102 | 3300049742 | Ga0501080_0198459 | Ga0501080_0198459_599_1702 | 367 |
| 103 | 3300049822 | Ga0501035_0042187 | Ga0501035_0042187_2404_3507 | 367 |
| 104 | 3300050507 | nmdc:mga05p37_136263_c1 | nmdc:mga05p37_136263_c1_1406_2512 | 367 |
| 105 | 3300002987 | JGI25159J45721_1006094 | JGI25159J45721_10060942 | 368 |
| 106 | 3300005262 | Ga0065165_1000240 | Ga0065165_100024044 | 368 |
| 107 | 3300025284 | Ga0209130_1000061 | Ga0209130_1000061124 | 368 |
| 108 | 3300005616 | Ga0068852_100051109 | Ga0068852_1000511093 | 369 |
| 109 | 3300006048 | Ga0075363_100063203 | Ga0075363_1000632032 | 369 |
| 110 | 3300014968 | Ga0157379_10028238 | Ga0157379_100282385 | 369 |
| 111 | iso_pu_bacteria | 2721755686 | 2723578136 | 369 |
| 112 | iso_pu_bacteria | 2856349417 | 2856353197 | 369 |
| 113 | iso_pu_bacteria | 2878753008 | 2878754100 | 369 |
| 114 | iso_pu_bacteria | 2881155292 | 2881158096 | 369 |
| 115 | iso_pu_bacteria | 2881853255 | 2881855602 | 369 |
| 116 | iso_pu_bacteria | 2881861095 | 2881864146 | 369 |
| 117 | iso_pu_bacteria | 2882912400 | 2882917133 | 369 |
| 118 | iso_pu_bacteria | 2885318864 | 2885324420 | 369 |
| 119 | iso_pu_bacteria | 2885342637 | 2885347305 | 369 |
| 120 | iso_pu_bacteria | 2885350715 | 2885354901 | 369 |
| 121 | iso_pu_bacteria | 2889914905 | 2889918642 | 369 |
| 122 | iso_pu_bacteria | 2903492973 | 2903494597 | 369 |
| 123 | iso_pu_bacteria | 2924784321 | 2924788822 | 369 |
| 124 | iso_pu_bacteria | 2961127735 | 2961132734 | 369 |
| 125 | iso_pu_bacteria | 2961170736 | 2961171732 | 369 |
| 126 | iso_pu_bacteria | 2967996073 | 2967996563 | 369 |
| 127 | iso_pu_bacteria | 2968003550 | 2968010226 | 369 |
| 128 | iso_pu_bacteria | 2970503327 | 2970504328 | 369 |
| 129 | iso_pu_bacteria | 2977821940 | 2977823315 | 369 |
| 130 | iso_pu_bacteria | 2977828996 | 2977831947 | 369 |
| 131 | iso_pu_bacteria | 2979808191 | 2979808965 | 369 |
| 132 | iso_pu_bacteria | 8004374579 | 8004375676 | 369 |
| 133 | 3300046543 | Ga0495645_0018054 | Ga0495645_0018054_542_1660 | 370 |
| 134 | iso_pu_bacteria | 2643221547 | 2643754709 | 370 |
| 135 | iso_pu_bacteria | 2643221736 | 2644744833 | 370 |
| 136 | iso_pu_bacteria | 2841760612 | 2841764338 | 370 |
| 137 | iso_pu_bacteria | 2842482326 | 2842486489 | 370 |
| 138 | iso_pu_bacteria | 2844104063 | 2844108207 | 370 |
| 139 | iso_pu_bacteria | 2851246043 | 2851250773 | 370 |
| 140 | iso_pu_bacteria | 2904690495 | 2904698451 | 370 |
| 141 | iso_pu_bacteria | 8002392321 | 8002392383 | 370 |
| 142 | iso_pu_bacteria | 8006984368 | 8006988304 | 370 |
| 143 | iso_pu_bacteria | 8056673599 | 8056679734 | 370 |
| 144 | iso_pu_bacteria | 8057529695 | 8057532233 | 370 |
| 145 | iso_pu_bacteria | 2513237101 | 2513698244 | 371 |
| 146 | iso_pu_bacteria | 2524023228 | 2524533992 | 371 |
| 147 | iso_pu_bacteria | 2599185317 | 2600028829 | 371 |
| 148 | iso_pu_bacteria | 2600254930 | 2600357996 | 371 |
| 149 | iso_pu_bacteria | 2721755755 | 2723848574 | 371 |
| 150 | iso_pu_bacteria | 2728368998 | 2728755227 | 371 |
| 151 | iso_pu_bacteria | 2751185846 | 2753568313 | 371 |
| 152 | iso_pu_bacteria | 2791355199 | 2793077552 | 371 |
| 153 | iso_pu_bacteria | 2874604998 | 2874606251 | 371 |
| 154 | iso_pu_bacteria | 2889033259 | 2889036843 | 371 |
| 155 | iso_pu_bacteria | 2908756301 | 2908762537 | 371 |
| 156 | iso_pu_bacteria | 8006933436 | 8006940050 | 371 |
| 157 | iso_pu_bacteria | 8006964411 | 8006968543 | 371 |
| 158 | iso_pu_bacteria | 8006973647 | 8006979832 | 371 |
| 159 | iso_pu_bacteria | 8006994254 | 8006999543 | 371 |
| 160 | iso_pu_bacteria | 8056689827 | 8056692759 | 371 |
| 161 | 3300003203 | JGI25406J46586_10005542 | JGI25406J46586_100055422 | 372 |
| 162 | 3300005334 | Ga0068869_100253374 | Ga0068869_1002533741 | 372 |
| 163 | 3300005338 | Ga0068868_100049781 | Ga0068868_1000497813 | 372 |
| 164 | 3300005564 | Ga0070664_100106615 | Ga0070664_1001066152 | 372 |
| 165 | 3300005577 | Ga0068857_100112077 | Ga0068857_1001120772 | 372 |
| 166 | 3300005617 | Ga0068859_100048944 | Ga0068859_1000489443 | 372 |
| 167 | 3300005617 | Ga0068859_100168761 | Ga0068859_1001687612 | 372 |
| 168 | 3300005985 | Ga0081539_10000466 | Ga0081539_1000046648 | 372 |
| 169 | 3300005985 | Ga0081539_10023321 | Ga0081539_100233214 | 372 |
| 170 | 3300006931 | Ga0097620_100048939 | Ga0097620_1000489393 | 372 |
| 171 | 3300006931 | Ga0097620_100168756 | Ga0097620_1001687562 | 372 |
| 172 | 3300009093 | Ga0105240_10060813 | Ga0105240_100608133 | 372 |
| 173 | 3300009098 | Ga0105245_10016233 | Ga0105245_100162337 | 372 |
| 174 | 3300009101 | Ga0105247_10217140 | Ga0105247_102171401 | 372 |
| 175 | 3300025913 | Ga0207695_10397080 | Ga0207695_103970801 | 372 |
| 176 | 3300025927 | Ga0207687_10012740 | Ga0207687_100127406 | 372 |
| 177 | 3300025941 | Ga0207711_10075893 | Ga0207711_100758932 | 372 |
| 178 | 3300025942 | Ga0207689_10195071 | Ga0207689_101950712 | 372 |
| 179 | 3300025972 | Ga0207668_10101412 | Ga0207668_101014122 | 372 |
| 180 | 3300026075 | Ga0207708_10326483 | Ga0207708_103264831 | 372 |
| 181 | 3300028794 | Ga0307515_10002752 | Ga0307515_100027523 | 372 |
| 182 | 3300028794 | Ga0307515_10011951 | Ga0307515_100119515 | 372 |
| 183 | 3300031456 | Ga0307513_10013361 | Ga0307513_100133613 | 372 |
| 184 | 3300035115 | Ga0373941_0044184 | Ga0373941_0044184_155_1279 | 372 |
| 185 | 3300037418 | Ga0395900_0011759 | Ga0395900_0011759_4088_5212 | 372 |
| 186 | 3300037466 | Ga0395898_0058614 | Ga0395898_0058614_1961_3085 | 372 |
| 187 | 3300046460 | Ga0495638_0136700 | Ga0495638_0136700_251_1375 | 372 |
| 188 | 3300046473 | Ga0495582_0081436 | Ga0495582_0081436_559_1680 | 372 |
| 189 | 3300048912 | Ga0496109_0197898 | Ga0496109_0197898_339_1463 | 372 |
| 190 | 3300048914 | Ga0496111_0072617 | Ga0496111_0072617_593_1717 | 372 |
| 191 | 3300049568 | Ga0501031_0192051 | Ga0501031_0192051_105_1250 | 372 |
| 192 | 3300049571 | Ga0501034_0027684 | Ga0501034_0027684_3979_5103 | 372 |
| 193 | 3300049571 | Ga0501034_0195737 | Ga0501034_0195737_820_1944 | 372 |
| 194 | 3300049574 | Ga0501038_0019660 | Ga0501038_0019660_3120_4265 | 372 |
| 195 | 3300049585 | Ga0501069_0102660 | Ga0501069_0102660_288_1412 | 372 |
| 196 | 3300049586 | Ga0501070_0017659 | Ga0501070_0017659_4652_5836 | 372 |
| 197 | 3300049586 | Ga0501070_0040598 | Ga0501070_0040598_597_1721 | 372 |
| 198 | 3300049741 | Ga0501079_0216659 | Ga0501079_0216659_323_1447 | 372 |
| 199 | 3300049742 | Ga0501080_0146539 | Ga0501080_0146539_122_1246 | 372 |
| 200 | 3300049822 | Ga0501035_0007097 | Ga0501035_0007097_4538_5722 | 372 |
| 201 | 3300049823 | Ga0501044_0211866 | Ga0501044_0211866_199_1323 | 372 |
| 202 | 3300050494 | nmdc:mga06z11_26328_c1 | nmdc:mga06z11_26328_c1_125_1249 | 372 |
| 203 | 3300053730 | Ga0500645_018811 | Ga0500645_018811_844_1968 | 372 |
| 204 | 3300003203 | JGI25406J46586_10008043 | JGI25406J46586_100080433 | 373 |
| 205 | 3300003215 | JGI25153J46596_10022066 | JGI25153J46596_100220663 | 373 |
| 206 | 3300003659 | JGI25404J52841_10000914 | JGI25404J52841_100009144 | 373 |
| 207 | 3300003771 | Ga0055526_1000755 | Ga0055526_100075523 | 373 |
| 208 | 3300003775 | Ga0055524_1000208 | Ga0055524_100020842 | 373 |
| 209 | 3300005347 | Ga0070668_100041440 | Ga0070668_1000414402 | 373 |
| 210 | 3300005456 | Ga0070678_100024448 | Ga0070678_1000244483 | 373 |
| 211 | 3300005544 | Ga0070686_100221065 | Ga0070686_1002210651 | 373 |
| 212 | 3300005548 | Ga0070665_100018220 | Ga0070665_1000182206 | 373 |
| 213 | 3300005719 | Ga0068861_100046879 | Ga0068861_1000468793 | 373 |
| 214 | 3300005937 | Ga0081455_10012043 | Ga0081455_100120434 | 373 |
| 215 | 3300005937 | Ga0081455_10033377 | Ga0081455_100333774 | 373 |
| 216 | 3300005983 | Ga0081540_1001736 | Ga0081540_10017363 | 373 |
| 217 | 3300005983 | Ga0081540_1023610 | Ga0081540_10236102 | 373 |
| 218 | 3300005983 | Ga0081540_1029904 | Ga0081540_10299042 | 373 |
| 219 | 3300005985 | Ga0081539_10002040 | Ga0081539_1000204016 | 373 |
| 220 | 3300006038 | Ga0075365_10010066 | Ga0075365_100100664 | 373 |
| 221 | 3300006038 | Ga0075365_10010109 | Ga0075365_100101092 | 373 |
| 222 | 3300006048 | Ga0075363_100004113 | Ga0075363_1000041133 | 373 |
| 223 | 3300006051 | Ga0075364_10006585 | Ga0075364_100065852 | 373 |
| 224 | 3300006051 | Ga0075364_10016348 | Ga0075364_100163484 | 373 |
| 225 | 3300006177 | Ga0075362_10000112 | Ga0075362_1000011215 | 373 |
| 226 | 3300006177 | Ga0075362_10046156 | Ga0075362_100461562 | 373 |
| 227 | 3300006178 | Ga0075367_10117920 | Ga0075367_101179202 | 373 |
| 228 | 3300006186 | Ga0075369_10074834 | Ga0075369_100748341 | 373 |
| 229 | 3300006195 | Ga0075366_10004774 | Ga0075366_100047742 | 373 |
| 230 | 3300006195 | Ga0075366_10087849 | Ga0075366_100878493 | 373 |
| 231 | 3300006353 | Ga0075370_10014421 | Ga0075370_100144212 | 373 |
| 232 | 3300006871 | Ga0075434_100001388 | Ga0075434_10000138820 | 373 |
| 233 | 3300006942 | Ga0099824_1019122 | Ga0099824_10191222 | 373 |
| 234 | 3300006943 | Ga0099822_1001679 | Ga0099822_100167923 | 373 |
| 235 | 3300007076 | Ga0075435_100002597 | Ga0075435_1000025977 | 373 |
| 236 | 3300009147 | Ga0114129_10138219 | Ga0114129_101382194 | 373 |
| 237 | 3300011119 | Ga0105246_10195627 | Ga0105246_101956272 | 373 |
| 238 | 3300013306 | Ga0163162_10129220 | Ga0163162_101292203 | 373 |
| 239 | 3300014325 | Ga0163163_10164897 | Ga0163163_101648972 | 373 |
| 240 | 3300014326 | Ga0157380_10377741 | Ga0157380_103777412 | 373 |
| 241 | 3300014968 | Ga0157379_10156389 | Ga0157379_101563892 | 373 |
| 242 | 3300025254 | Ga0209148_1000882 | Ga0209148_100088216 | 373 |
| 243 | 3300025272 | Ga0209455_1008123 | Ga0209455_10081232 | 373 |
| 244 | 3300025291 | Ga0209675_1000262 | Ga0209675_100026242 | 373 |
| 245 | 3300025294 | Ga0209025_1001266 | Ga0209025_100126617 | 373 |
| 246 | 3300025295 | Ga0209564_1000403 | Ga0209564_100040340 | 373 |
| 247 | 3300025297 | Ga0209758_1000139 | Ga0209758_100013946 | 373 |
| 248 | 3300025297 | Ga0209758_1006318 | Ga0209758_10063186 | 373 |
| 249 | 3300025299 | Ga0209256_1000436 | Ga0209256_100043628 | 373 |
| 250 | 3300025900 | Ga0207710_10036628 | Ga0207710_100366282 | 373 |
| 251 | 3300025907 | Ga0207645_10028942 | Ga0207645_100289424 | 373 |
| 252 | 3300025908 | Ga0207643_10119418 | Ga0207643_101194182 | 373 |
| 253 | 3300025923 | Ga0207681_10279837 | Ga0207681_102798371 | 373 |
| 254 | 3300026118 | Ga0207675_100066780 | Ga0207675_1000667803 | 373 |
| 255 | 3300026121 | Ga0207683_10119160 | Ga0207683_101191602 | 373 |
| 256 | 3300027357 | Ga0209589_1000001 | Ga0209589_1000001496 | 373 |
| 257 | 3300027361 | Ga0209489_100001 | Ga0209489_100001496 | 373 |
| 258 | 3300027363 | Ga0209700_100001 | Ga0209700_100001496 | 373 |
| 259 | 3300028379 | Ga0268266_10005936 | Ga0268266_100059362 | 373 |
| 260 | 3300028786 | Ga0307517_10002374 | Ga0307517_100023746 | 373 |
| 261 | 3300028794 | Ga0307515_10030402 | Ga0307515_100304027 | 373 |
| 262 | 3300028794 | Ga0307515_10174978 | Ga0307515_101749782 | 373 |
| 263 | 3300031730 | Ga0307516_10006465 | Ga0307516_100064655 | 373 |
| 264 | 3300031730 | Ga0307516_10184811 | Ga0307516_101848112 | 373 |
| 265 | 3300031824 | Ga0307413_10061517 | Ga0307413_100615172 | 373 |
| 266 | 3300032005 | Ga0307411_10010884 | Ga0307411_100108843 | 373 |
| 267 | 3300032126 | Ga0307415_100038093 | Ga0307415_1000380934 | 373 |
| 268 | 3300037418 | Ga0395900_0198953 | Ga0395900_0198953_311_1438 | 373 |
| 269 | 3300037471 | Ga0395905_0056567 | Ga0395905_0056567_217_1344 | 373 |
| 270 | 3300044658 | Ga0466972_0004102 | Ga0466972_0004102_4993_6147 | 373 |
| 271 | 3300044658 | Ga0466972_0048755 | Ga0466972_0048755_111_1238 | 373 |
| 272 | 3300044683 | Ga0466965_0008271 | Ga0466965_0008271_3233_4387 | 373 |
| 273 | 3300044706 | Ga0466964_0004424 | Ga0466964_0004424_690_1844 | 373 |
| 274 | 3300044735 | Ga0466968_0000262 | Ga0466968_0000262_2573_3727 | 373 |
| 275 | 3300044901 | Ga0466960_0091675 | Ga0466960_0091675_106_1233 | 373 |
| 276 | 3300045049 | Ga0466959_0119276 | Ga0466959_0119276_166_1293 | 373 |
| 277 | 3300046537 | Ga0495598_0004278 | Ga0495598_0004278_887_2014 | 373 |
| 278 | 3300046539 | Ga0495621_0011237 | Ga0495621_0011237_59_1186 | 373 |
| 279 | 3300046558 | Ga0495633_0032731 | Ga0495633_0032731_468_1595 | 373 |
| 280 | 3300046615 | Ga0495656_0001705 | Ga0495656_0001705_601_1728 | 373 |
| 281 | 3300047320 | Ga0495672_0006976 | Ga0495672_0006976_6932_8071 | 373 |
| 282 | 3300047673 | Ga0495593_0043790 | Ga0495593_0043790_1058_2185 | 373 |
| 283 | 3300048090 | Ga0495615_0011057 | Ga0495615_0011057_500_1627 | 373 |
| 284 | 3300048904 | Ga0496101_0179050 | Ga0496101_0179050_280_1407 | 373 |
| 285 | 3300048912 | Ga0496109_0055328 | Ga0496109_0055328_1349_2476 | 373 |
| 286 | 3300049585 | Ga0501069_0136467 | Ga0501069_0136467_37_1164 | 373 |
| 287 | 3300050489 | nmdc:mga03683_18482_c1 | nmdc:mga03683_18482_c1_1223_2350 | 373 |
| 288 | 3300050490 | nmdc:mga03n38_38383_c1 | nmdc:mga03n38_38383_c1_868_2007 | 373 |
| 289 | 3300050491 | nmdc:mga00v17_51400_c1 | nmdc:mga00v17_51400_c1_1281_2408 | 373 |
| 290 | 3300050491 | nmdc:mga00v17_83682_c1 | nmdc:mga00v17_83682_c1_550_1677 | 373 |
| 291 | 3300050492 | nmdc:mga0yw44_24944_c1 | nmdc:mga0yw44_24944_c1_164_1291 | 373 |
| 292 | 3300050492 | nmdc:mga0yw44_38707_c1 | nmdc:mga0yw44_38707_c1_163_1290 | 373 |
| 293 | 3300050493 | nmdc:mga0k408_515_c1 | nmdc:mga0k408_515_c1_16502_17629 | 373 |
| 294 | 3300050496 | nmdc:mga07m45_128265_c1 | nmdc:mga07m45_128265_c1_168_1292 | 373 |
| 295 | 3300050496 | nmdc:mga07m45_60197_c1 | nmdc:mga07m45_60197_c1_242_1369 | 373 |
| 296 | 3300050507 | nmdc:mga05p37_152608_c1 | nmdc:mga05p37_152608_c1_841_1968 | 373 |
| 297 | 3300050512 | nmdc:mga0n895_30327_c1 | nmdc:mga0n895_30327_c1_149_1285 | 373 |
| 298 | 3300050513 | nmdc:mga0rr50_10912_c1 | nmdc:mga0rr50_10912_c1_1671_2807 | 373 |
| 299 | 3300050516 | nmdc:mga0sz30_99387_c1 | nmdc:mga0sz30_99387_c1_66_1190 | 373 |
| 300 | 3300053096 | Ga0500641_0101958 | Ga0500641_0101958_16_1143 | 373 |
| 301 | 3300053119 | Ga0500595_003730 | Ga0500595_003730_4348_5475 | 373 |
| 302 | 3300053153 | Ga0500616_0078759 | Ga0500616_0078759_334_1461 | 373 |
| 303 | 3300053158 | Ga0500627_0073930 | Ga0500627_0073930_233_1360 | 373 |
| 304 | iso_pu_bacteria | 2838054893 | 2838061609 | 373 |
| 305 | iso_pu_bacteria | 2939631187 | 2939631627 | 373 |
| 306 | 3300044694 | Ga0466963_0003572 | Ga0466963_0003572_2119_3255 | 374 |
| 307 | 3300045976 | Ga0466967_0013872 | Ga0466967_0013872_380_1516 | 374 |
| 308 | iso_pu_bacteria | 2904439833 | 2904442673 | 374 |
| 309 | iso_pu_bacteria | 2904530477 | 2904535118 | 374 |
| 310 | iso_pu_bacteria | 2904584206 | 2904588540 | 374 |
| 311 | iso_pu_bacteria | 2904589729 | 2904594386 | 374 |
| 312 | iso_pu_bacteria | 2904601388 | 2904604781 | 374 |
| 313 | iso_pu_bacteria | 2919079590 | 2919083009 | 374 |
| 314 | iso_pu_bacteria | 2928130867 | 2928132886 | 374 |
| 315 | 3300009176 | Ga0105242_10002748 | Ga0105242_100027484 | 375 |
| 316 | 3300048925 | Ga0496122_0042805 | Ga0496122_0042805_743_1873 | 375 |
| 317 | 3300048926 | Ga0496123_0012523 | Ga0496123_0012523_10_1140 | 375 |
| 318 | 3300048929 | Ga0496126_0073108 | Ga0496126_0073108_1355_2485 | 375 |
| 319 | 3300049679 | Ga0501249_001307 | Ga0501249_001307_909_2042 | 375 |
| 320 | 3300005578 | Ga0068854_100007947 | Ga0068854_1000079474 | 376 |
| 321 | 3300009036 | Ga0105244_10044801 | Ga0105244_100448011 | 376 |
| 322 | 3300009093 | Ga0105240_10021237 | Ga0105240_100212377 | 376 |
| 323 | 3300009093 | Ga0105240_10023240 | Ga0105240_100232405 | 376 |
| 324 | 3300009545 | Ga0105237_10006659 | Ga0105237_100066592 | 376 |
| 325 | 3300009551 | Ga0105238_10000031 | Ga0105238_1000003161 | 376 |
| 326 | 3300010375 | Ga0105239_10000539 | Ga0105239_1000053947 | 376 |
| 327 | 3300015261 | Ga0182006_1001130 | Ga0182006_100113010 | 376 |
| 328 | 3300025913 | Ga0207695_10000480 | Ga0207695_1000048055 | 376 |
| 329 | 3300025914 | Ga0207671_10006025 | Ga0207671_100060256 | 376 |
| 330 | 3300025924 | Ga0207694_10000062 | Ga0207694_1000006271 | 376 |
| 331 | 3300025949 | Ga0207667_10000044 | Ga0207667_10000044134 | 376 |
| 332 | 3300026116 | Ga0207674_10156491 | Ga0207674_101564912 | 376 |
| 333 | 3300002705 | JGI25156J39149_1000789 | JGI25156J39149_100078911 | 377 |
| 334 | 3300003756 | Ga0055533_1000665 | Ga0055533_10006657 | 377 |
| 335 | 3300005719 | Ga0068861_100081508 | Ga0068861_1000815083 | 377 |
| 336 | 3300009551 | Ga0105238_10028589 | Ga0105238_100285894 | 377 |
| 337 | 3300025226 | Ga0209674_100214 | Ga0209674_10021441 | 377 |
| 338 | 3300025256 | Ga0209759_1000251 | Ga0209759_100025150 | 377 |
| 339 | 3300025256 | Ga0209759_1000413 | Ga0209759_10004137 | 377 |
| 340 | 3300025961 | Ga0207712_10053162 | Ga0207712_100531623 | 377 |
| 341 | 3300026118 | Ga0207675_100099492 | Ga0207675_1000994923 | 377 |
| 342 | 3300031995 | Ga0307409_100194971 | Ga0307409_1001949712 | 377 |
| 343 | 3300059421 | Ga0590071_004390 | Ga0590071_004390_669_1826 | 377 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2d40-assembly1.cif.gz_A | crystal structure of z3393 from escherichia coli o157:h7 | 0.9608 | 50 | 360 |
| 2d40-assembly1.cif.gz_B | crystal structure of z3393 from escherichia coli o157:h7 | 0.9582 | 50 | 360 |
| 2d40-assembly1.cif.gz_B | crystal structure of z3393 from escherichia coli o157:h7 | 0.9516 | 50 | 360 |
| 3bu7-assembly1.cif.gz_B | crystal structure and biochemical characterization of gdosp, a gentisate 1,2-dioxygenase from silicibacter pomeroyi | 0.9482 | 16 | 373 |
| 2d40-assembly1.cif.gz_A | crystal structure of z3393 from escherichia coli o157:h7 | 0.9479 | 50 | 360 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q9LUJ7_61_262_2.60.120.10 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.9649 | 271 | 347 | 2.60.120.10 |
| 2d40B00 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.9552 | 50 | 360 | 2.60.120.10 |
| 2d40B00 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.9485 | 50 | 360 | 2.60.120.10 |
| 3bu7B00 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.9482 | 16 | 373 | 2.60.120.10 |
| 3bu7B00 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.9456 | 16 | 373 | 2.60.120.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7Z7KL54-F1-model_v4 | deleted | 0.9983 | 248 | 373 |
|
| AF-A0A1M3BFN9-F1-model_v4 | NADPH dehydrogenase | 0.9946 | 84 | 373 |
GO:0051213
|
| AF-A0A7Y9N6Q1-F1-model_v4 | Gentisate 1,2-dioxygenase | 0.9938 | 232 | 371 |
GO:0051213
|
| AF-A0A1M3BFN9-F1-model_v4 | NADPH dehydrogenase | 0.9912 | 84 | 373 |
GO:0051213
|
| AF-A0A381PFN2-F1-model_v4 | Cupin type-2 domain-containing protein | 0.9911 | 52 | 373 |
GO:0051213
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar