F415644
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 343 | 176 | 343 | 220 |
Family's Representative Sequence
| Representative Sequence | 3300031852|Ga0307410_10088503|Ga0307410_100885032 |
| Length | 213 |
| Sequence | MAGADARLAFVRERIARACDLARRDPAEVQIIAVSKGRTADHIEPLIAAGQRDFGESRVQEAAAKWPDLRERYPDLGLHMIGRLQSNKAAQAATLFDSIHSLDRASLLDALAEAQSPPCFVQVNIGDEPQKGGVAVDQLGAFLERMRATQVPLAGLMAIPPDAYEAAPFFALLNELARRHDVKGLSMGMSADYPEAVMLGATVVRVGTALFED |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886012 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 | Metagenome | Rhizosphere |
| 2 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 3 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 4 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 5 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 6 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 7 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 8 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 11 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 16 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 24 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 33 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 34 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 35 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 37 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 41 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 43 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 44 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 45 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 46 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 47 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 48 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 49 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 50 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 51 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 52 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 53 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 54 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 55 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 58 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 59 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300012512 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 | Metagenome | Rhizosphere |
| 71 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 81 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 131 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 132 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 133 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 134 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 135 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 136 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 137 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 138 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 139 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 140 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 141 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 142 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 143 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 144 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 145 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 146 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 147 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 148 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 149 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 150 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 151 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 152 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 153 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 154 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 155 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 156 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 157 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 158 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 159 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 170 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 171 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 172 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 173 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 174 | 3300049765 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought | Metagenome | Rhizosphere |
| 175 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 176 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 1.46 |
| Rhizosphere | 97.96 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.58 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | MBSR1b_contig_8639358 | 2162886012 | Bacteria | 3036 |
| 2 | JGI24736J21556_1001329 | 3300001904 | Bacteria | 4519 |
| 3 | JGI24746J21847_1004600 | 3300001977 | Bacteria | 2173 |
| 4 | JGI24749J21850_1000139 | 3300002076 | Bacteria | 11813 |
| 5 | JGI24744J21845_10000804 | 3300002077 | Bacteria | 5894 |
| 6 | rootH1_10038125 | 3300003323 | Bacteria | 3893 |
| 7 | rootH1_10081980 | 3300003323 | Bacteria | 2329 |
| 8 | Ga0065715_10000357 | 3300005293 | Bacteria | 14467 |
| 9 | Ga0070658_10462901 | 3300005327 | Bacteria | 1093 |
| 10 | Ga0070676_10009377 | 3300005328 | Bacteria | 5290 |
| 11 | Ga0070676_10115493 | 3300005328 | Bacteria | 1677 |
| 12 | Ga0070690_100395563 | 3300005330 | Bacteria | 1014 |
| 13 | Ga0070670_100005336 | 3300005331 | Bacteria | 10836 |
| 14 | Ga0070670_100099980 | 3300005331 | Bacteria | 2496 |
| 15 | Ga0070677_10000652 | 3300005333 | Bacteria | 11602 |
| 16 | Ga0070666_10000205 | 3300005335 | Bacteria | 40586 |
| 17 | Ga0070660_100011183 | 3300005339 | Bacteria | 6369 |
| 18 | Ga0070660_100135634 | 3300005339 | Bacteria | 1972 |
| 19 | Ga0070660_100420104 | 3300005339 | Bacteria | 1107 |
| 20 | Ga0070689_100104808 | 3300005340 | Bacteria | 2242 |
| 21 | Ga0070661_100004478 | 3300005344 | Bacteria | 9635 |
| 22 | Ga0070661_100319116 | 3300005344 | Bacteria | 1213 |
| 23 | Ga0070668_100002805 | 3300005347 | Bacteria | 12821 |
| 24 | Ga0070668_100006099 | 3300005347 | Bacteria | 8938 |
| 25 | Ga0070668_100019021 | 3300005347 | Bacteria | 5163 |
| 26 | Ga0070669_100001859 | 3300005353 | Bacteria | 15190 |
| 27 | Ga0070675_100001753 | 3300005354 | Bacteria | 16008 |
| 28 | Ga0070675_100289504 | 3300005354 | Unclassified | 1441 |
| 29 | Ga0070671_100004029 | 3300005355 | Bacteria | 11578 |
| 30 | Ga0070671_100037229 | 3300005355 | Bacteria | 4034 |
| 31 | Ga0070671_100063722 | 3300005355 | Bacteria | 3070 |
| 32 | Ga0070671_100301440 | 3300005355 | Bacteria | 1364 |
| 33 | Ga0070674_100012769 | 3300005356 | Bacteria | 5168 |
| 34 | Ga0070674_100048840 | 3300005356 | Bacteria | 2906 |
| 35 | Ga0070673_100010076 | 3300005364 | Bacteria | 6379 |
| 36 | Ga0070688_100689339 | 3300005365 | Bacteria | 790 |
| 37 | Ga0070659_100102083 | 3300005366 | Bacteria | 2309 |
| 38 | Ga0070659_100170682 | 3300005366 | Bacteria | 1781 |
| 39 | Ga0070667_100003025 | 3300005367 | Bacteria | 14454 |
| 40 | Ga0070667_100007182 | 3300005367 | Bacteria | 9256 |
| 41 | Ga0070667_100035574 | 3300005367 | Bacteria | 4173 |
| 42 | Ga0070709_10006547 | 3300005434 | Bacteria | 6352 |
| 43 | Ga0070714_100055350 | 3300005435 | Bacteria | 3390 |
| 44 | Ga0070713_100221731 | 3300005436 | Bacteria | 1715 |
| 45 | Ga0070700_100202180 | 3300005441 | Bacteria | 1396 |
| 46 | Ga0070663_100007296 | 3300005455 | Bacteria | 6720 |
| 47 | Ga0070663_100058093 | 3300005455 | Bacteria | 2777 |
| 48 | Ga0070663_100087863 | 3300005455 | Bacteria | 2298 |
| 49 | Ga0070662_100000350 | 3300005457 | Bacteria | 27678 |
| 50 | Ga0070681_10106071 | 3300005458 | Bacteria | 2751 |
| 51 | Ga0070679_100230279 | 3300005530 | Bacteria | 1812 |
| 52 | Ga0068853_100041433 | 3300005539 | Bacteria | 3933 |
| 53 | Ga0068853_100108704 | 3300005539 | Bacteria | 2460 |
| 54 | Ga0070672_100001606 | 3300005543 | Bacteria | 14037 |
| 55 | Ga0070672_100182674 | 3300005543 | Bacteria | 1748 |
| 56 | Ga0070686_100016200 | 3300005544 | Bacteria | 4333 |
| 57 | Ga0070695_100079877 | 3300005545 | Bacteria | 2160 |
| 58 | Ga0070696_100357796 | 3300005546 | Bacteria | 1132 |
| 59 | Ga0070693_100088957 | 3300005547 | Bacteria | 1858 |
| 60 | Ga0068855_100140154 | 3300005563 | Bacteria | 2757 |
| 61 | Ga0070664_100008513 | 3300005564 | Bacteria | 8294 |
| 62 | Ga0070664_100042400 | 3300005564 | Bacteria | 3842 |
| 63 | Ga0068857_100022191 | 3300005577 | Bacteria | 5584 |
| 64 | Ga0068857_100053090 | 3300005577 | Bacteria | 3596 |
| 65 | Ga0068857_100113340 | 3300005577 | Bacteria | 2438 |
| 66 | Ga0068857_100622718 | 3300005577 | Bacteria | 1021 |
| 67 | Ga0068854_100004556 | 3300005578 | Bacteria | 8737 |
| 68 | Ga0068854_100067851 | 3300005578 | Bacteria | 2599 |
| 69 | Ga0068854_100245889 | 3300005578 | Bacteria | 1426 |
| 70 | Ga0068856_100288326 | 3300005614 | Bacteria | 1658 |
| 71 | Ga0068856_100336570 | 3300005614 | Bacteria | 1527 |
| 72 | Ga0068852_100021784 | 3300005616 | Bacteria | 5126 |
| 73 | Ga0068852_100034064 | 3300005616 | Bacteria | 4236 |
| 74 | Ga0068852_100146819 | 3300005616 | Bacteria | 2188 |
| 75 | Ga0068852_100153905 | 3300005616 | Bacteria | 2140 |
| 76 | Ga0068852_100533963 | 3300005616 | Bacteria | 1172 |
| 77 | Ga0068859_100010015 | 3300005617 | Bacteria | 9561 |
| 78 | Ga0068859_100066062 | 3300005617 | Bacteria | 3652 |
| 79 | Ga0068859_100102714 | 3300005617 | Bacteria | 2916 |
| 80 | Ga0068864_100004984 | 3300005618 | Bacteria | 10880 |
| 81 | Ga0068864_100023725 | 3300005618 | Bacteria | 5154 |
| 82 | Ga0068866_10216673 | 3300005718 | Bacteria | 1152 |
| 83 | Ga0068861_100015774 | 3300005719 | Bacteria | 5333 |
| 84 | Ga0068851_10022273 | 3300005834 | Bacteria | 3084 |
| 85 | Ga0068851_10079360 | 3300005834 | Bacteria | 1712 |
| 86 | Ga0068863_100010334 | 3300005841 | Bacteria | 9067 |
| 87 | Ga0068863_100160431 | 3300005841 | Bacteria | 2154 |
| 88 | Ga0068863_100594381 | 3300005841 | Bacteria | 1095 |
| 89 | Ga0068858_100000980 | 3300005842 | Bacteria | 29457 |
| 90 | Ga0068858_100050243 | 3300005842 | Bacteria | 3859 |
| 91 | Ga0068860_100048457 | 3300005843 | Bacteria | 4050 |
| 92 | Ga0068860_100048726 | 3300005843 | Bacteria | 4037 |
| 93 | Ga0068860_100094960 | 3300005843 | Bacteria | 2842 |
| 94 | Ga0068860_100146173 | 3300005843 | Bacteria | 2275 |
| 95 | Ga0068862_100003962 | 3300005844 | Bacteria | 12579 |
| 96 | Ga0068862_100058074 | 3300005844 | Bacteria | 3319 |
| 97 | Ga0068862_100921711 | 3300005844 | Bacteria | 860 |
| 98 | Ga0070717_10030870 | 3300006028 | Bacteria | 4306 |
| 99 | Ga0097621_100071566 | 3300006237 | Bacteria | 2866 |
| 100 | Ga0068871_100024780 | 3300006358 | Bacteria | 4657 |
| 101 | Ga0068865_100009912 | 3300006881 | Bacteria | 5920 |
| 102 | Ga0097620_100010015 | 3300006931 | Bacteria | 9561 |
| 103 | Ga0097620_100066061 | 3300006931 | Bacteria | 3652 |
| 104 | Ga0097620_100102711 | 3300006931 | Bacteria | 2916 |
| 105 | Ga0105251_10014665 | 3300009011 | Bacteria | 4321 |
| 106 | Ga0105240_10054442 | 3300009093 | Bacteria | 5014 |
| 107 | Ga0105240_10065302 | 3300009093 | Bacteria | 4518 |
| 108 | Ga0105240_10658506 | 3300009093 | Bacteria | 1147 |
| 109 | Ga0105245_10039260 | 3300009098 | Bacteria | 4214 |
| 110 | Ga0105247_10129964 | 3300009101 | Bacteria | 1641 |
| 111 | Ga0105243_10122479 | 3300009148 | Bacteria | 2195 |
| 112 | Ga0105241_10185906 | 3300009174 | Bacteria | 1727 |
| 113 | Ga0105248_10000390 | 3300009177 | Bacteria | 50573 |
| 114 | Ga0105248_10043821 | 3300009177 | Bacteria | 5018 |
| 115 | Ga0105237_10105840 | 3300009545 | Bacteria | 2804 |
| 116 | Ga0105238_10029121 | 3300009551 | Bacteria | 5626 |
| 117 | Ga0105249_10009551 | 3300009553 | Bacteria | 8499 |
| 118 | Ga0105249_10050376 | 3300009553 | Bacteria | 3796 |
| 119 | Ga0157327_1001364 | 3300012512 | Bacteria | 1516 |
| 120 | Ga0157373_10002479 | 3300013100 | Bacteria | 14052 |
| 121 | Ga0157371_10097525 | 3300013102 | Unclassified | 2084 |
| 122 | Ga0157371_10138413 | 3300013102 | Bacteria | 1734 |
| 123 | Ga0157371_10169787 | 3300013102 | Bacteria | 1558 |
| 124 | Ga0157371_10171895 | 3300013102 | Bacteria | 1549 |
| 125 | Ga0157371_10459834 | 3300013102 | Bacteria | 936 |
| 126 | Ga0157370_10262750 | 3300013104 | Bacteria | 1595 |
| 127 | Ga0157369_10046293 | 3300013105 | Bacteria | 4727 |
| 128 | Ga0157369_10055713 | 3300013105 | Bacteria | 4267 |
| 129 | Ga0157369_10268016 | 3300013105 | Bacteria | 1780 |
| 130 | Ga0157374_10300387 | 3300013296 | Bacteria | 1588 |
| 131 | Ga0157372_10258320 | 3300013307 | Unclassified | 2023 |
| 132 | Ga0157372_10371958 | 3300013307 | Bacteria | 1665 |
| 133 | Ga0157372_11375439 | 3300013307 | Bacteria | 814 |
| 134 | Ga0157375_10332997 | 3300013308 | Bacteria | 1683 |
| 135 | Ga0163163_10020654 | 3300014325 | Bacteria | 6206 |
| 136 | Ga0157380_10001142 | 3300014326 | Bacteria | 17160 |
| 137 | Ga0157380_10003382 | 3300014326 | Bacteria | 10946 |
| 138 | Ga0182008_10022462 | 3300014497 | Bacteria | 3231 |
| 139 | Ga0157379_10008156 | 3300014968 | Bacteria | 9096 |
| 140 | Ga0157379_10042362 | 3300014968 | Bacteria | 4064 |
| 141 | Ga0207697_10000333 | 3300025315 | Bacteria | 26386 |
| 142 | Ga0207682_10001225 | 3300025893 | Bacteria | 11858 |
| 143 | Ga0207642_10069218 | 3300025899 | Bacteria | 1673 |
| 144 | Ga0207688_10004324 | 3300025901 | Bacteria | 7749 |
| 145 | Ga0207688_10007318 | 3300025901 | Bacteria | 6008 |
| 146 | Ga0207647_10003326 | 3300025904 | Bacteria | 12077 |
| 147 | Ga0207647_10019225 | 3300025904 | Bacteria | 4598 |
| 148 | Ga0207647_10026262 | 3300025904 | Bacteria | 3812 |
| 149 | Ga0207699_10099992 | 3300025906 | Bacteria | 1838 |
| 150 | Ga0207645_10004731 | 3300025907 | Bacteria | 10020 |
| 151 | Ga0207645_10047397 | 3300025907 | Bacteria | 2744 |
| 152 | Ga0207645_10206240 | 3300025907 | Bacteria | 1294 |
| 153 | Ga0207645_10319660 | 3300025907 | Bacteria | 1035 |
| 154 | Ga0207705_10000033 | 3300025909 | Bacteria | 223997 |
| 155 | Ga0207705_10017908 | 3300025909 | Bacteria | 5066 |
| 156 | Ga0207695_10009645 | 3300025913 | Bacteria | 11903 |
| 157 | Ga0207695_10018686 | 3300025913 | Bacteria | 8005 |
| 158 | Ga0207695_10595751 | 3300025913 | Bacteria | 986 |
| 159 | Ga0207693_10039708 | 3300025915 | Bacteria | 3706 |
| 160 | Ga0207657_10024543 | 3300025919 | Bacteria | 5576 |
| 161 | Ga0207657_10137282 | 3300025919 | Bacteria | 2000 |
| 162 | Ga0207657_10173734 | 3300025919 | Bacteria | 1745 |
| 163 | Ga0207657_10487546 | 3300025919 | Bacteria | 966 |
| 164 | Ga0207649_10003587 | 3300025920 | Bacteria | 8483 |
| 165 | Ga0207649_10117435 | 3300025920 | Bacteria | 1788 |
| 166 | Ga0207652_10149079 | 3300025921 | Bacteria | 2094 |
| 167 | Ga0207681_10002252 | 3300025923 | Bacteria | 12264 |
| 168 | Ga0207694_10037347 | 3300025924 | Bacteria | 3730 |
| 169 | Ga0207650_10001160 | 3300025925 | Bacteria | 19345 |
| 170 | Ga0207659_10003531 | 3300025926 | Bacteria | 9402 |
| 171 | Ga0207659_10201143 | 3300025926 | Bacteria | 1591 |
| 172 | Ga0207687_10020163 | 3300025927 | Bacteria | 4421 |
| 173 | Ga0207700_10063065 | 3300025928 | Bacteria | 2817 |
| 174 | Ga0207644_10027342 | 3300025931 | Bacteria | 3940 |
| 175 | Ga0207644_10136582 | 3300025931 | Bacteria | 1883 |
| 176 | Ga0207690_10151196 | 3300025932 | Bacteria | 1721 |
| 177 | Ga0207706_10000222 | 3300025933 | Bacteria | 62279 |
| 178 | Ga0207706_10000276 | 3300025933 | Bacteria | 55889 |
| 179 | Ga0207706_10205867 | 3300025933 | Bacteria | 1725 |
| 180 | Ga0207709_10080175 | 3300025935 | Bacteria | 2101 |
| 181 | Ga0207670_10217808 | 3300025936 | Bacteria | 1460 |
| 182 | Ga0207669_10005678 | 3300025937 | Bacteria | 5626 |
| 183 | Ga0207669_10076531 | 3300025937 | Bacteria | 2124 |
| 184 | Ga0207704_10026790 | 3300025938 | Bacteria | 3168 |
| 185 | Ga0207691_10002789 | 3300025940 | Bacteria | 17030 |
| 186 | Ga0207691_10359544 | 3300025940 | Bacteria | 1245 |
| 187 | Ga0207711_10000190 | 3300025941 | Bacteria | 65723 |
| 188 | Ga0207689_10229998 | 3300025942 | Bacteria | 1532 |
| 189 | Ga0207679_10015858 | 3300025945 | Bacteria | 4993 |
| 190 | Ga0207667_10018949 | 3300025949 | Bacteria | 7694 |
| 191 | Ga0207651_10001768 | 3300025960 | Bacteria | 10020 |
| 192 | Ga0207651_10037268 | 3300025960 | Bacteria | 3184 |
| 193 | Ga0207668_10000847 | 3300025972 | Bacteria | 18448 |
| 194 | Ga0207668_10034584 | 3300025972 | Bacteria | 3357 |
| 195 | Ga0207640_10000473 | 3300025981 | Bacteria | 24521 |
| 196 | Ga0207640_10002375 | 3300025981 | Bacteria | 10077 |
| 197 | Ga0207640_10223385 | 3300025981 | Bacteria | 1444 |
| 198 | Ga0207640_10349126 | 3300025981 | Bacteria | 1188 |
| 199 | Ga0207640_10934050 | 3300025981 | Unclassified | 760 |
| 200 | Ga0207658_10020587 | 3300025986 | Bacteria | 4567 |
| 201 | Ga0207658_10064044 | 3300025986 | Bacteria | 2756 |
| 202 | Ga0207677_10005685 | 3300026023 | Bacteria | 6785 |
| 203 | Ga0207677_10006502 | 3300026023 | Bacteria | 6421 |
| 204 | Ga0207703_10000461 | 3300026035 | Bacteria | 42797 |
| 205 | Ga0207703_10199251 | 3300026035 | Bacteria | 1778 |
| 206 | Ga0207639_10847317 | 3300026041 | Bacteria | 853 |
| 207 | Ga0207678_10000321 | 3300026067 | Bacteria | 43233 |
| 208 | Ga0207678_10033320 | 3300026067 | Bacteria | 4489 |
| 209 | Ga0207678_10091006 | 3300026067 | Bacteria | 2607 |
| 210 | Ga0207678_10401710 | 3300026067 | Bacteria | 1186 |
| 211 | Ga0207702_10001866 | 3300026078 | Bacteria | 20690 |
| 212 | Ga0207702_10032955 | 3300026078 | Bacteria | 4325 |
| 213 | Ga0207641_10142526 | 3300026088 | Bacteria | 2164 |
| 214 | Ga0207641_10483614 | 3300026088 | Bacteria | 1200 |
| 215 | Ga0207676_10076072 | 3300026095 | Bacteria | 2711 |
| 216 | Ga0207674_10049277 | 3300026116 | Bacteria | 4308 |
| 217 | Ga0207674_10073579 | 3300026116 | Bacteria | 3430 |
| 218 | Ga0207674_10331413 | 3300026116 | Bacteria | 1472 |
| 219 | Ga0207675_100059132 | 3300026118 | Bacteria | 3577 |
| 220 | Ga0207683_10020656 | 3300026121 | Bacteria | 5635 |
| 221 | Ga0207683_10036783 | 3300026121 | Bacteria | 4263 |
| 222 | Ga0207683_10585811 | 3300026121 | Bacteria | 1032 |
| 223 | Ga0207698_10031710 | 3300026142 | Bacteria | 3819 |
| 224 | Ga0207698_10154794 | 3300026142 | Bacteria | 1995 |
| 225 | Ga0268265_10003443 | 3300028380 | Bacteria | 11386 |
| 226 | Ga0268265_10021490 | 3300028380 | Bacteria | 4522 |
| 227 | Ga0268264_10062212 | 3300028381 | Bacteria | 3134 |
| 228 | Ga0268264_10091518 | 3300028381 | Bacteria | 2624 |
| 229 | Ga0268264_10200502 | 3300028381 | Bacteria | 1825 |
| 230 | Ga0268264_10397855 | 3300028381 | Bacteria | 1323 |
| 231 | Ga0307408_100015711 | 3300031548 | Bacteria | 5043 |
| 232 | Ga0307408_100221109 | 3300031548 | Unclassified | 1545 |
| 233 | Ga0307408_100472466 | 3300031548 | Bacteria | 1092 |
| 234 | Ga0307408_101031304 | 3300031548 | Bacteria | 760 |
| 235 | Ga0307405_10004439 | 3300031731 | Bacteria | 6630 |
| 236 | Ga0307405_10426186 | 3300031731 | Bacteria | 1045 |
| 237 | Ga0307413_10001834 | 3300031824 | Bacteria | 8356 |
| 238 | Ga0307413_10043560 | 3300031824 | Bacteria | 2646 |
| 239 | Ga0307413_10055490 | 3300031824 | Bacteria | 2411 |
| 240 | Ga0307413_10096870 | 3300031824 | Bacteria | 1938 |
| 241 | Ga0307413_10178672 | 3300031824 | Bacteria | 1510 |
| 242 | Ga0307413_10479903 | 3300031824 | Bacteria | 993 |
| 243 | Ga0307413_10845450 | 3300031824 | Bacteria | 773 |
| 244 | Ga0307410_10001310 | 3300031852 | Bacteria | 11113 |
| 245 | Ga0307410_10088503 | 3300031852 | Bacteria | 2193 |
| 246 | Ga0307410_10098017 | 3300031852 | Bacteria | 2095 |
| 247 | Ga0307410_10212386 | 3300031852 | Bacteria | 1483 |
| 248 | Ga0307410_10305979 | 3300031852 | Bacteria | 1256 |
| 249 | Ga0307410_10565863 | 3300031852 | Bacteria | 944 |
| 250 | Ga0307406_10005756 | 3300031901 | Bacteria | 6792 |
| 251 | Ga0307406_10246333 | 3300031901 | Bacteria | 1344 |
| 252 | Ga0307406_10635031 | 3300031901 | Bacteria | 884 |
| 253 | Ga0307407_10000602 | 3300031903 | Bacteria | 11440 |
| 254 | Ga0307407_10044681 | 3300031903 | Bacteria | 2499 |
| 255 | Ga0307407_10118260 | 3300031903 | Bacteria | 1675 |
| 256 | Ga0307407_10294907 | 3300031903 | Bacteria | 1128 |
| 257 | Ga0307407_10321201 | 3300031903 | Bacteria | 1086 |
| 258 | Ga0307412_10017200 | 3300031911 | Bacteria | 4325 |
| 259 | Ga0307412_10066202 | 3300031911 | Bacteria | 2448 |
| 260 | Ga0307409_100008476 | 3300031995 | Bacteria | 6243 |
| 261 | Ga0307409_100015114 | 3300031995 | Bacteria | 5050 |
| 262 | Ga0307409_100088970 | 3300031995 | Bacteria | 2522 |
| 263 | Ga0307409_100100363 | 3300031995 | Bacteria | 2399 |
| 264 | Ga0307409_100101375 | 3300031995 | Bacteria | 2389 |
| 265 | Ga0307409_100178368 | 3300031995 | Bacteria | 1877 |
| 266 | Ga0307409_100292762 | 3300031995 | Bacteria | 1510 |
| 267 | Ga0307409_100322172 | 3300031995 | Bacteria | 1447 |
| 268 | Ga0307409_100351212 | 3300031995 | Bacteria | 1391 |
| 269 | Ga0307409_100707401 | 3300031995 | Bacteria | 1007 |
| 270 | Ga0307416_100012428 | 3300032002 | Bacteria | 5737 |
| 271 | Ga0307416_100059842 | 3300032002 | Bacteria | 3098 |
| 272 | Ga0307416_100158873 | 3300032002 | Bacteria | 2086 |
| 273 | Ga0307416_100177788 | 3300032002 | Bacteria | 1991 |
| 274 | Ga0307416_100202874 | 3300032002 | Bacteria | 1883 |
| 275 | Ga0307416_100222842 | 3300032002 | Bacteria | 1810 |
| 276 | Ga0307416_100317873 | 3300032002 | Bacteria | 1557 |
| 277 | Ga0307414_10005495 | 3300032004 | Bacteria | 6984 |
| 278 | Ga0307414_10051633 | 3300032004 | Bacteria | 2855 |
| 279 | Ga0307414_10056434 | 3300032004 | Bacteria | 2755 |
| 280 | Ga0307414_10262253 | 3300032004 | Bacteria | 1442 |
| 281 | Ga0307414_10479058 | 3300032004 | Bacteria | 1097 |
| 282 | Ga0307411_10006465 | 3300032005 | Bacteria | 5868 |
| 283 | Ga0307411_10014729 | 3300032005 | Bacteria | 4363 |
| 284 | Ga0307411_10023787 | 3300032005 | Bacteria | 3637 |
| 285 | Ga0307411_10026761 | 3300032005 | Bacteria | 3477 |
| 286 | Ga0307411_10137644 | 3300032005 | Bacteria | 1795 |
| 287 | Ga0307411_10153925 | 3300032005 | Bacteria | 1712 |
| 288 | Ga0307411_10188786 | 3300032005 | Bacteria | 1571 |
| 289 | Ga0307411_10299233 | 3300032005 | Bacteria | 1289 |
| 290 | Ga0307411_10844008 | 3300032005 | Bacteria | 810 |
| 291 | Ga0307415_100009831 | 3300032126 | Bacteria | 5388 |
| 292 | Ga0307415_100382600 | 3300032126 | Bacteria | 1195 |
| 293 | Ga0307415_101309480 | 3300032126 | Bacteria | 686 |
| 294 | Ga0373949_0068831 | 3300035090 | Bacteria | 924 |
| 295 | Ga0373925_0195427 | 3300037068 | Bacteria | 1607 |
| 296 | Ga0395899_0008289 | 3300037312 | Bacteria | 8004 |
| 297 | Ga0395899_0010294 | 3300037312 | Bacteria | 7170 |
| 298 | Ga0395900_0028200 | 3300037418 | Bacteria | 5751 |
| 299 | Ga0395900_0057902 | 3300037418 | Bacteria | 3989 |
| 300 | Ga0395900_0105547 | 3300037418 | Bacteria | 2894 |
| 301 | Ga0395900_0787479 | 3300037418 | Bacteria | 879 |
| 302 | Ga0395898_0821100 | 3300037466 | Bacteria | 870 |
| 303 | Ga0395905_0000541 | 3300037471 | Bacteria | 51481 |
| 304 | Ga0395905_0661419 | 3300037471 | Bacteria | 947 |
| 305 | Ga0395905_0724668 | 3300037471 | Bacteria | 897 |
| 306 | Ga0395901_0002184 | 3300038443 | Bacteria | 19974 |
| 307 | Ga0395901_0032170 | 3300038443 | Bacteria | 5413 |
| 308 | Ga0439445_0000370 | 3300042004 | Bacteria | 8995 |
| 309 | Ga0466969_0020689 | 3300044656 | Bacteria | 3405 |
| 310 | Ga0466966_0031208 | 3300044684 | Bacteria | 3456 |
| 311 | Ga0466963_0014720 | 3300044694 | Bacteria | 4827 |
| 312 | Ga0466963_0296905 | 3300044694 | Bacteria | 1136 |
| 313 | Ga0466971_0069194 | 3300044719 | Bacteria | 1601 |
| 314 | Ga0466970_0001624 | 3300044765 | Bacteria | 10829 |
| 315 | Ga0466957_0068187 | 3300044842 | Bacteria | 2195 |
| 316 | Ga0466959_0139473 | 3300045049 | Bacteria | 1714 |
| 317 | Ga0466958_0000786 | 3300045836 | Bacteria | 13978 |
| 318 | Ga0466967_0224017 | 3300045976 | Bacteria | 1788 |
| 319 | Ga0495606_0208478 | 3300046507 | Bacteria | 1108 |
| 320 | Ga0495620_0045216 | 3300046515 | Bacteria | 1909 |
| 321 | Ga0495663_0010118 | 3300046525 | Bacteria | 2619 |
| 322 | Ga0495663_0018913 | 3300046525 | Bacteria | 1965 |
| 323 | Ga0495663_0090608 | 3300046525 | Bacteria | 996 |
| 324 | Ga0495642_0044415 | 3300046528 | Bacteria | 1814 |
| 325 | Ga0495621_0091748 | 3300046539 | Bacteria | 1145 |
| 326 | Ga0495633_0021453 | 3300046558 | Bacteria | 3231 |
| 327 | Ga0495659_0013125 | 3300046664 | Bacteria | 2695 |
| 328 | Ga0495659_0016855 | 3300046664 | Bacteria | 2414 |
| 329 | Ga0495669_0011154 | 3300046684 | Bacteria | 3809 |
| 330 | Ga0495669_0127738 | 3300046684 | Bacteria | 1195 |
| 331 | Ga0495670_0012219 | 3300046691 | Bacteria | 4221 |
| 332 | Ga0495670_0028244 | 3300046691 | Bacteria | 2781 |
| 333 | Ga0495677_0018721 | 3300047445 | Bacteria | 2510 |
| 334 | Ga0495677_0089873 | 3300047445 | Unclassified | 1157 |
| 335 | Ga0495677_0137041 | 3300047445 | Bacteria | 939 |
| 336 | Ga0496103_0161129 | 3300048906 | Bacteria | 1439 |
| 337 | Ga0496106_0487668 | 3300048909 | Bacteria | 990 |
| 338 | Ga0496107_0266409 | 3300048910 | Bacteria | 1275 |
| 339 | Ga0496109_0018675 | 3300048912 | Bacteria | 6094 |
| 340 | Ga0496114_0000016 | 3300048917 | Bacteria | 274656 |
| 341 | Ga0501268_002988 | 3300049765 | Bacteria | 2279 |
| 342 | nmdc:mga06r32_126452_c1 | 3300050510 | Bacteria | 2525 |
| 343 | Ga0466962_0004150 | 3300061719 | Bacteria | 6947 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300031995 | Ga0307409_100101375 | Ga0307409_1001013752 | 205 |
| 2 | 3300031548 | Ga0307408_101031304 | Ga0307408_1010313041 | 213 |
| 3 | 3300031852 | Ga0307410_10088503 | Ga0307410_100885032 | 213 |
| 4 | 3300031901 | Ga0307406_10246333 | Ga0307406_102463331 | 213 |
| 5 | 3300001904 | JGI24736J21556_1001329 | JGI24736J21556_10013293 | 217 |
| 6 | 3300003323 | rootH1_10038125 | rootH1_100381253 | 217 |
| 7 | 3300005327 | Ga0070658_10462901 | Ga0070658_104629012 | 217 |
| 8 | 3300005339 | Ga0070660_100011183 | Ga0070660_1000111832 | 217 |
| 9 | 3300005339 | Ga0070660_100420104 | Ga0070660_1004201041 | 217 |
| 10 | 3300005344 | Ga0070661_100004478 | Ga0070661_10000447810 | 217 |
| 11 | 3300005347 | Ga0070668_100006099 | Ga0070668_1000060996 | 217 |
| 12 | 3300005354 | Ga0070675_100289504 | Ga0070675_1002895042 | 217 |
| 13 | 3300005366 | Ga0070659_100102083 | Ga0070659_1001020832 | 217 |
| 14 | 3300005435 | Ga0070714_100055350 | Ga0070714_1000553504 | 217 |
| 15 | 3300005455 | Ga0070663_100007296 | Ga0070663_1000072966 | 217 |
| 16 | 3300005539 | Ga0068853_100041433 | Ga0068853_1000414334 | 217 |
| 17 | 3300005539 | Ga0068853_100108704 | Ga0068853_1001087043 | 217 |
| 18 | 3300005563 | Ga0068855_100140154 | Ga0068855_1001401542 | 217 |
| 19 | 3300005577 | Ga0068857_100053090 | Ga0068857_1000530903 | 217 |
| 20 | 3300005577 | Ga0068857_100622718 | Ga0068857_1006227182 | 217 |
| 21 | 3300005578 | Ga0068854_100004556 | Ga0068854_1000045567 | 217 |
| 22 | 3300005578 | Ga0068854_100067851 | Ga0068854_1000678513 | 217 |
| 23 | 3300005614 | Ga0068856_100336570 | Ga0068856_1003365702 | 217 |
| 24 | 3300005616 | Ga0068852_100021784 | Ga0068852_1000217844 | 217 |
| 25 | 3300005616 | Ga0068852_100034064 | Ga0068852_1000340644 | 217 |
| 26 | 3300005834 | Ga0068851_10079360 | Ga0068851_100793601 | 217 |
| 27 | 3300005843 | Ga0068860_100146173 | Ga0068860_1001461732 | 217 |
| 28 | 3300005844 | Ga0068862_100058074 | Ga0068862_1000580741 | 217 |
| 29 | 3300005844 | Ga0068862_100921711 | Ga0068862_1009217112 | 217 |
| 30 | 3300009093 | Ga0105240_10054442 | Ga0105240_100544424 | 217 |
| 31 | 3300009093 | Ga0105240_10065302 | Ga0105240_100653025 | 217 |
| 32 | 3300009093 | Ga0105240_10658506 | Ga0105240_106585062 | 217 |
| 33 | 3300009551 | Ga0105238_10029121 | Ga0105238_100291215 | 217 |
| 34 | 3300009553 | Ga0105249_10050376 | Ga0105249_100503763 | 217 |
| 35 | 3300013102 | Ga0157371_10097525 | Ga0157371_100975253 | 217 |
| 36 | 3300013102 | Ga0157371_10138413 | Ga0157371_101384131 | 217 |
| 37 | 3300013102 | Ga0157371_10171895 | Ga0157371_101718953 | 217 |
| 38 | 3300013102 | Ga0157371_10459834 | Ga0157371_104598342 | 217 |
| 39 | 3300013104 | Ga0157370_10262750 | Ga0157370_102627503 | 217 |
| 40 | 3300013105 | Ga0157369_10046293 | Ga0157369_100462935 | 217 |
| 41 | 3300013105 | Ga0157369_10055713 | Ga0157369_100557134 | 217 |
| 42 | 3300013105 | Ga0157369_10268016 | Ga0157369_102680163 | 217 |
| 43 | 3300013307 | Ga0157372_10258320 | Ga0157372_102583202 | 217 |
| 44 | 3300013307 | Ga0157372_11375439 | Ga0157372_113754392 | 217 |
| 45 | 3300025904 | Ga0207647_10019225 | Ga0207647_100192256 | 217 |
| 46 | 3300025904 | Ga0207647_10026262 | Ga0207647_100262624 | 217 |
| 47 | 3300025909 | Ga0207705_10000033 | Ga0207705_10000033174 | 217 |
| 48 | 3300025909 | Ga0207705_10017908 | Ga0207705_100179084 | 217 |
| 49 | 3300025913 | Ga0207695_10009645 | Ga0207695_100096459 | 217 |
| 50 | 3300025913 | Ga0207695_10018686 | Ga0207695_100186866 | 217 |
| 51 | 3300025913 | Ga0207695_10595751 | Ga0207695_105957512 | 217 |
| 52 | 3300025919 | Ga0207657_10024543 | Ga0207657_100245436 | 217 |
| 53 | 3300025920 | Ga0207649_10003587 | Ga0207649_100035876 | 217 |
| 54 | 3300025920 | Ga0207649_10117435 | Ga0207649_101174352 | 217 |
| 55 | 3300025924 | Ga0207694_10037347 | Ga0207694_100373474 | 217 |
| 56 | 3300025932 | Ga0207690_10151196 | Ga0207690_101511962 | 217 |
| 57 | 3300025981 | Ga0207640_10000473 | Ga0207640_1000047323 | 217 |
| 58 | 3300025981 | Ga0207640_10223385 | Ga0207640_102233852 | 217 |
| 59 | 3300026041 | Ga0207639_10847317 | Ga0207639_108473172 | 217 |
| 60 | 3300026067 | Ga0207678_10000321 | Ga0207678_1000032140 | 217 |
| 61 | 3300026067 | Ga0207678_10091006 | Ga0207678_100910063 | 217 |
| 62 | 3300026067 | Ga0207678_10401710 | Ga0207678_104017102 | 217 |
| 63 | 3300026078 | Ga0207702_10001866 | Ga0207702_100018662 | 217 |
| 64 | 3300026078 | Ga0207702_10032955 | Ga0207702_100329555 | 217 |
| 65 | 3300026116 | Ga0207674_10073579 | Ga0207674_100735794 | 217 |
| 66 | 3300026116 | Ga0207674_10331413 | Ga0207674_103314132 | 217 |
| 67 | 3300026142 | Ga0207698_10031710 | Ga0207698_100317102 | 217 |
| 68 | 3300026142 | Ga0207698_10154794 | Ga0207698_101547943 | 217 |
| 69 | 3300028380 | Ga0268265_10021490 | Ga0268265_100214905 | 217 |
| 70 | 3300031824 | Ga0307413_10479903 | Ga0307413_104799031 | 217 |
| 71 | 3300031852 | Ga0307410_10098017 | Ga0307410_100980173 | 217 |
| 72 | 3300031852 | Ga0307410_10212386 | Ga0307410_102123862 | 217 |
| 73 | 3300031903 | Ga0307407_10118260 | Ga0307407_101182603 | 217 |
| 74 | 3300031911 | Ga0307412_10066202 | Ga0307412_100662023 | 217 |
| 75 | 3300031995 | Ga0307409_100178368 | Ga0307409_1001783682 | 217 |
| 76 | 3300031995 | Ga0307409_100292762 | Ga0307409_1002927622 | 217 |
| 77 | 3300032004 | Ga0307414_10051633 | Ga0307414_100516333 | 217 |
| 78 | 3300032005 | Ga0307411_10023787 | Ga0307411_100237873 | 217 |
| 79 | 3300032005 | Ga0307411_10844008 | Ga0307411_108440082 | 217 |
| 80 | 3300032126 | Ga0307415_101309480 | Ga0307415_1013094801 | 217 |
| 81 | 3300037068 | Ga0373925_0195427 | Ga0373925_0195427_97_750 | 217 |
| 82 | 3300037418 | Ga0395900_0057902 | Ga0395900_0057902_1487_2140 | 217 |
| 83 | 3300037418 | Ga0395900_0105547 | Ga0395900_0105547_266_919 | 217 |
| 84 | 3300037418 | Ga0395900_0787479 | Ga0395900_0787479_109_762 | 217 |
| 85 | 3300037471 | Ga0395905_0724668 | Ga0395905_0724668_215_868 | 217 |
| 86 | 3300045976 | Ga0466967_0224017 | Ga0466967_0224017_982_1635 | 217 |
| 87 | 2162886012 | MBSR1b_contig_8639358 | MBSR1b_0132.00004370 | 218 |
| 88 | 3300001977 | JGI24746J21847_1004600 | JGI24746J21847_10046002 | 218 |
| 89 | 3300002076 | JGI24749J21850_1000139 | JGI24749J21850_10001397 | 218 |
| 90 | 3300002077 | JGI24744J21845_10000804 | JGI24744J21845_100008042 | 218 |
| 91 | 3300003323 | rootH1_10081980 | rootH1_100819803 | 218 |
| 92 | 3300005293 | Ga0065715_10000357 | Ga0065715_100003575 | 218 |
| 93 | 3300005328 | Ga0070676_10009377 | Ga0070676_100093775 | 218 |
| 94 | 3300005328 | Ga0070676_10115493 | Ga0070676_101154932 | 218 |
| 95 | 3300005330 | Ga0070690_100395563 | Ga0070690_1003955631 | 218 |
| 96 | 3300005331 | Ga0070670_100005336 | Ga0070670_1000053367 | 218 |
| 97 | 3300005331 | Ga0070670_100099980 | Ga0070670_1000999802 | 218 |
| 98 | 3300005333 | Ga0070677_10000652 | Ga0070677_100006526 | 218 |
| 99 | 3300005335 | Ga0070666_10000205 | Ga0070666_1000020527 | 218 |
| 100 | 3300005339 | Ga0070660_100135634 | Ga0070660_1001356342 | 218 |
| 101 | 3300005340 | Ga0070689_100104808 | Ga0070689_1001048082 | 218 |
| 102 | 3300005344 | Ga0070661_100319116 | Ga0070661_1003191162 | 218 |
| 103 | 3300005347 | Ga0070668_100002805 | Ga0070668_1000028055 | 218 |
| 104 | 3300005347 | Ga0070668_100019021 | Ga0070668_1000190214 | 218 |
| 105 | 3300005353 | Ga0070669_100001859 | Ga0070669_10000185914 | 218 |
| 106 | 3300005354 | Ga0070675_100001753 | Ga0070675_1000017535 | 218 |
| 107 | 3300005355 | Ga0070671_100004029 | Ga0070671_10000402910 | 218 |
| 108 | 3300005355 | Ga0070671_100037229 | Ga0070671_1000372293 | 218 |
| 109 | 3300005355 | Ga0070671_100063722 | Ga0070671_1000637223 | 218 |
| 110 | 3300005355 | Ga0070671_100301440 | Ga0070671_1003014402 | 218 |
| 111 | 3300005356 | Ga0070674_100012769 | Ga0070674_1000127695 | 218 |
| 112 | 3300005356 | Ga0070674_100048840 | Ga0070674_1000488402 | 218 |
| 113 | 3300005364 | Ga0070673_100010076 | Ga0070673_1000100765 | 218 |
| 114 | 3300005365 | Ga0070688_100689339 | Ga0070688_1006893391 | 218 |
| 115 | 3300005366 | Ga0070659_100170682 | Ga0070659_1001706822 | 218 |
| 116 | 3300005367 | Ga0070667_100003025 | Ga0070667_1000030255 | 218 |
| 117 | 3300005367 | Ga0070667_100007182 | Ga0070667_10000718210 | 218 |
| 118 | 3300005367 | Ga0070667_100035574 | Ga0070667_1000355742 | 218 |
| 119 | 3300005434 | Ga0070709_10006547 | Ga0070709_100065474 | 218 |
| 120 | 3300005436 | Ga0070713_100221731 | Ga0070713_1002217312 | 218 |
| 121 | 3300005441 | Ga0070700_100202180 | Ga0070700_1002021802 | 218 |
| 122 | 3300005455 | Ga0070663_100058093 | Ga0070663_1000580934 | 218 |
| 123 | 3300005455 | Ga0070663_100087863 | Ga0070663_1000878632 | 218 |
| 124 | 3300005457 | Ga0070662_100000350 | Ga0070662_10000035026 | 218 |
| 125 | 3300005458 | Ga0070681_10106071 | Ga0070681_101060712 | 218 |
| 126 | 3300005530 | Ga0070679_100230279 | Ga0070679_1002302793 | 218 |
| 127 | 3300005543 | Ga0070672_100001606 | Ga0070672_1000016065 | 218 |
| 128 | 3300005543 | Ga0070672_100182674 | Ga0070672_1001826742 | 218 |
| 129 | 3300005544 | Ga0070686_100016200 | Ga0070686_1000162003 | 218 |
| 130 | 3300005545 | Ga0070695_100079877 | Ga0070695_1000798773 | 218 |
| 131 | 3300005546 | Ga0070696_100357796 | Ga0070696_1003577962 | 218 |
| 132 | 3300005547 | Ga0070693_100088957 | Ga0070693_1000889572 | 218 |
| 133 | 3300005564 | Ga0070664_100008513 | Ga0070664_1000085135 | 218 |
| 134 | 3300005564 | Ga0070664_100042400 | Ga0070664_1000424003 | 218 |
| 135 | 3300005577 | Ga0068857_100022191 | Ga0068857_1000221916 | 218 |
| 136 | 3300005577 | Ga0068857_100113340 | Ga0068857_1001133403 | 218 |
| 137 | 3300005578 | Ga0068854_100245889 | Ga0068854_1002458892 | 218 |
| 138 | 3300005614 | Ga0068856_100288326 | Ga0068856_1002883262 | 218 |
| 139 | 3300005616 | Ga0068852_100146819 | Ga0068852_1001468192 | 218 |
| 140 | 3300005616 | Ga0068852_100153905 | Ga0068852_1001539052 | 218 |
| 141 | 3300005616 | Ga0068852_100533963 | Ga0068852_1005339632 | 218 |
| 142 | 3300005617 | Ga0068859_100010015 | Ga0068859_1000100157 | 218 |
| 143 | 3300005617 | Ga0068859_100066062 | Ga0068859_1000660624 | 218 |
| 144 | 3300005617 | Ga0068859_100102714 | Ga0068859_1001027143 | 218 |
| 145 | 3300005618 | Ga0068864_100004984 | Ga0068864_1000049848 | 218 |
| 146 | 3300005618 | Ga0068864_100023725 | Ga0068864_1000237255 | 218 |
| 147 | 3300005718 | Ga0068866_10216673 | Ga0068866_102166732 | 218 |
| 148 | 3300005719 | Ga0068861_100015774 | Ga0068861_1000157744 | 218 |
| 149 | 3300005834 | Ga0068851_10022273 | Ga0068851_100222733 | 218 |
| 150 | 3300005841 | Ga0068863_100010334 | Ga0068863_1000103349 | 218 |
| 151 | 3300005841 | Ga0068863_100160431 | Ga0068863_1001604313 | 218 |
| 152 | 3300005841 | Ga0068863_100594381 | Ga0068863_1005943811 | 218 |
| 153 | 3300005842 | Ga0068858_100000980 | Ga0068858_10000098011 | 218 |
| 154 | 3300005842 | Ga0068858_100050243 | Ga0068858_1000502432 | 218 |
| 155 | 3300005843 | Ga0068860_100048457 | Ga0068860_1000484572 | 218 |
| 156 | 3300005843 | Ga0068860_100048726 | Ga0068860_1000487262 | 218 |
| 157 | 3300005843 | Ga0068860_100094960 | Ga0068860_1000949603 | 218 |
| 158 | 3300005844 | Ga0068862_100003962 | Ga0068862_10000396212 | 218 |
| 159 | 3300006028 | Ga0070717_10030870 | Ga0070717_100308707 | 218 |
| 160 | 3300006237 | Ga0097621_100071566 | Ga0097621_1000715664 | 218 |
| 161 | 3300006358 | Ga0068871_100024780 | Ga0068871_1000247804 | 218 |
| 162 | 3300006881 | Ga0068865_100009912 | Ga0068865_1000099124 | 218 |
| 163 | 3300006931 | Ga0097620_100010015 | Ga0097620_1000100157 | 218 |
| 164 | 3300006931 | Ga0097620_100066061 | Ga0097620_1000660614 | 218 |
| 165 | 3300006931 | Ga0097620_100102711 | Ga0097620_1001027112 | 218 |
| 166 | 3300009011 | Ga0105251_10014665 | Ga0105251_100146653 | 218 |
| 167 | 3300009098 | Ga0105245_10039260 | Ga0105245_100392602 | 218 |
| 168 | 3300009101 | Ga0105247_10129964 | Ga0105247_101299642 | 218 |
| 169 | 3300009148 | Ga0105243_10122479 | Ga0105243_101224792 | 218 |
| 170 | 3300009174 | Ga0105241_10185906 | Ga0105241_101859063 | 218 |
| 171 | 3300009177 | Ga0105248_10000390 | Ga0105248_1000039035 | 218 |
| 172 | 3300009177 | Ga0105248_10043821 | Ga0105248_100438214 | 218 |
| 173 | 3300009545 | Ga0105237_10105840 | Ga0105237_101058402 | 218 |
| 174 | 3300009553 | Ga0105249_10009551 | Ga0105249_100095516 | 218 |
| 175 | 3300012512 | Ga0157327_1001364 | Ga0157327_10013642 | 218 |
| 176 | 3300013100 | Ga0157373_10002479 | Ga0157373_100024795 | 218 |
| 177 | 3300013102 | Ga0157371_10169787 | Ga0157371_101697872 | 218 |
| 178 | 3300013296 | Ga0157374_10300387 | Ga0157374_103003872 | 218 |
| 179 | 3300013307 | Ga0157372_10371958 | Ga0157372_103719582 | 218 |
| 180 | 3300013308 | Ga0157375_10332997 | Ga0157375_103329972 | 218 |
| 181 | 3300014325 | Ga0163163_10020654 | Ga0163163_100206544 | 218 |
| 182 | 3300014326 | Ga0157380_10001142 | Ga0157380_100011427 | 218 |
| 183 | 3300014326 | Ga0157380_10003382 | Ga0157380_100033829 | 218 |
| 184 | 3300014497 | Ga0182008_10022462 | Ga0182008_100224622 | 218 |
| 185 | 3300014968 | Ga0157379_10008156 | Ga0157379_1000815610 | 218 |
| 186 | 3300014968 | Ga0157379_10042362 | Ga0157379_100423622 | 218 |
| 187 | 3300025315 | Ga0207697_10000333 | Ga0207697_1000033321 | 218 |
| 188 | 3300025893 | Ga0207682_10001225 | Ga0207682_100012259 | 218 |
| 189 | 3300025899 | Ga0207642_10069218 | Ga0207642_100692182 | 218 |
| 190 | 3300025901 | Ga0207688_10004324 | Ga0207688_100043247 | 218 |
| 191 | 3300025901 | Ga0207688_10007318 | Ga0207688_100073182 | 218 |
| 192 | 3300025904 | Ga0207647_10003326 | Ga0207647_100033264 | 218 |
| 193 | 3300025906 | Ga0207699_10099992 | Ga0207699_100999922 | 218 |
| 194 | 3300025907 | Ga0207645_10004731 | Ga0207645_100047314 | 218 |
| 195 | 3300025907 | Ga0207645_10047397 | Ga0207645_100473973 | 218 |
| 196 | 3300025907 | Ga0207645_10206240 | Ga0207645_102062402 | 218 |
| 197 | 3300025907 | Ga0207645_10319660 | Ga0207645_103196602 | 218 |
| 198 | 3300025915 | Ga0207693_10039708 | Ga0207693_100397082 | 218 |
| 199 | 3300025919 | Ga0207657_10137282 | Ga0207657_101372822 | 218 |
| 200 | 3300025919 | Ga0207657_10173734 | Ga0207657_101737342 | 218 |
| 201 | 3300025919 | Ga0207657_10487546 | Ga0207657_104875462 | 218 |
| 202 | 3300025921 | Ga0207652_10149079 | Ga0207652_101490792 | 218 |
| 203 | 3300025923 | Ga0207681_10002252 | Ga0207681_100022525 | 218 |
| 204 | 3300025925 | Ga0207650_10001160 | Ga0207650_1000116014 | 218 |
| 205 | 3300025926 | Ga0207659_10003531 | Ga0207659_100035316 | 218 |
| 206 | 3300025926 | Ga0207659_10201143 | Ga0207659_102011432 | 218 |
| 207 | 3300025927 | Ga0207687_10020163 | Ga0207687_100201632 | 218 |
| 208 | 3300025928 | Ga0207700_10063065 | Ga0207700_100630652 | 218 |
| 209 | 3300025931 | Ga0207644_10027342 | Ga0207644_100273423 | 218 |
| 210 | 3300025931 | Ga0207644_10136582 | Ga0207644_101365822 | 218 |
| 211 | 3300025933 | Ga0207706_10000222 | Ga0207706_1000022232 | 218 |
| 212 | 3300025933 | Ga0207706_10000276 | Ga0207706_1000027643 | 218 |
| 213 | 3300025933 | Ga0207706_10205867 | Ga0207706_102058672 | 218 |
| 214 | 3300025935 | Ga0207709_10080175 | Ga0207709_100801753 | 218 |
| 215 | 3300025936 | Ga0207670_10217808 | Ga0207670_102178082 | 218 |
| 216 | 3300025937 | Ga0207669_10005678 | Ga0207669_100056784 | 218 |
| 217 | 3300025937 | Ga0207669_10076531 | Ga0207669_100765312 | 218 |
| 218 | 3300025938 | Ga0207704_10026790 | Ga0207704_100267904 | 218 |
| 219 | 3300025940 | Ga0207691_10002789 | Ga0207691_1000278910 | 218 |
| 220 | 3300025940 | Ga0207691_10359544 | Ga0207691_103595442 | 218 |
| 221 | 3300025941 | Ga0207711_10000190 | Ga0207711_1000019068 | 218 |
| 222 | 3300025942 | Ga0207689_10229998 | Ga0207689_102299982 | 218 |
| 223 | 3300025945 | Ga0207679_10015858 | Ga0207679_100158583 | 218 |
| 224 | 3300025949 | Ga0207667_10018949 | Ga0207667_100189495 | 218 |
| 225 | 3300025960 | Ga0207651_10001768 | Ga0207651_100017684 | 218 |
| 226 | 3300025960 | Ga0207651_10037268 | Ga0207651_100372685 | 218 |
| 227 | 3300025972 | Ga0207668_10000847 | Ga0207668_1000084714 | 218 |
| 228 | 3300025972 | Ga0207668_10034584 | Ga0207668_100345844 | 218 |
| 229 | 3300025981 | Ga0207640_10002375 | Ga0207640_100023753 | 218 |
| 230 | 3300025981 | Ga0207640_10349126 | Ga0207640_103491262 | 218 |
| 231 | 3300025981 | Ga0207640_10934050 | Ga0207640_109340501 | 218 |
| 232 | 3300025986 | Ga0207658_10020587 | Ga0207658_100205872 | 218 |
| 233 | 3300025986 | Ga0207658_10064044 | Ga0207658_100640444 | 218 |
| 234 | 3300026023 | Ga0207677_10005685 | Ga0207677_100056858 | 218 |
| 235 | 3300026023 | Ga0207677_10006502 | Ga0207677_100065024 | 218 |
| 236 | 3300026035 | Ga0207703_10000461 | Ga0207703_1000046137 | 218 |
| 237 | 3300026035 | Ga0207703_10199251 | Ga0207703_101992512 | 218 |
| 238 | 3300026067 | Ga0207678_10033320 | Ga0207678_100333204 | 218 |
| 239 | 3300026088 | Ga0207641_10142526 | Ga0207641_101425263 | 218 |
| 240 | 3300026088 | Ga0207641_10483614 | Ga0207641_104836142 | 218 |
| 241 | 3300026095 | Ga0207676_10076072 | Ga0207676_100760723 | 218 |
| 242 | 3300026116 | Ga0207674_10049277 | Ga0207674_100492773 | 218 |
| 243 | 3300026118 | Ga0207675_100059132 | Ga0207675_1000591322 | 218 |
| 244 | 3300026121 | Ga0207683_10020656 | Ga0207683_100206566 | 218 |
| 245 | 3300026121 | Ga0207683_10036783 | Ga0207683_100367837 | 218 |
| 246 | 3300026121 | Ga0207683_10585811 | Ga0207683_105858112 | 218 |
| 247 | 3300028380 | Ga0268265_10003443 | Ga0268265_100034434 | 218 |
| 248 | 3300028381 | Ga0268264_10062212 | Ga0268264_100622123 | 218 |
| 249 | 3300028381 | Ga0268264_10091518 | Ga0268264_100915182 | 218 |
| 250 | 3300028381 | Ga0268264_10200502 | Ga0268264_102005021 | 218 |
| 251 | 3300028381 | Ga0268264_10397855 | Ga0268264_103978552 | 218 |
| 252 | 3300031548 | Ga0307408_100015711 | Ga0307408_1000157112 | 218 |
| 253 | 3300031548 | Ga0307408_100221109 | Ga0307408_1002211092 | 218 |
| 254 | 3300031548 | Ga0307408_100472466 | Ga0307408_1004724662 | 218 |
| 255 | 3300031731 | Ga0307405_10004439 | Ga0307405_100044395 | 218 |
| 256 | 3300031731 | Ga0307405_10426186 | Ga0307405_104261862 | 218 |
| 257 | 3300031824 | Ga0307413_10001834 | Ga0307413_100018348 | 218 |
| 258 | 3300031824 | Ga0307413_10043560 | Ga0307413_100435602 | 218 |
| 259 | 3300031824 | Ga0307413_10055490 | Ga0307413_100554903 | 218 |
| 260 | 3300031824 | Ga0307413_10096870 | Ga0307413_100968702 | 218 |
| 261 | 3300031824 | Ga0307413_10178672 | Ga0307413_101786722 | 218 |
| 262 | 3300031824 | Ga0307413_10845450 | Ga0307413_108454501 | 218 |
| 263 | 3300031852 | Ga0307410_10001310 | Ga0307410_100013106 | 218 |
| 264 | 3300031852 | Ga0307410_10305979 | Ga0307410_103059791 | 218 |
| 265 | 3300031852 | Ga0307410_10565863 | Ga0307410_105658632 | 218 |
| 266 | 3300031901 | Ga0307406_10005756 | Ga0307406_100057565 | 218 |
| 267 | 3300031901 | Ga0307406_10635031 | Ga0307406_106350312 | 218 |
| 268 | 3300031903 | Ga0307407_10000602 | Ga0307407_1000060210 | 218 |
| 269 | 3300031903 | Ga0307407_10044681 | Ga0307407_100446812 | 218 |
| 270 | 3300031903 | Ga0307407_10294907 | Ga0307407_102949072 | 218 |
| 271 | 3300031903 | Ga0307407_10321201 | Ga0307407_103212011 | 218 |
| 272 | 3300031911 | Ga0307412_10017200 | Ga0307412_100172005 | 218 |
| 273 | 3300031995 | Ga0307409_100008476 | Ga0307409_1000084763 | 218 |
| 274 | 3300031995 | Ga0307409_100015114 | Ga0307409_1000151145 | 218 |
| 275 | 3300031995 | Ga0307409_100088970 | Ga0307409_1000889703 | 218 |
| 276 | 3300031995 | Ga0307409_100100363 | Ga0307409_1001003632 | 218 |
| 277 | 3300031995 | Ga0307409_100322172 | Ga0307409_1003221722 | 218 |
| 278 | 3300031995 | Ga0307409_100351212 | Ga0307409_1003512122 | 218 |
| 279 | 3300031995 | Ga0307409_100707401 | Ga0307409_1007074012 | 218 |
| 280 | 3300032002 | Ga0307416_100012428 | Ga0307416_1000124283 | 218 |
| 281 | 3300032002 | Ga0307416_100059842 | Ga0307416_1000598423 | 218 |
| 282 | 3300032002 | Ga0307416_100158873 | Ga0307416_1001588733 | 218 |
| 283 | 3300032002 | Ga0307416_100177788 | Ga0307416_1001777882 | 218 |
| 284 | 3300032002 | Ga0307416_100202874 | Ga0307416_1002028742 | 218 |
| 285 | 3300032002 | Ga0307416_100222842 | Ga0307416_1002228423 | 218 |
| 286 | 3300032002 | Ga0307416_100317873 | Ga0307416_1003178732 | 218 |
| 287 | 3300032004 | Ga0307414_10005495 | Ga0307414_100054956 | 218 |
| 288 | 3300032004 | Ga0307414_10056434 | Ga0307414_100564343 | 218 |
| 289 | 3300032004 | Ga0307414_10262253 | Ga0307414_102622532 | 218 |
| 290 | 3300032004 | Ga0307414_10479058 | Ga0307414_104790582 | 218 |
| 291 | 3300032005 | Ga0307411_10006465 | Ga0307411_100064652 | 218 |
| 292 | 3300032005 | Ga0307411_10014729 | Ga0307411_100147295 | 218 |
| 293 | 3300032005 | Ga0307411_10026761 | Ga0307411_100267612 | 218 |
| 294 | 3300032005 | Ga0307411_10137644 | Ga0307411_101376442 | 218 |
| 295 | 3300032005 | Ga0307411_10153925 | Ga0307411_101539251 | 218 |
| 296 | 3300032005 | Ga0307411_10188786 | Ga0307411_101887863 | 218 |
| 297 | 3300032005 | Ga0307411_10299233 | Ga0307411_102992332 | 218 |
| 298 | 3300032126 | Ga0307415_100009831 | Ga0307415_1000098313 | 218 |
| 299 | 3300032126 | Ga0307415_100382600 | Ga0307415_1003826002 | 218 |
| 300 | 3300035090 | Ga0373949_0068831 | Ga0373949_0068831_158_814 | 218 |
| 301 | 3300037312 | Ga0395899_0008289 | Ga0395899_0008289_1432_2202 | 218 |
| 302 | 3300037312 | Ga0395899_0010294 | Ga0395899_0010294_4921_5577 | 218 |
| 303 | 3300037418 | Ga0395900_0028200 | Ga0395900_0028200_59_715 | 218 |
| 304 | 3300037466 | Ga0395898_0821100 | Ga0395898_0821100_89_745 | 218 |
| 305 | 3300037471 | Ga0395905_0000541 | Ga0395905_0000541_11889_12545 | 218 |
| 306 | 3300037471 | Ga0395905_0661419 | Ga0395905_0661419_14_811 | 218 |
| 307 | 3300038443 | Ga0395901_0002184 | Ga0395901_0002184_14922_15578 | 218 |
| 308 | 3300038443 | Ga0395901_0032170 | Ga0395901_0032170_4466_5236 | 218 |
| 309 | 3300042004 | Ga0439445_0000370 | Ga0439445_0000370_2340_2996 | 218 |
| 310 | 3300044656 | Ga0466969_0020689 | Ga0466969_0020689_1841_2611 | 218 |
| 311 | 3300044684 | Ga0466966_0031208 | Ga0466966_0031208_2429_3199 | 218 |
| 312 | 3300044694 | Ga0466963_0014720 | Ga0466963_0014720_2165_2935 | 218 |
| 313 | 3300044694 | Ga0466963_0296905 | Ga0466963_0296905_392_1051 | 218 |
| 314 | 3300044719 | Ga0466971_0069194 | Ga0466971_0069194_540_1310 | 218 |
| 315 | 3300044765 | Ga0466970_0001624 | Ga0466970_0001624_175_945 | 218 |
| 316 | 3300044842 | Ga0466957_0068187 | Ga0466957_0068187_1323_2093 | 218 |
| 317 | 3300045049 | Ga0466959_0139473 | Ga0466959_0139473_655_1425 | 218 |
| 318 | 3300045836 | Ga0466958_0000786 | Ga0466958_0000786_8407_9177 | 218 |
| 319 | 3300046507 | Ga0495606_0208478 | Ga0495606_0208478_387_1064 | 218 |
| 320 | 3300046515 | Ga0495620_0045216 | Ga0495620_0045216_145_822 | 218 |
| 321 | 3300046525 | Ga0495663_0010118 | Ga0495663_0010118_1878_2534 | 218 |
| 322 | 3300046525 | Ga0495663_0018913 | Ga0495663_0018913_1176_1832 | 218 |
| 323 | 3300046525 | Ga0495663_0090608 | Ga0495663_0090608_24_680 | 218 |
| 324 | 3300046528 | Ga0495642_0044415 | Ga0495642_0044415_418_1074 | 218 |
| 325 | 3300046539 | Ga0495621_0091748 | Ga0495621_0091748_195_851 | 218 |
| 326 | 3300046558 | Ga0495633_0021453 | Ga0495633_0021453_145_801 | 218 |
| 327 | 3300046664 | Ga0495659_0013125 | Ga0495659_0013125_2020_2676 | 218 |
| 328 | 3300046664 | Ga0495659_0016855 | Ga0495659_0016855_1114_1770 | 218 |
| 329 | 3300046684 | Ga0495669_0011154 | Ga0495669_0011154_2754_3410 | 218 |
| 330 | 3300046684 | Ga0495669_0127738 | Ga0495669_0127738_515_1171 | 218 |
| 331 | 3300046691 | Ga0495670_0012219 | Ga0495670_0012219_1282_1938 | 218 |
| 332 | 3300046691 | Ga0495670_0028244 | Ga0495670_0028244_1288_1944 | 218 |
| 333 | 3300047445 | Ga0495677_0018721 | Ga0495677_0018721_1501_2157 | 218 |
| 334 | 3300047445 | Ga0495677_0089873 | Ga0495677_0089873_476_1132 | 218 |
| 335 | 3300047445 | Ga0495677_0137041 | Ga0495677_0137041_117_773 | 218 |
| 336 | 3300048906 | Ga0496103_0161129 | Ga0496103_0161129_423_1079 | 218 |
| 337 | 3300048909 | Ga0496106_0487668 | Ga0496106_0487668_197_853 | 218 |
| 338 | 3300048910 | Ga0496107_0266409 | Ga0496107_0266409_186_842 | 218 |
| 339 | 3300048912 | Ga0496109_0018675 | Ga0496109_0018675_279_935 | 218 |
| 340 | 3300048917 | Ga0496114_0000016 | Ga0496114_0000016_109856_110512 | 218 |
| 341 | 3300049765 | Ga0501268_002988 | Ga0501268_002988_1609_2265 | 218 |
| 342 | 3300050510 | nmdc:mga06r32_126452_c1 | nmdc:mga06r32_126452_c1_361_1017 | 218 |
| 343 | 3300061719 | Ga0466962_0004150 | Ga0466962_0004150_2103_2873 | 218 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3r79-assembly3.cif.gz_A-2 | crystal structure of an uncharactertized protein from agrobacterium tumefaciens | 0.981 | 2 | 216 |
| 3r79-assembly3.cif.gz_B | crystal structure of an uncharactertized protein from agrobacterium tumefaciens | 0.9792 | 3 | 218 |
| 3r79-assembly3.cif.gz_A-2 | crystal structure of an uncharactertized protein from agrobacterium tumefaciens | 0.9633 | 2 | 216 |
| 3r79-assembly3.cif.gz_B | crystal structure of an uncharactertized protein from agrobacterium tumefaciens | 0.9571 | 3 | 218 |
| 7uau-assembly1.cif.gz_A | the crystal structure of the k137a mutant of e. coli yggs in complex with plp | 0.9371 | 5 | 218 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3r79B00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Alanine racemase | 0.9725 | 3 | 218 | 3.20.20.10 |
| af_Q9Z2Y8_11_258_3.20.20.10 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Alanine racemase | 0.9378 | 2 | 218 | 3.20.20.10 |
| af_P9WFQ7_2_257_3.20.20.10 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Alanine racemase | 0.9327 | 3 | 218 | 3.20.20.10 |
| af_B9EWG6_2_244_3.20.20.10 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Alanine racemase | 0.9319 | 2 | 218 | 3.20.20.10 |
| af_Q9Z2Y8_11_258_3.20.20.10 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Alanine racemase | 0.9296 | 2 | 218 | 3.20.20.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A529LS87-F1-model_v4 | YggS family pyridoxal phosphate-dependent enzyme | 0.9967 | 32 | 130 |
GO:0030170
|
| AF-A0A7H0GB16-F1-model_v4 | deleted | 0.9945 | 2 | 218 |
|
| AF-A0A1H7ASL7-F1-model_v4 | Pyridoxal phosphate homeostasis protein (PLP homeostasis protein) | 0.9941 | 2 | 218 |
GO:0030170
|
| AF-A0A1S1H9R3-F1-model_v4 | Pyridoxal phosphate homeostasis protein (PLP homeostasis protein) | 0.9934 | 7 | 218 |
GO:0030170
|
| AF-D8NHC9-F1-model_v4 | deleted | 0.9925 | 8 | 104 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar