F415674

General Info

Members Datasets Scaffolds Average Seq Length
343 220 686 172

Family's Representative Sequence

Representative Sequence 3300037471|Ga0395905_0595527|Ga0395905_0595527_181_789
Length 202
Sequence LQRLKRVQIERLAGVRDGSVTVFGTGVCGVVLAAGASSRFGSPKQRLLLEPVLSRVRRSSVDDVVVVLGAHEVETSARTVRCPEWERGPGASLRCGLEALPPETEAAIVVLGDGPDLAPEAIDRVIATWRSTDAEVIAATYGGVRLHPLLIARAQWPAVPDEGLRSLAAVLVPCDDLGPPGDVDFSDEIPESLRPKPPTAES

Samples

Sample ID Description Type Environment
1 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
2 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
9 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
10 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
14 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
18 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
19 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
20 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
21 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
22 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
23 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
24 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
25 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
26 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
27 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
28 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
34 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
35 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
36 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
39 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
40 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
41 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
42 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
45 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
46 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
47 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
48 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
49 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
50 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
51 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
52 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
53 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
54 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
55 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
56 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
57 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
58 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
59 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
60 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
61 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
62 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
63 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
65 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
66 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
67 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
68 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
70 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
72 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
73 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
75 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
76 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
77 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
78 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
79 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
80 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
81 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
82 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
83 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
84 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
85 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
86 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
87 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
88 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
89 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
90 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
91 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
92 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
93 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
94 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
139 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
142 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
143 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
144 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
145 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
146 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
147 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
148 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
149 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
150 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
151 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
152 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
153 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
154 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
155 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
156 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
157 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
158 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
159 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
160 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
161 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
162 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
163 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
164 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
165 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
166 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
167 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
168 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
169 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
170 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
171 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
172 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
173 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
174 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
175 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
176 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
177 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
178 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
179 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
180 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
181 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
182 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
183 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
184 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
185 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
186 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
187 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
188 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
189 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
190 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
191 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
192 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
193 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
194 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
195 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
196 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
197 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
198 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
199 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
200 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
201 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
202 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
203 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
204 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
205 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
206 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
207 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
208 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
209 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
210 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
211 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
212 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
213 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
214 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
215 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
216 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
217 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
218 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
219 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
220 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 8.75
Rhizosphere 90.96
Stem 0
Stem Tuber 0
Unclassified 20.7

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0395905_0595527 3300037471 Unclassified 1007
2 Ga0070676_10678891 3300005328 Bacteria 750
3 Ga0070683_100009377 3300005329 Bacteria 8368
4 Ga0070683_100145347 3300005329 Bacteria 2247
5 Ga0070666_10074623 3300005335 Bacteria 2312
6 Ga0070680_100201981 3300005336 Bacteria 1676
7 Ga0070682_100032133 3300005337 Bacteria 3180
8 Ga0068868_100213442 3300005338 Bacteria 1614
9 Ga0068868_100497545 3300005338 Unclassified 1067
10 Ga0070691_10124062 3300005341 Unclassified 1303
11 Ga0070687_100234275 3300005343 Bacteria 1132
12 Ga0070692_10209349 3300005345 Bacteria 1146
13 Ga0070668_100021194 3300005347 Bacteria 4912
14 Ga0070668_100219745 3300005347 Bacteria 1567
15 Ga0070669_100422661 3300005353 Bacteria 1094
16 Ga0070673_100112702 3300005364 Bacteria 2258
17 Ga0070673_100201850 3300005364 Bacteria 1713
18 Ga0070688_100007444 3300005365 Bacteria 5903
19 Ga0070659_100365789 3300005366 Bacteria 1212
20 Ga0070667_100342136 3300005367 Bacteria 1353
21 Ga0070703_10090500 3300005406 Unclassified 1060
22 Ga0070709_10067463 3300005434 Bacteria 2297
23 Ga0070714_100038155 3300005435 Bacteria 4040
24 Ga0070714_100215918 3300005435 Bacteria 1760
25 Ga0070713_100114582 3300005436 Bacteria 2355
26 Ga0070710_10093085 3300005437 Bacteria 1781
27 Ga0070701_10003678 3300005438 Bacteria 6111
28 Ga0070701_10384518 3300005438 Unclassified 885
29 Ga0070711_100006925 3300005439 Bacteria 6873
30 Ga0070705_100126949 3300005440 Bacteria 1657
31 Ga0070700_100113057 3300005441 Unclassified 1808
32 Ga0070694_100262901 3300005444 Bacteria 1309
33 Ga0070694_100323070 3300005444 Unclassified 1188
34 Ga0070694_100339337 3300005444 Unclassified 1161
35 Ga0070708_100170565 3300005445 Bacteria 2031
36 Ga0070663_100107337 3300005455 Bacteria 2093
37 Ga0070678_100018547 3300005456 Bacteria 4511
38 Ga0070662_100041395 3300005457 Bacteria 3286
39 Ga0070662_100065973 3300005457 Bacteria 2655
40 Ga0070681_11030713 3300005458 Unclassified 743
41 Ga0068867_100054578 3300005459 Bacteria 2952
42 Ga0070685_10027717 3300005466 Bacteria 3134
43 Ga0070685_10048261 3300005466 Bacteria 2452
44 Ga0070706_100248540 3300005467 Bacteria 1661
45 Ga0070707_100014133 3300005468 Bacteria 7481
46 Ga0070707_100545171 3300005468 Bacteria 1122
47 Ga0070698_100006283 3300005471 Bacteria 12909
48 Ga0070679_100688262 3300005530 Bacteria 965
49 Ga0068853_100075864 3300005539 Bacteria 2935
50 Ga0070672_100159215 3300005543 Bacteria 1872
51 Ga0070695_101216808 3300005545 Bacteria 620
52 Ga0070696_100026320 3300005546 Bacteria 3957
53 Ga0070696_100208602 3300005546 Unclassified 1462
54 Ga0070696_100492003 3300005546 Bacteria 974
55 Ga0070693_100250999 3300005547 Bacteria 1173
56 Ga0070665_100033262 3300005548 Bacteria 5188
57 Ga0070704_100039962 3300005549 Bacteria 3225
58 Ga0070704_100089418 3300005549 Bacteria 2291
59 Ga0070704_100576370 3300005549 Bacteria 986
60 Ga0068855_100028306 3300005563 Bacteria 6703
61 Ga0068855_100089423 3300005563 Bacteria 3555
62 Ga0068855_100650758 3300005563 Unclassified 1132
63 Ga0070664_100141132 3300005564 Bacteria 2121
64 Ga0068857_100005679 3300005577 Bacteria 10665
65 Ga0068857_100044120 3300005577 Bacteria 3954
66 Ga0068854_100338803 3300005578 Bacteria 1227
67 Ga0068856_100008762 3300005614 Bacteria 9839
68 Ga0068856_100099403 3300005614 Bacteria 2900
69 Ga0070702_100015066 3300005615 Bacteria 3938
70 Ga0070702_100038105 3300005615 Bacteria 2674
71 Ga0068859_100682419 3300005617 Bacteria 1118
72 Ga0068864_101586657 3300005618 Bacteria 658
73 Ga0068861_100037148 3300005719 Bacteria 3620
74 Ga0068851_10159755 3300005834 Bacteria 1237
75 Ga0068863_100627529 3300005841 Bacteria 1065
76 Ga0068860_101097984 3300005843 Bacteria 815
77 Ga0068862_100548166 3300005844 Unclassified 1104
78 Ga0081455_10088175 3300005937 Bacteria 2522
79 Ga0081538_10001503 3300005981 Bacteria 23933
80 Ga0081540_1001335 3300005983 Bacteria 21496
81 Ga0081540_1143438 3300005983 Unclassified 955
82 Ga0070717_10014733 3300006028 Bacteria 6015
83 Ga0070712_100151956 3300006175 Bacteria 1778
84 Ga0070712_100228327 3300006175 Bacteria 1477
85 Ga0070712_100938831 3300006175 Unclassified 747
86 Ga0097621_100333044 3300006237 Bacteria 1347
87 Ga0075431_100493052 3300006847 Bacteria 1217
88 Ga0075433_11042768 3300006852 Bacteria 712
89 Ga0075434_100581888 3300006871 Bacteria 1139
90 Ga0068865_100006636 3300006881 Bacteria 7079
91 Ga0068865_100138231 3300006881 Bacteria 1834
92 Ga0097620_100682435 3300006931 Bacteria 1118
93 Ga0075435_100185425 3300007076 Bacteria 1759
94 Ga0111539_10012751 3300009094 Bacteria 10523
95 Ga0111539_10367971 3300009094 Bacteria 1673
96 Ga0111539_10431753 3300009094 Bacteria 1534
97 Ga0105245_10006942 3300009098 Bacteria 9925
98 Ga0105245_10007115 3300009098 Bacteria 9814
99 Ga0105245_10079199 3300009098 Bacteria 3000
100 Ga0105245_10116464 3300009098 Bacteria 2492
101 Ga0105245_10297756 3300009098 Bacteria 1582
102 Ga0105245_10532872 3300009098 Unclassified 1194
103 Ga0105247_10148265 3300009101 Bacteria 1544
104 Ga0114129_10877861 3300009147 Unclassified 1138
105 Ga0114129_12099872 3300009147 Unclassified 681
106 Ga0105243_10223161 3300009148 Bacteria 1667
107 Ga0105243_10312219 3300009148 Bacteria 1429
108 Ga0105241_10323876 3300009174 Bacteria 1330
109 Ga0105242_10005237 3300009176 Bacteria 10008
110 Ga0105242_10596934 3300009176 Bacteria 1066
111 Ga0105248_10021199 3300009177 Bacteria 7200
112 Ga0105237_10050681 3300009545 Bacteria 4171
113 Ga0105238_10093471 3300009551 Bacteria 2995
114 Ga0105249_10134928 3300009553 Unclassified 2360
115 Ga0105239_10027132 3300010375 Bacteria 6305
116 Ga0105239_10075392 3300010375 Bacteria 3709
117 Ga0105239_10126649 3300010375 Bacteria 2839
118 Ga0105246_10023947 3300011119 Bacteria 3958
119 Ga0105246_11053723 3300011119 Unclassified 740
120 Ga0157342_1047241 3300012507 Unclassified 595
121 Ga0157374_10028620 3300013296 Bacteria 5035
122 Ga0157374_10082266 3300013296 Bacteria 3057
123 Ga0157378_10009952 3300013297 Bacteria 8289
124 Ga0163162_10007734 3300013306 Bacteria 10474
125 Ga0163162_10106270 3300013306 Bacteria 2902
126 Ga0157372_10056077 3300013307 Bacteria 4402
127 Ga0157372_10721275 3300013307 Bacteria 1160
128 Ga0157375_10007650 3300013308 Bacteria 9451
129 Ga0157375_10231604 3300013308 Bacteria 2006
130 Ga0157380_10217584 3300014326 Bacteria 1707
131 Ga0182008_10250383 3300014497 Bacteria 914
132 Ga0182008_10577195 3300014497 Unclassified 628
133 Ga0157377_10002322 3300014745 Bacteria 8370
134 Ga0157377_10186258 3300014745 Bacteria 1309
135 Ga0157377_10249765 3300014745 Bacteria 1149
136 Ga0157379_10636476 3300014968 Bacteria 998
137 Ga0157376_10077906 3300014969 Bacteria 2837
138 Ga0157376_12499917 3300014969 Unclassified 556
139 Ga0207653_10038906 3300025885 Bacteria 1555
140 Ga0207653_10071443 3300025885 Bacteria 1186
141 Ga0207682_10072077 3300025893 Bacteria 1465
142 Ga0207710_10074368 3300025900 Bacteria 1564
143 Ga0207688_10035921 3300025901 Bacteria 2745
144 Ga0207680_10162961 3300025903 Bacteria 1497
145 Ga0207699_10275150 3300025906 Bacteria 1168
146 Ga0207684_10058034 3300025910 Bacteria 3284
147 Ga0207684_10543239 3300025910 Bacteria 994
148 Ga0207654_10088670 3300025911 Bacteria 1880
149 Ga0207707_10255417 3300025912 Bacteria 1522
150 Ga0207707_11270069 3300025912 Bacteria 593
151 Ga0207671_10261993 3300025914 Bacteria 1361
152 Ga0207693_10001256 3300025915 Bacteria 22567
153 Ga0207693_10533017 3300025915 Bacteria 916
154 Ga0207663_10143550 3300025916 Bacteria 1666
155 Ga0207660_10003185 3300025917 Bacteria 10735
156 Ga0207662_10022505 3300025918 Bacteria 3614
157 Ga0207657_10002716 3300025919 Bacteria 19059
158 Ga0207652_11245557 3300025921 Unclassified 646
159 Ga0207646_10025119 3300025922 Bacteria 5453
160 Ga0207646_10814143 3300025922 Bacteria 831
161 Ga0207646_10871526 3300025922 Bacteria 800
162 Ga0207646_10929062 3300025922 Bacteria 771
163 Ga0207681_10469746 3300025923 Bacteria 1026
164 Ga0207659_10226734 3300025926 Bacteria 1505
165 Ga0207687_10031647 3300025927 Bacteria 3577
166 Ga0207687_10448661 3300025927 Bacteria 1069
167 Ga0207687_10594475 3300025927 Bacteria 932
168 Ga0207687_10625666 3300025927 Bacteria 909
169 Ga0207664_10012259 3300025929 Bacteria 6127
170 Ga0207690_10504957 3300025932 Unclassified 978
171 Ga0207690_11230726 3300025932 Unclassified 625
172 Ga0207706_10010931 3300025933 Bacteria 8278
173 Ga0207706_10034995 3300025933 Bacteria 4468
174 Ga0207706_10342966 3300025933 Bacteria 1299
175 Ga0207686_10085588 3300025934 Bacteria 2068
176 Ga0207686_10260966 3300025934 Bacteria 1270
177 Ga0207709_10117008 3300025935 Bacteria 1793
178 Ga0207670_10212675 3300025936 Bacteria 1475
179 Ga0207669_10111041 3300025937 Bacteria 1837
180 Ga0207704_10125391 3300025938 Bacteria 1767
181 Ga0207661_10068472 3300025944 Bacteria 2891
182 Ga0207679_10307000 3300025945 Bacteria 1369
183 Ga0207667_10072793 3300025949 Bacteria 3571
184 Ga0207667_10074302 3300025949 Bacteria 3531
185 Ga0207667_10126994 3300025949 Bacteria 2627
186 Ga0207651_10400807 3300025960 Unclassified 1167
187 Ga0207712_10036052 3300025961 Bacteria 3366
188 Ga0207712_10096753 3300025961 Unclassified 2186
189 Ga0207668_10011321 3300025972 Bacteria 5415
190 Ga0207640_10155555 3300025981 Bacteria 1685
191 Ga0207677_10267467 3300026023 Bacteria 1397
192 Ga0207677_10421308 3300026023 Unclassified 1137
193 Ga0207639_10298751 3300026041 Bacteria 1423
194 Ga0207678_10006146 3300026067 Bacteria 10683
195 Ga0207708_10000515 3300026075 Bacteria 29848
196 Ga0207702_10028695 3300026078 Bacteria 4627
197 Ga0207702_10038598 3300026078 Bacteria 3999
198 Ga0207648_10000705 3300026089 Bacteria 37489
199 Ga0207648_10092258 3300026089 Bacteria 2648
200 Ga0207674_10000923 3300026116 Bacteria 38278
201 Ga0207674_10002109 3300026116 Bacteria 25169
202 Ga0207675_100002893 3300026118 Bacteria 16878
203 Ga0207683_10023530 3300026121 Bacteria 5299
204 Ga0207428_10601617 3300027907 Bacteria 792
205 Ga0268266_10129141 3300028379 Bacteria 2259
206 Ga0268265_10280354 3300028380 Bacteria 1491
207 Ga0268265_10504374 3300028380 Unclassified 1141
208 Ga0307409_100206850 3300031995 Bacteria 1760
209 Ga0307416_100119096 3300032002 Bacteria 2348
210 Ga0307414_10414655 3300032004 Unclassified 1173
211 Ga0307411_11266505 3300032005 Bacteria 671
212 Ga0373943_0355058 3300035170 Bacteria 841
213 Ga0373935_0123103 3300035692 Bacteria 1735
214 Ga0395899_0010130 3300037312 Bacteria 7228
215 Ga0395899_0041718 3300037312 Bacteria 3428
216 Ga0395899_0481253 3300037312 Unclassified 808
217 Ga0395900_0007148 3300037418 Bacteria 11569
218 Ga0395900_0014100 3300037418 Bacteria 8160
219 Ga0395900_0024887 3300037418 Bacteria 6126
220 Ga0395900_0067530 3300037418 Bacteria 3673
221 Ga0395900_0656132 3300037418 Unclassified 985
222 Ga0395898_0003692 3300037466 Bacteria 17010
223 Ga0395898_0004728 3300037466 Bacteria 14820
224 Ga0395898_0010283 3300037466 Bacteria 9792
225 Ga0395898_0354501 3300037466 Bacteria 1399
226 Ga0395898_1195139 3300037466 Unclassified 692
227 Ga0395898_1502528 3300037466 Bacteria 599
228 Ga0395898_1544755 3300037466 Unclassified 589
229 Ga0395905_0002224 3300037471 Bacteria 21889
230 Ga0395905_0012584 3300037471 Bacteria 8140
231 Ga0395905_0020154 3300037471 Bacteria 6317
232 Ga0395905_0020464 3300037471 Bacteria 6268
233 Ga0395905_0023205 3300037471 Bacteria 5864
234 Ga0395905_0296190 3300037471 Unclassified 1505
235 Ga0395901_0008564 3300038443 Bacteria 10336
236 Ga0395901_0016741 3300038443 Bacteria 7470
237 Ga0395901_0032367 3300038443 Bacteria 5396
238 Ga0395901_0043408 3300038443 Bacteria 4663
239 Ga0395901_0061820 3300038443 Bacteria 3897
240 Ga0395901_0165591 3300038443 Unclassified 2321
241 Ga0395901_0189985 3300038443 Bacteria 2154
242 Ga0395901_0250222 3300038443 Unclassified 1846
243 Ga0395901_0292233 3300038443 Unclassified 1691
244 Ga0395901_0339210 3300038443 Unclassified 1553
245 Ga0439461_0001225 3300041410 Bacteria 3913
246 Ga0439461_0025991 3300041410 Unclassified 1192
247 Ga0439461_0076080 3300041410 Unclassified 785
248 Ga0439466_0029708 3300041411 Unclassified 1879
249 Ga0451853_2640462 3300041512 Bacteria 1467
250 Ga0439431_0053578 3300041997 Unclassified 1051
251 Ga0439445_0005343 3300042004 Bacteria 2926
252 Ga0439446_0006147 3300042156 Bacteria 3119
253 Ga0439434_0004397 3300042435 Bacteria 4122
254 Ga0495603_0014784 3300046455 Bacteria 4721
255 Ga0495641_0007636 3300046461 Bacteria 6722
256 Ga0495651_0094089 3300046462 Bacteria 2243
257 Ga0495582_0006027 3300046473 Bacteria 6759
258 Ga0495605_0055675 3300046474 Unclassified 1910
259 Ga0495605_0182187 3300046474 Unclassified 923
260 Ga0495662_0072609 3300046476 Bacteria 1669
261 Ga0495664_0225539 3300046477 Bacteria 1134
262 Ga0495584_0065705 3300046491 Unclassified 1825
263 Ga0495584_0364690 3300046491 Bacteria 734
264 Ga0495585_0126542 3300046492 Unclassified 1348
265 Ga0495594_0108662 3300046499 Bacteria 1563
266 Ga0495596_0028372 3300046500 Unclassified 2248
267 Ga0495608_0137800 3300046511 Unclassified 1559
268 Ga0495608_0420010 3300046511 Unclassified 816
269 Ga0495616_0217207 3300046513 Bacteria 834
270 Ga0495618_0246035 3300046514 Archaea 1123
271 Ga0495628_0096598 3300046516 Bacteria 2282
272 Ga0495630_0133202 3300046517 Unclassified 1888
273 Ga0495630_0447953 3300046517 Bacteria 989
274 Ga0495631_0133023 3300046518 Unclassified 1069
275 Ga0495663_0016177 3300046525 Bacteria 2108
276 Ga0495663_0019822 3300046525 Unclassified 1928
277 Ga0495609_0034278 3300046538 Unclassified 2302
278 Ga0495645_0449204 3300046543 Unclassified 813
279 Ga0495667_0134965 3300046559 Unclassified 1591
280 Ga0495656_0257582 3300046615 Unclassified 883
281 Ga0495659_0019918 3300046664 Bacteria 2249
282 Ga0495659_0225036 3300046664 Bacteria 776
283 Ga0495588_0048425 3300046674 Bacteria 2183
284 Ga0495646_0098120 3300046680 Unclassified 1683
285 Ga0495647_0434795 3300046681 Bacteria 606
286 Ga0495658_0036580 3300046683 Bacteria 2710
287 Ga0495658_0059273 3300046683 Bacteria 2192
288 Ga0495613_0035137 3300046689 Bacteria 3721
289 Ga0495624_0348473 3300046690 Bacteria 891
290 Ga0495671_0083268 3300046692 Unclassified 1568
291 Ga0495581_0000094 3300047315 Bacteria 36744
292 Ga0495581_0015923 3300047315 Bacteria 4369
293 Ga0495674_0217041 3300047319 Unclassified 1582
294 Ga0495676_0002561 3300047321 Bacteria 16185
295 Ga0495684_0094377 3300047471 Bacteria 2265
296 Ga0495602_0532108 3300048088 Unclassified 817
297 Ga0496100_0032253 3300048903 Bacteria 3264
298 Ga0496102_0042354 3300048905 Bacteria 4125
299 Ga0496102_0631429 3300048905 Bacteria 994
300 Ga0496104_0130032 3300048907 Bacteria 2419
301 Ga0496104_0188746 3300048907 Bacteria 1972
302 Ga0496105_0438374 3300048908 Bacteria 1032
303 Ga0496106_0341443 3300048909 Bacteria 1203
304 Ga0496106_1169520 3300048909 Bacteria 601
305 Ga0496107_0415497 3300048910 Bacteria 1000
306 Ga0496108_0035459 3300048911 Bacteria 4147
307 Ga0496108_0158403 3300048911 Bacteria 1956
308 Ga0496108_0189835 3300048911 Unclassified 1781
309 Ga0496108_0368482 3300048911 Bacteria 1254
310 Ga0496109_0011202 3300048912 Bacteria 7696
311 Ga0496109_0020700 3300048912 Bacteria 5810
312 Ga0496109_0169271 3300048912 Unclassified 2049
313 Ga0496109_0227001 3300048912 Bacteria 1756
314 Ga0496110_0052334 3300048913 Bacteria 3588
315 Ga0496110_0145308 3300048913 Bacteria 2145
316 Ga0496110_0253964 3300048913 Bacteria 1600
317 Ga0496110_0998362 3300048913 Bacteria 744
318 Ga0496110_1043922 3300048913 Unclassified 725
319 Ga0496111_0037524 3300048914 Bacteria 3467
320 Ga0496111_0259350 3300048914 Bacteria 1290
321 Ga0496112_0213064 3300048915 Bacteria 1889
322 Ga0496112_0531457 3300048915 Bacteria 1110
323 Ga0496113_0075814 3300048916 Bacteria 2568
324 Ga0496113_0188615 3300048916 Bacteria 1636
325 Ga0496113_0191412 3300048916 Unclassified 1624
326 Ga0496115_0085981 3300048918 Bacteria 2565
327 Ga0501038_0307833 3300049574 Bacteria 1242
328 Ga0501042_0343692 3300049578 Bacteria 1079
329 Ga0501048_0362021 3300049582 Viruses 1035
330 Ga0501067_0005710 3300049583 Bacteria 6906
331 Ga0501069_0000573 3300049585 Bacteria 17009
332 Ga0501072_0312410 3300049588 Viruses 1249
333 Ga0501077_0672988 3300049593 Bacteria 665
334 nmdc:mga05p37_1792351_c1 3300050507 Unclassified 593
335 nmdc:mga08y16_1061935_c1 3300050511 Bacteria 787
336 nmdc:mga08y16_170311_c1 3300050511 Bacteria 2262
337 nmdc:mga0n895_675832_c1 3300050512 Bacteria 1030
338 nmdc:mga0rr50_708848_c1 3300050513 Unclassified 859
339 Ga0495601_0107062 3300053077 Unclassified 1808
340 Ga0495601_0147513 3300053077 Unclassified 1535
341 Ga0495595_0103221 3300053084 Unclassified 1377
342 Ga0501084_0671726 3300054114 Unclassified 874
343 Ga0530510_0031839 3300061734 Bacteria 3792
344 Ga0395905_0595527
345 Ga0070676_10678891
346 Ga0070683_100009377
347 Ga0070683_100145347
348 Ga0070666_10074623
349 Ga0070680_100201981
350 Ga0070682_100032133
351 Ga0068868_100213442
352 Ga0068868_100497545
353 Ga0070691_10124062
354 Ga0070687_100234275
355 Ga0070692_10209349
356 Ga0070668_100021194
357 Ga0070668_100219745
358 Ga0070669_100422661
359 Ga0070673_100112702
360 Ga0070673_100201850
361 Ga0070688_100007444
362 Ga0070659_100365789
363 Ga0070667_100342136
364 Ga0070703_10090500
365 Ga0070709_10067463
366 Ga0070714_100038155
367 Ga0070714_100215918
368 Ga0070713_100114582
369 Ga0070710_10093085
370 Ga0070701_10003678
371 Ga0070701_10384518
372 Ga0070711_100006925
373 Ga0070705_100126949
374 Ga0070700_100113057
375 Ga0070694_100262901
376 Ga0070694_100323070
377 Ga0070694_100339337
378 Ga0070708_100170565
379 Ga0070663_100107337
380 Ga0070678_100018547
381 Ga0070662_100041395
382 Ga0070662_100065973
383 Ga0070681_11030713
384 Ga0068867_100054578
385 Ga0070685_10027717
386 Ga0070685_10048261
387 Ga0070706_100248540
388 Ga0070707_100014133
389 Ga0070707_100545171
390 Ga0070698_100006283
391 Ga0070679_100688262
392 Ga0068853_100075864
393 Ga0070672_100159215
394 Ga0070695_101216808
395 Ga0070696_100026320
396 Ga0070696_100208602
397 Ga0070696_100492003
398 Ga0070693_100250999
399 Ga0070665_100033262
400 Ga0070704_100039962
401 Ga0070704_100089418
402 Ga0070704_100576370
403 Ga0068855_100028306
404 Ga0068855_100089423
405 Ga0068855_100650758
406 Ga0070664_100141132
407 Ga0068857_100005679
408 Ga0068857_100044120
409 Ga0068854_100338803
410 Ga0068856_100008762
411 Ga0068856_100099403
412 Ga0070702_100015066
413 Ga0070702_100038105
414 Ga0068859_100682419
415 Ga0068864_101586657
416 Ga0068861_100037148
417 Ga0068851_10159755
418 Ga0068863_100627529
419 Ga0068860_101097984
420 Ga0068862_100548166
421 Ga0081455_10088175
422 Ga0081538_10001503
423 Ga0081540_1001335
424 Ga0081540_1143438
425 Ga0070717_10014733
426 Ga0070712_100151956
427 Ga0070712_100228327
428 Ga0070712_100938831
429 Ga0097621_100333044
430 Ga0075431_100493052
431 Ga0075433_11042768
432 Ga0075434_100581888
433 Ga0068865_100006636
434 Ga0068865_100138231
435 Ga0097620_100682435
436 Ga0075435_100185425
437 Ga0111539_10012751
438 Ga0111539_10367971
439 Ga0111539_10431753
440 Ga0105245_10006942
441 Ga0105245_10007115
442 Ga0105245_10079199
443 Ga0105245_10116464
444 Ga0105245_10297756
445 Ga0105245_10532872
446 Ga0105247_10148265
447 Ga0114129_10877861
448 Ga0114129_12099872
449 Ga0105243_10223161
450 Ga0105243_10312219
451 Ga0105241_10323876
452 Ga0105242_10005237
453 Ga0105242_10596934
454 Ga0105248_10021199
455 Ga0105237_10050681
456 Ga0105238_10093471
457 Ga0105249_10134928
458 Ga0105239_10027132
459 Ga0105239_10075392
460 Ga0105239_10126649
461 Ga0105246_10023947
462 Ga0105246_11053723
463 Ga0157342_1047241
464 Ga0157374_10028620
465 Ga0157374_10082266
466 Ga0157378_10009952
467 Ga0163162_10007734
468 Ga0163162_10106270
469 Ga0157372_10056077
470 Ga0157372_10721275
471 Ga0157375_10007650
472 Ga0157375_10231604
473 Ga0157380_10217584
474 Ga0182008_10250383
475 Ga0182008_10577195
476 Ga0157377_10002322
477 Ga0157377_10186258
478 Ga0157377_10249765
479 Ga0157379_10636476
480 Ga0157376_10077906
481 Ga0157376_12499917
482 Ga0207653_10038906
483 Ga0207653_10071443
484 Ga0207682_10072077
485 Ga0207710_10074368
486 Ga0207688_10035921
487 Ga0207680_10162961
488 Ga0207699_10275150
489 Ga0207684_10058034
490 Ga0207684_10543239
491 Ga0207654_10088670
492 Ga0207707_10255417
493 Ga0207707_11270069
494 Ga0207671_10261993
495 Ga0207693_10001256
496 Ga0207693_10533017
497 Ga0207663_10143550
498 Ga0207660_10003185
499 Ga0207662_10022505
500 Ga0207657_10002716
501 Ga0207652_11245557
502 Ga0207646_10025119
503 Ga0207646_10814143
504 Ga0207646_10871526
505 Ga0207646_10929062
506 Ga0207681_10469746
507 Ga0207659_10226734
508 Ga0207687_10031647
509 Ga0207687_10448661
510 Ga0207687_10594475
511 Ga0207687_10625666
512 Ga0207664_10012259
513 Ga0207690_10504957
514 Ga0207690_11230726
515 Ga0207706_10010931
516 Ga0207706_10034995
517 Ga0207706_10342966
518 Ga0207686_10085588
519 Ga0207686_10260966
520 Ga0207709_10117008
521 Ga0207670_10212675
522 Ga0207669_10111041
523 Ga0207704_10125391
524 Ga0207661_10068472
525 Ga0207679_10307000
526 Ga0207667_10072793
527 Ga0207667_10074302
528 Ga0207667_10126994
529 Ga0207651_10400807
530 Ga0207712_10036052
531 Ga0207712_10096753
532 Ga0207668_10011321
533 Ga0207640_10155555
534 Ga0207677_10267467
535 Ga0207677_10421308
536 Ga0207639_10298751
537 Ga0207678_10006146
538 Ga0207708_10000515
539 Ga0207702_10028695
540 Ga0207702_10038598
541 Ga0207648_10000705
542 Ga0207648_10092258
543 Ga0207674_10000923
544 Ga0207674_10002109
545 Ga0207675_100002893
546 Ga0207683_10023530
547 Ga0207428_10601617
548 Ga0268266_10129141
549 Ga0268265_10280354
550 Ga0268265_10504374
551 Ga0307409_100206850
552 Ga0307416_100119096
553 Ga0307414_10414655
554 Ga0307411_11266505
555 Ga0373943_0355058
556 Ga0373935_0123103
557 Ga0395899_0010130
558 Ga0395899_0041718
559 Ga0395899_0481253
560 Ga0395900_0007148
561 Ga0395900_0014100
562 Ga0395900_0024887
563 Ga0395900_0067530
564 Ga0395900_0656132
565 Ga0395898_0003692
566 Ga0395898_0004728
567 Ga0395898_0010283
568 Ga0395898_0354501
569 Ga0395898_1195139
570 Ga0395898_1502528
571 Ga0395898_1544755
572 Ga0395905_0002224
573 Ga0395905_0012584
574 Ga0395905_0020154
575 Ga0395905_0020464
576 Ga0395905_0023205
577 Ga0395905_0296190
578 Ga0395901_0008564
579 Ga0395901_0016741
580 Ga0395901_0032367
581 Ga0395901_0043408
582 Ga0395901_0061820
583 Ga0395901_0165591
584 Ga0395901_0189985
585 Ga0395901_0250222
586 Ga0395901_0292233
587 Ga0395901_0339210
588 Ga0439461_0001225
589 Ga0439461_0025991
590 Ga0439461_0076080
591 Ga0439466_0029708
592 Ga0451853_2640462
593 Ga0439431_0053578
594 Ga0439445_0005343
595 Ga0439446_0006147
596 Ga0439434_0004397
597 Ga0495603_0014784
598 Ga0495641_0007636
599 Ga0495651_0094089
600 Ga0495582_0006027
601 Ga0495605_0055675
602 Ga0495605_0182187
603 Ga0495662_0072609
604 Ga0495664_0225539
605 Ga0495584_0065705
606 Ga0495584_0364690
607 Ga0495585_0126542
608 Ga0495594_0108662
609 Ga0495596_0028372
610 Ga0495608_0137800
611 Ga0495608_0420010
612 Ga0495616_0217207
613 Ga0495618_0246035
614 Ga0495628_0096598
615 Ga0495630_0133202
616 Ga0495630_0447953
617 Ga0495631_0133023
618 Ga0495663_0016177
619 Ga0495663_0019822
620 Ga0495609_0034278
621 Ga0495645_0449204
622 Ga0495667_0134965
623 Ga0495656_0257582
624 Ga0495659_0019918
625 Ga0495659_0225036
626 Ga0495588_0048425
627 Ga0495646_0098120
628 Ga0495647_0434795
629 Ga0495658_0036580
630 Ga0495658_0059273
631 Ga0495613_0035137
632 Ga0495624_0348473
633 Ga0495671_0083268
634 Ga0495581_0000094
635 Ga0495581_0015923
636 Ga0495674_0217041
637 Ga0495676_0002561
638 Ga0495684_0094377
639 Ga0495602_0532108
640 Ga0496100_0032253
641 Ga0496102_0042354
642 Ga0496102_0631429
643 Ga0496104_0130032
644 Ga0496104_0188746
645 Ga0496105_0438374
646 Ga0496106_0341443
647 Ga0496106_1169520
648 Ga0496107_0415497
649 Ga0496108_0035459
650 Ga0496108_0158403
651 Ga0496108_0189835
652 Ga0496108_0368482
653 Ga0496109_0011202
654 Ga0496109_0020700
655 Ga0496109_0169271
656 Ga0496109_0227001
657 Ga0496110_0052334
658 Ga0496110_0145308
659 Ga0496110_0253964
660 Ga0496110_0998362
661 Ga0496110_1043922
662 Ga0496111_0037524
663 Ga0496111_0259350
664 Ga0496112_0213064
665 Ga0496112_0531457
666 Ga0496113_0075814
667 Ga0496113_0188615
668 Ga0496113_0191412
669 Ga0496115_0085981
670 Ga0501038_0307833
671 Ga0501042_0343692
672 Ga0501048_0362021
673 Ga0501067_0005710
674 Ga0501069_0000573
675 Ga0501072_0312410
676 Ga0501077_0672988
677 nmdc:mga05p37_1792351_c1
678 nmdc:mga08y16_1061935_c1
679 nmdc:mga08y16_170311_c1
680 nmdc:mga0n895_675832_c1
681 nmdc:mga0rr50_708848_c1
682 Ga0495601_0107062
683 Ga0495601_0147513
684 Ga0495595_0103221
685 Ga0501084_0671726
686 Ga0530510_0031839

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12804

NTP_transf_3

MobA-like NTP transferase domain

29

174

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
3jtj-assembly1.cif.gz_A-2 3-deoxy-manno-octulosonate cytidylyltransferase from yersinia pestis 0.826 10 124
8b31-assembly1.cif.gz_B crystal structure of udp-glucose pyrophosphorylase from thermocrispum agreste dsm 44070 0.823 9 142
1vic-assembly3.cif.gz_B crystal structure of cmp-kdo synthetase 0.814 10 124
2waw-assembly1.cif.gz_A crystal structure of mycobacterium tuberculosis rv0371c homolog from mycobacterium sp. strain jc1 0.807 8 171
3k8e-assembly2.cif.gz_A crystal structure of e. coli lipopolysaccharide specific cmp-kdo synthetase 0.7952 10 122
ID Description Score Start End Superfamily
af_A0A0P0VBA2_1_174_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8366 72 141 3.90.550.10
af_P9WJQ9_9_197_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8313 9 171 3.90.550.10
af_Q61647_178_371_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8027 71 122 3.90.550.10
af_Q2FVY4_1_197_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.7895 11 171 3.90.550.10
2weeA00 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.778 7 171 3.90.550.10
ID Description Score Start End GO Terms
AF-A0A538F2W8-F1-model_v4 Nucleotidyltransferase family protein 0.98 8 172 GO:0016779
AF-A0A538M2P6-F1-model_v4 Nucleotidyltransferase family protein 0.9786 8 178 GO:0016779
AF-A0A7M2Z016-F1-model_v4 Putative MobA-related protein 0.978 8 177 GO:0016779
AF-A0A7M2Z016-F1-model_v4 Putative MobA-related protein 0.9668 8 177 GO:0016779
AF-A0A538IA21-F1-model_v4 Nucleotidyltransferase family protein 0.9643 1 172 GO:0016779

Map