F415644

General Info

Members Datasets Scaffolds Average Seq Length
343 176 343 220

Family's Representative Sequence

Representative Sequence 3300031852|Ga0307410_10088503|Ga0307410_100885032
Length 213
Sequence MAGADARLAFVRERIARACDLARRDPAEVQIIAVSKGRTADHIEPLIAAGQRDFGESRVQEAAAKWPDLRERYPDLGLHMIGRLQSNKAAQAATLFDSIHSLDRASLLDALAEAQSPPCFVQVNIGDEPQKGGVAVDQLGAFLERMRATQVPLAGLMAIPPDAYEAAPFFALLNELARRHDVKGLSMGMSADYPEAVMLGATVVRVGTALFED

Samples

Sample ID Description Type Environment
1 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
2 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
3 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
4 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
5 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
6 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
27 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
28 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
29 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
30 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
36 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
37 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
38 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
39 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
40 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
41 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
42 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
43 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
44 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
45 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
46 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
47 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
48 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
49 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
50 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
51 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
52 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
53 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
54 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
55 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
56 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
58 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
59 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
61 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
62 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
63 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
64 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
65 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
66 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
67 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
68 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
69 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
70 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
71 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
72 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
73 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
74 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
75 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
76 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
77 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
78 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
79 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
80 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
81 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
82 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
131 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
132 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
133 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
134 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
135 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
136 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
137 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
138 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
139 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
140 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
141 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
142 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
143 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
144 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
145 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
146 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
147 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
148 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
149 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
150 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
151 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
152 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
153 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
154 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
155 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
156 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
157 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
158 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
159 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
160 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
161 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
162 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
163 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
164 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
165 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
166 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
167 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
168 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
169 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
170 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
171 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
172 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
173 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
174 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
175 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
176 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.46
Rhizosphere 97.96
Stem 0
Stem Tuber 0
Unclassified 0.58

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MBSR1b_contig_8639358 2162886012 Bacteria 3036
2 JGI24736J21556_1001329 3300001904 Bacteria 4519
3 JGI24746J21847_1004600 3300001977 Bacteria 2173
4 JGI24749J21850_1000139 3300002076 Bacteria 11813
5 JGI24744J21845_10000804 3300002077 Bacteria 5894
6 rootH1_10038125 3300003323 Bacteria 3893
7 rootH1_10081980 3300003323 Bacteria 2329
8 Ga0065715_10000357 3300005293 Bacteria 14467
9 Ga0070658_10462901 3300005327 Bacteria 1093
10 Ga0070676_10009377 3300005328 Bacteria 5290
11 Ga0070676_10115493 3300005328 Bacteria 1677
12 Ga0070690_100395563 3300005330 Bacteria 1014
13 Ga0070670_100005336 3300005331 Bacteria 10836
14 Ga0070670_100099980 3300005331 Bacteria 2496
15 Ga0070677_10000652 3300005333 Bacteria 11602
16 Ga0070666_10000205 3300005335 Bacteria 40586
17 Ga0070660_100011183 3300005339 Bacteria 6369
18 Ga0070660_100135634 3300005339 Bacteria 1972
19 Ga0070660_100420104 3300005339 Bacteria 1107
20 Ga0070689_100104808 3300005340 Bacteria 2242
21 Ga0070661_100004478 3300005344 Bacteria 9635
22 Ga0070661_100319116 3300005344 Bacteria 1213
23 Ga0070668_100002805 3300005347 Bacteria 12821
24 Ga0070668_100006099 3300005347 Bacteria 8938
25 Ga0070668_100019021 3300005347 Bacteria 5163
26 Ga0070669_100001859 3300005353 Bacteria 15190
27 Ga0070675_100001753 3300005354 Bacteria 16008
28 Ga0070675_100289504 3300005354 Unclassified 1441
29 Ga0070671_100004029 3300005355 Bacteria 11578
30 Ga0070671_100037229 3300005355 Bacteria 4034
31 Ga0070671_100063722 3300005355 Bacteria 3070
32 Ga0070671_100301440 3300005355 Bacteria 1364
33 Ga0070674_100012769 3300005356 Bacteria 5168
34 Ga0070674_100048840 3300005356 Bacteria 2906
35 Ga0070673_100010076 3300005364 Bacteria 6379
36 Ga0070688_100689339 3300005365 Bacteria 790
37 Ga0070659_100102083 3300005366 Bacteria 2309
38 Ga0070659_100170682 3300005366 Bacteria 1781
39 Ga0070667_100003025 3300005367 Bacteria 14454
40 Ga0070667_100007182 3300005367 Bacteria 9256
41 Ga0070667_100035574 3300005367 Bacteria 4173
42 Ga0070709_10006547 3300005434 Bacteria 6352
43 Ga0070714_100055350 3300005435 Bacteria 3390
44 Ga0070713_100221731 3300005436 Bacteria 1715
45 Ga0070700_100202180 3300005441 Bacteria 1396
46 Ga0070663_100007296 3300005455 Bacteria 6720
47 Ga0070663_100058093 3300005455 Bacteria 2777
48 Ga0070663_100087863 3300005455 Bacteria 2298
49 Ga0070662_100000350 3300005457 Bacteria 27678
50 Ga0070681_10106071 3300005458 Bacteria 2751
51 Ga0070679_100230279 3300005530 Bacteria 1812
52 Ga0068853_100041433 3300005539 Bacteria 3933
53 Ga0068853_100108704 3300005539 Bacteria 2460
54 Ga0070672_100001606 3300005543 Bacteria 14037
55 Ga0070672_100182674 3300005543 Bacteria 1748
56 Ga0070686_100016200 3300005544 Bacteria 4333
57 Ga0070695_100079877 3300005545 Bacteria 2160
58 Ga0070696_100357796 3300005546 Bacteria 1132
59 Ga0070693_100088957 3300005547 Bacteria 1858
60 Ga0068855_100140154 3300005563 Bacteria 2757
61 Ga0070664_100008513 3300005564 Bacteria 8294
62 Ga0070664_100042400 3300005564 Bacteria 3842
63 Ga0068857_100022191 3300005577 Bacteria 5584
64 Ga0068857_100053090 3300005577 Bacteria 3596
65 Ga0068857_100113340 3300005577 Bacteria 2438
66 Ga0068857_100622718 3300005577 Bacteria 1021
67 Ga0068854_100004556 3300005578 Bacteria 8737
68 Ga0068854_100067851 3300005578 Bacteria 2599
69 Ga0068854_100245889 3300005578 Bacteria 1426
70 Ga0068856_100288326 3300005614 Bacteria 1658
71 Ga0068856_100336570 3300005614 Bacteria 1527
72 Ga0068852_100021784 3300005616 Bacteria 5126
73 Ga0068852_100034064 3300005616 Bacteria 4236
74 Ga0068852_100146819 3300005616 Bacteria 2188
75 Ga0068852_100153905 3300005616 Bacteria 2140
76 Ga0068852_100533963 3300005616 Bacteria 1172
77 Ga0068859_100010015 3300005617 Bacteria 9561
78 Ga0068859_100066062 3300005617 Bacteria 3652
79 Ga0068859_100102714 3300005617 Bacteria 2916
80 Ga0068864_100004984 3300005618 Bacteria 10880
81 Ga0068864_100023725 3300005618 Bacteria 5154
82 Ga0068866_10216673 3300005718 Bacteria 1152
83 Ga0068861_100015774 3300005719 Bacteria 5333
84 Ga0068851_10022273 3300005834 Bacteria 3084
85 Ga0068851_10079360 3300005834 Bacteria 1712
86 Ga0068863_100010334 3300005841 Bacteria 9067
87 Ga0068863_100160431 3300005841 Bacteria 2154
88 Ga0068863_100594381 3300005841 Bacteria 1095
89 Ga0068858_100000980 3300005842 Bacteria 29457
90 Ga0068858_100050243 3300005842 Bacteria 3859
91 Ga0068860_100048457 3300005843 Bacteria 4050
92 Ga0068860_100048726 3300005843 Bacteria 4037
93 Ga0068860_100094960 3300005843 Bacteria 2842
94 Ga0068860_100146173 3300005843 Bacteria 2275
95 Ga0068862_100003962 3300005844 Bacteria 12579
96 Ga0068862_100058074 3300005844 Bacteria 3319
97 Ga0068862_100921711 3300005844 Bacteria 860
98 Ga0070717_10030870 3300006028 Bacteria 4306
99 Ga0097621_100071566 3300006237 Bacteria 2866
100 Ga0068871_100024780 3300006358 Bacteria 4657
101 Ga0068865_100009912 3300006881 Bacteria 5920
102 Ga0097620_100010015 3300006931 Bacteria 9561
103 Ga0097620_100066061 3300006931 Bacteria 3652
104 Ga0097620_100102711 3300006931 Bacteria 2916
105 Ga0105251_10014665 3300009011 Bacteria 4321
106 Ga0105240_10054442 3300009093 Bacteria 5014
107 Ga0105240_10065302 3300009093 Bacteria 4518
108 Ga0105240_10658506 3300009093 Bacteria 1147
109 Ga0105245_10039260 3300009098 Bacteria 4214
110 Ga0105247_10129964 3300009101 Bacteria 1641
111 Ga0105243_10122479 3300009148 Bacteria 2195
112 Ga0105241_10185906 3300009174 Bacteria 1727
113 Ga0105248_10000390 3300009177 Bacteria 50573
114 Ga0105248_10043821 3300009177 Bacteria 5018
115 Ga0105237_10105840 3300009545 Bacteria 2804
116 Ga0105238_10029121 3300009551 Bacteria 5626
117 Ga0105249_10009551 3300009553 Bacteria 8499
118 Ga0105249_10050376 3300009553 Bacteria 3796
119 Ga0157327_1001364 3300012512 Bacteria 1516
120 Ga0157373_10002479 3300013100 Bacteria 14052
121 Ga0157371_10097525 3300013102 Unclassified 2084
122 Ga0157371_10138413 3300013102 Bacteria 1734
123 Ga0157371_10169787 3300013102 Bacteria 1558
124 Ga0157371_10171895 3300013102 Bacteria 1549
125 Ga0157371_10459834 3300013102 Bacteria 936
126 Ga0157370_10262750 3300013104 Bacteria 1595
127 Ga0157369_10046293 3300013105 Bacteria 4727
128 Ga0157369_10055713 3300013105 Bacteria 4267
129 Ga0157369_10268016 3300013105 Bacteria 1780
130 Ga0157374_10300387 3300013296 Bacteria 1588
131 Ga0157372_10258320 3300013307 Unclassified 2023
132 Ga0157372_10371958 3300013307 Bacteria 1665
133 Ga0157372_11375439 3300013307 Bacteria 814
134 Ga0157375_10332997 3300013308 Bacteria 1683
135 Ga0163163_10020654 3300014325 Bacteria 6206
136 Ga0157380_10001142 3300014326 Bacteria 17160
137 Ga0157380_10003382 3300014326 Bacteria 10946
138 Ga0182008_10022462 3300014497 Bacteria 3231
139 Ga0157379_10008156 3300014968 Bacteria 9096
140 Ga0157379_10042362 3300014968 Bacteria 4064
141 Ga0207697_10000333 3300025315 Bacteria 26386
142 Ga0207682_10001225 3300025893 Bacteria 11858
143 Ga0207642_10069218 3300025899 Bacteria 1673
144 Ga0207688_10004324 3300025901 Bacteria 7749
145 Ga0207688_10007318 3300025901 Bacteria 6008
146 Ga0207647_10003326 3300025904 Bacteria 12077
147 Ga0207647_10019225 3300025904 Bacteria 4598
148 Ga0207647_10026262 3300025904 Bacteria 3812
149 Ga0207699_10099992 3300025906 Bacteria 1838
150 Ga0207645_10004731 3300025907 Bacteria 10020
151 Ga0207645_10047397 3300025907 Bacteria 2744
152 Ga0207645_10206240 3300025907 Bacteria 1294
153 Ga0207645_10319660 3300025907 Bacteria 1035
154 Ga0207705_10000033 3300025909 Bacteria 223997
155 Ga0207705_10017908 3300025909 Bacteria 5066
156 Ga0207695_10009645 3300025913 Bacteria 11903
157 Ga0207695_10018686 3300025913 Bacteria 8005
158 Ga0207695_10595751 3300025913 Bacteria 986
159 Ga0207693_10039708 3300025915 Bacteria 3706
160 Ga0207657_10024543 3300025919 Bacteria 5576
161 Ga0207657_10137282 3300025919 Bacteria 2000
162 Ga0207657_10173734 3300025919 Bacteria 1745
163 Ga0207657_10487546 3300025919 Bacteria 966
164 Ga0207649_10003587 3300025920 Bacteria 8483
165 Ga0207649_10117435 3300025920 Bacteria 1788
166 Ga0207652_10149079 3300025921 Bacteria 2094
167 Ga0207681_10002252 3300025923 Bacteria 12264
168 Ga0207694_10037347 3300025924 Bacteria 3730
169 Ga0207650_10001160 3300025925 Bacteria 19345
170 Ga0207659_10003531 3300025926 Bacteria 9402
171 Ga0207659_10201143 3300025926 Bacteria 1591
172 Ga0207687_10020163 3300025927 Bacteria 4421
173 Ga0207700_10063065 3300025928 Bacteria 2817
174 Ga0207644_10027342 3300025931 Bacteria 3940
175 Ga0207644_10136582 3300025931 Bacteria 1883
176 Ga0207690_10151196 3300025932 Bacteria 1721
177 Ga0207706_10000222 3300025933 Bacteria 62279
178 Ga0207706_10000276 3300025933 Bacteria 55889
179 Ga0207706_10205867 3300025933 Bacteria 1725
180 Ga0207709_10080175 3300025935 Bacteria 2101
181 Ga0207670_10217808 3300025936 Bacteria 1460
182 Ga0207669_10005678 3300025937 Bacteria 5626
183 Ga0207669_10076531 3300025937 Bacteria 2124
184 Ga0207704_10026790 3300025938 Bacteria 3168
185 Ga0207691_10002789 3300025940 Bacteria 17030
186 Ga0207691_10359544 3300025940 Bacteria 1245
187 Ga0207711_10000190 3300025941 Bacteria 65723
188 Ga0207689_10229998 3300025942 Bacteria 1532
189 Ga0207679_10015858 3300025945 Bacteria 4993
190 Ga0207667_10018949 3300025949 Bacteria 7694
191 Ga0207651_10001768 3300025960 Bacteria 10020
192 Ga0207651_10037268 3300025960 Bacteria 3184
193 Ga0207668_10000847 3300025972 Bacteria 18448
194 Ga0207668_10034584 3300025972 Bacteria 3357
195 Ga0207640_10000473 3300025981 Bacteria 24521
196 Ga0207640_10002375 3300025981 Bacteria 10077
197 Ga0207640_10223385 3300025981 Bacteria 1444
198 Ga0207640_10349126 3300025981 Bacteria 1188
199 Ga0207640_10934050 3300025981 Unclassified 760
200 Ga0207658_10020587 3300025986 Bacteria 4567
201 Ga0207658_10064044 3300025986 Bacteria 2756
202 Ga0207677_10005685 3300026023 Bacteria 6785
203 Ga0207677_10006502 3300026023 Bacteria 6421
204 Ga0207703_10000461 3300026035 Bacteria 42797
205 Ga0207703_10199251 3300026035 Bacteria 1778
206 Ga0207639_10847317 3300026041 Bacteria 853
207 Ga0207678_10000321 3300026067 Bacteria 43233
208 Ga0207678_10033320 3300026067 Bacteria 4489
209 Ga0207678_10091006 3300026067 Bacteria 2607
210 Ga0207678_10401710 3300026067 Bacteria 1186
211 Ga0207702_10001866 3300026078 Bacteria 20690
212 Ga0207702_10032955 3300026078 Bacteria 4325
213 Ga0207641_10142526 3300026088 Bacteria 2164
214 Ga0207641_10483614 3300026088 Bacteria 1200
215 Ga0207676_10076072 3300026095 Bacteria 2711
216 Ga0207674_10049277 3300026116 Bacteria 4308
217 Ga0207674_10073579 3300026116 Bacteria 3430
218 Ga0207674_10331413 3300026116 Bacteria 1472
219 Ga0207675_100059132 3300026118 Bacteria 3577
220 Ga0207683_10020656 3300026121 Bacteria 5635
221 Ga0207683_10036783 3300026121 Bacteria 4263
222 Ga0207683_10585811 3300026121 Bacteria 1032
223 Ga0207698_10031710 3300026142 Bacteria 3819
224 Ga0207698_10154794 3300026142 Bacteria 1995
225 Ga0268265_10003443 3300028380 Bacteria 11386
226 Ga0268265_10021490 3300028380 Bacteria 4522
227 Ga0268264_10062212 3300028381 Bacteria 3134
228 Ga0268264_10091518 3300028381 Bacteria 2624
229 Ga0268264_10200502 3300028381 Bacteria 1825
230 Ga0268264_10397855 3300028381 Bacteria 1323
231 Ga0307408_100015711 3300031548 Bacteria 5043
232 Ga0307408_100221109 3300031548 Unclassified 1545
233 Ga0307408_100472466 3300031548 Bacteria 1092
234 Ga0307408_101031304 3300031548 Bacteria 760
235 Ga0307405_10004439 3300031731 Bacteria 6630
236 Ga0307405_10426186 3300031731 Bacteria 1045
237 Ga0307413_10001834 3300031824 Bacteria 8356
238 Ga0307413_10043560 3300031824 Bacteria 2646
239 Ga0307413_10055490 3300031824 Bacteria 2411
240 Ga0307413_10096870 3300031824 Bacteria 1938
241 Ga0307413_10178672 3300031824 Bacteria 1510
242 Ga0307413_10479903 3300031824 Bacteria 993
243 Ga0307413_10845450 3300031824 Bacteria 773
244 Ga0307410_10001310 3300031852 Bacteria 11113
245 Ga0307410_10088503 3300031852 Bacteria 2193
246 Ga0307410_10098017 3300031852 Bacteria 2095
247 Ga0307410_10212386 3300031852 Bacteria 1483
248 Ga0307410_10305979 3300031852 Bacteria 1256
249 Ga0307410_10565863 3300031852 Bacteria 944
250 Ga0307406_10005756 3300031901 Bacteria 6792
251 Ga0307406_10246333 3300031901 Bacteria 1344
252 Ga0307406_10635031 3300031901 Bacteria 884
253 Ga0307407_10000602 3300031903 Bacteria 11440
254 Ga0307407_10044681 3300031903 Bacteria 2499
255 Ga0307407_10118260 3300031903 Bacteria 1675
256 Ga0307407_10294907 3300031903 Bacteria 1128
257 Ga0307407_10321201 3300031903 Bacteria 1086
258 Ga0307412_10017200 3300031911 Bacteria 4325
259 Ga0307412_10066202 3300031911 Bacteria 2448
260 Ga0307409_100008476 3300031995 Bacteria 6243
261 Ga0307409_100015114 3300031995 Bacteria 5050
262 Ga0307409_100088970 3300031995 Bacteria 2522
263 Ga0307409_100100363 3300031995 Bacteria 2399
264 Ga0307409_100101375 3300031995 Bacteria 2389
265 Ga0307409_100178368 3300031995 Bacteria 1877
266 Ga0307409_100292762 3300031995 Bacteria 1510
267 Ga0307409_100322172 3300031995 Bacteria 1447
268 Ga0307409_100351212 3300031995 Bacteria 1391
269 Ga0307409_100707401 3300031995 Bacteria 1007
270 Ga0307416_100012428 3300032002 Bacteria 5737
271 Ga0307416_100059842 3300032002 Bacteria 3098
272 Ga0307416_100158873 3300032002 Bacteria 2086
273 Ga0307416_100177788 3300032002 Bacteria 1991
274 Ga0307416_100202874 3300032002 Bacteria 1883
275 Ga0307416_100222842 3300032002 Bacteria 1810
276 Ga0307416_100317873 3300032002 Bacteria 1557
277 Ga0307414_10005495 3300032004 Bacteria 6984
278 Ga0307414_10051633 3300032004 Bacteria 2855
279 Ga0307414_10056434 3300032004 Bacteria 2755
280 Ga0307414_10262253 3300032004 Bacteria 1442
281 Ga0307414_10479058 3300032004 Bacteria 1097
282 Ga0307411_10006465 3300032005 Bacteria 5868
283 Ga0307411_10014729 3300032005 Bacteria 4363
284 Ga0307411_10023787 3300032005 Bacteria 3637
285 Ga0307411_10026761 3300032005 Bacteria 3477
286 Ga0307411_10137644 3300032005 Bacteria 1795
287 Ga0307411_10153925 3300032005 Bacteria 1712
288 Ga0307411_10188786 3300032005 Bacteria 1571
289 Ga0307411_10299233 3300032005 Bacteria 1289
290 Ga0307411_10844008 3300032005 Bacteria 810
291 Ga0307415_100009831 3300032126 Bacteria 5388
292 Ga0307415_100382600 3300032126 Bacteria 1195
293 Ga0307415_101309480 3300032126 Bacteria 686
294 Ga0373949_0068831 3300035090 Bacteria 924
295 Ga0373925_0195427 3300037068 Bacteria 1607
296 Ga0395899_0008289 3300037312 Bacteria 8004
297 Ga0395899_0010294 3300037312 Bacteria 7170
298 Ga0395900_0028200 3300037418 Bacteria 5751
299 Ga0395900_0057902 3300037418 Bacteria 3989
300 Ga0395900_0105547 3300037418 Bacteria 2894
301 Ga0395900_0787479 3300037418 Bacteria 879
302 Ga0395898_0821100 3300037466 Bacteria 870
303 Ga0395905_0000541 3300037471 Bacteria 51481
304 Ga0395905_0661419 3300037471 Bacteria 947
305 Ga0395905_0724668 3300037471 Bacteria 897
306 Ga0395901_0002184 3300038443 Bacteria 19974
307 Ga0395901_0032170 3300038443 Bacteria 5413
308 Ga0439445_0000370 3300042004 Bacteria 8995
309 Ga0466969_0020689 3300044656 Bacteria 3405
310 Ga0466966_0031208 3300044684 Bacteria 3456
311 Ga0466963_0014720 3300044694 Bacteria 4827
312 Ga0466963_0296905 3300044694 Bacteria 1136
313 Ga0466971_0069194 3300044719 Bacteria 1601
314 Ga0466970_0001624 3300044765 Bacteria 10829
315 Ga0466957_0068187 3300044842 Bacteria 2195
316 Ga0466959_0139473 3300045049 Bacteria 1714
317 Ga0466958_0000786 3300045836 Bacteria 13978
318 Ga0466967_0224017 3300045976 Bacteria 1788
319 Ga0495606_0208478 3300046507 Bacteria 1108
320 Ga0495620_0045216 3300046515 Bacteria 1909
321 Ga0495663_0010118 3300046525 Bacteria 2619
322 Ga0495663_0018913 3300046525 Bacteria 1965
323 Ga0495663_0090608 3300046525 Bacteria 996
324 Ga0495642_0044415 3300046528 Bacteria 1814
325 Ga0495621_0091748 3300046539 Bacteria 1145
326 Ga0495633_0021453 3300046558 Bacteria 3231
327 Ga0495659_0013125 3300046664 Bacteria 2695
328 Ga0495659_0016855 3300046664 Bacteria 2414
329 Ga0495669_0011154 3300046684 Bacteria 3809
330 Ga0495669_0127738 3300046684 Bacteria 1195
331 Ga0495670_0012219 3300046691 Bacteria 4221
332 Ga0495670_0028244 3300046691 Bacteria 2781
333 Ga0495677_0018721 3300047445 Bacteria 2510
334 Ga0495677_0089873 3300047445 Unclassified 1157
335 Ga0495677_0137041 3300047445 Bacteria 939
336 Ga0496103_0161129 3300048906 Bacteria 1439
337 Ga0496106_0487668 3300048909 Bacteria 990
338 Ga0496107_0266409 3300048910 Bacteria 1275
339 Ga0496109_0018675 3300048912 Bacteria 6094
340 Ga0496114_0000016 3300048917 Bacteria 274656
341 Ga0501268_002988 3300049765 Bacteria 2279
342 nmdc:mga06r32_126452_c1 3300050510 Bacteria 2525
343 Ga0466962_0004150 3300061719 Bacteria 6947

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300031995 Ga0307409_100101375 Ga0307409_1001013752 205
2 3300031548 Ga0307408_101031304 Ga0307408_1010313041 213
3 3300031852 Ga0307410_10088503 Ga0307410_100885032 213
4 3300031901 Ga0307406_10246333 Ga0307406_102463331 213
5 3300001904 JGI24736J21556_1001329 JGI24736J21556_10013293 217
6 3300003323 rootH1_10038125 rootH1_100381253 217
7 3300005327 Ga0070658_10462901 Ga0070658_104629012 217
8 3300005339 Ga0070660_100011183 Ga0070660_1000111832 217
9 3300005339 Ga0070660_100420104 Ga0070660_1004201041 217
10 3300005344 Ga0070661_100004478 Ga0070661_10000447810 217
11 3300005347 Ga0070668_100006099 Ga0070668_1000060996 217
12 3300005354 Ga0070675_100289504 Ga0070675_1002895042 217
13 3300005366 Ga0070659_100102083 Ga0070659_1001020832 217
14 3300005435 Ga0070714_100055350 Ga0070714_1000553504 217
15 3300005455 Ga0070663_100007296 Ga0070663_1000072966 217
16 3300005539 Ga0068853_100041433 Ga0068853_1000414334 217
17 3300005539 Ga0068853_100108704 Ga0068853_1001087043 217
18 3300005563 Ga0068855_100140154 Ga0068855_1001401542 217
19 3300005577 Ga0068857_100053090 Ga0068857_1000530903 217
20 3300005577 Ga0068857_100622718 Ga0068857_1006227182 217
21 3300005578 Ga0068854_100004556 Ga0068854_1000045567 217
22 3300005578 Ga0068854_100067851 Ga0068854_1000678513 217
23 3300005614 Ga0068856_100336570 Ga0068856_1003365702 217
24 3300005616 Ga0068852_100021784 Ga0068852_1000217844 217
25 3300005616 Ga0068852_100034064 Ga0068852_1000340644 217
26 3300005834 Ga0068851_10079360 Ga0068851_100793601 217
27 3300005843 Ga0068860_100146173 Ga0068860_1001461732 217
28 3300005844 Ga0068862_100058074 Ga0068862_1000580741 217
29 3300005844 Ga0068862_100921711 Ga0068862_1009217112 217
30 3300009093 Ga0105240_10054442 Ga0105240_100544424 217
31 3300009093 Ga0105240_10065302 Ga0105240_100653025 217
32 3300009093 Ga0105240_10658506 Ga0105240_106585062 217
33 3300009551 Ga0105238_10029121 Ga0105238_100291215 217
34 3300009553 Ga0105249_10050376 Ga0105249_100503763 217
35 3300013102 Ga0157371_10097525 Ga0157371_100975253 217
36 3300013102 Ga0157371_10138413 Ga0157371_101384131 217
37 3300013102 Ga0157371_10171895 Ga0157371_101718953 217
38 3300013102 Ga0157371_10459834 Ga0157371_104598342 217
39 3300013104 Ga0157370_10262750 Ga0157370_102627503 217
40 3300013105 Ga0157369_10046293 Ga0157369_100462935 217
41 3300013105 Ga0157369_10055713 Ga0157369_100557134 217
42 3300013105 Ga0157369_10268016 Ga0157369_102680163 217
43 3300013307 Ga0157372_10258320 Ga0157372_102583202 217
44 3300013307 Ga0157372_11375439 Ga0157372_113754392 217
45 3300025904 Ga0207647_10019225 Ga0207647_100192256 217
46 3300025904 Ga0207647_10026262 Ga0207647_100262624 217
47 3300025909 Ga0207705_10000033 Ga0207705_10000033174 217
48 3300025909 Ga0207705_10017908 Ga0207705_100179084 217
49 3300025913 Ga0207695_10009645 Ga0207695_100096459 217
50 3300025913 Ga0207695_10018686 Ga0207695_100186866 217
51 3300025913 Ga0207695_10595751 Ga0207695_105957512 217
52 3300025919 Ga0207657_10024543 Ga0207657_100245436 217
53 3300025920 Ga0207649_10003587 Ga0207649_100035876 217
54 3300025920 Ga0207649_10117435 Ga0207649_101174352 217
55 3300025924 Ga0207694_10037347 Ga0207694_100373474 217
56 3300025932 Ga0207690_10151196 Ga0207690_101511962 217
57 3300025981 Ga0207640_10000473 Ga0207640_1000047323 217
58 3300025981 Ga0207640_10223385 Ga0207640_102233852 217
59 3300026041 Ga0207639_10847317 Ga0207639_108473172 217
60 3300026067 Ga0207678_10000321 Ga0207678_1000032140 217
61 3300026067 Ga0207678_10091006 Ga0207678_100910063 217
62 3300026067 Ga0207678_10401710 Ga0207678_104017102 217
63 3300026078 Ga0207702_10001866 Ga0207702_100018662 217
64 3300026078 Ga0207702_10032955 Ga0207702_100329555 217
65 3300026116 Ga0207674_10073579 Ga0207674_100735794 217
66 3300026116 Ga0207674_10331413 Ga0207674_103314132 217
67 3300026142 Ga0207698_10031710 Ga0207698_100317102 217
68 3300026142 Ga0207698_10154794 Ga0207698_101547943 217
69 3300028380 Ga0268265_10021490 Ga0268265_100214905 217
70 3300031824 Ga0307413_10479903 Ga0307413_104799031 217
71 3300031852 Ga0307410_10098017 Ga0307410_100980173 217
72 3300031852 Ga0307410_10212386 Ga0307410_102123862 217
73 3300031903 Ga0307407_10118260 Ga0307407_101182603 217
74 3300031911 Ga0307412_10066202 Ga0307412_100662023 217
75 3300031995 Ga0307409_100178368 Ga0307409_1001783682 217
76 3300031995 Ga0307409_100292762 Ga0307409_1002927622 217
77 3300032004 Ga0307414_10051633 Ga0307414_100516333 217
78 3300032005 Ga0307411_10023787 Ga0307411_100237873 217
79 3300032005 Ga0307411_10844008 Ga0307411_108440082 217
80 3300032126 Ga0307415_101309480 Ga0307415_1013094801 217
81 3300037068 Ga0373925_0195427 Ga0373925_0195427_97_750 217
82 3300037418 Ga0395900_0057902 Ga0395900_0057902_1487_2140 217
83 3300037418 Ga0395900_0105547 Ga0395900_0105547_266_919 217
84 3300037418 Ga0395900_0787479 Ga0395900_0787479_109_762 217
85 3300037471 Ga0395905_0724668 Ga0395905_0724668_215_868 217
86 3300045976 Ga0466967_0224017 Ga0466967_0224017_982_1635 217
87 2162886012 MBSR1b_contig_8639358 MBSR1b_0132.00004370 218
88 3300001977 JGI24746J21847_1004600 JGI24746J21847_10046002 218
89 3300002076 JGI24749J21850_1000139 JGI24749J21850_10001397 218
90 3300002077 JGI24744J21845_10000804 JGI24744J21845_100008042 218
91 3300003323 rootH1_10081980 rootH1_100819803 218
92 3300005293 Ga0065715_10000357 Ga0065715_100003575 218
93 3300005328 Ga0070676_10009377 Ga0070676_100093775 218
94 3300005328 Ga0070676_10115493 Ga0070676_101154932 218
95 3300005330 Ga0070690_100395563 Ga0070690_1003955631 218
96 3300005331 Ga0070670_100005336 Ga0070670_1000053367 218
97 3300005331 Ga0070670_100099980 Ga0070670_1000999802 218
98 3300005333 Ga0070677_10000652 Ga0070677_100006526 218
99 3300005335 Ga0070666_10000205 Ga0070666_1000020527 218
100 3300005339 Ga0070660_100135634 Ga0070660_1001356342 218
101 3300005340 Ga0070689_100104808 Ga0070689_1001048082 218
102 3300005344 Ga0070661_100319116 Ga0070661_1003191162 218
103 3300005347 Ga0070668_100002805 Ga0070668_1000028055 218
104 3300005347 Ga0070668_100019021 Ga0070668_1000190214 218
105 3300005353 Ga0070669_100001859 Ga0070669_10000185914 218
106 3300005354 Ga0070675_100001753 Ga0070675_1000017535 218
107 3300005355 Ga0070671_100004029 Ga0070671_10000402910 218
108 3300005355 Ga0070671_100037229 Ga0070671_1000372293 218
109 3300005355 Ga0070671_100063722 Ga0070671_1000637223 218
110 3300005355 Ga0070671_100301440 Ga0070671_1003014402 218
111 3300005356 Ga0070674_100012769 Ga0070674_1000127695 218
112 3300005356 Ga0070674_100048840 Ga0070674_1000488402 218
113 3300005364 Ga0070673_100010076 Ga0070673_1000100765 218
114 3300005365 Ga0070688_100689339 Ga0070688_1006893391 218
115 3300005366 Ga0070659_100170682 Ga0070659_1001706822 218
116 3300005367 Ga0070667_100003025 Ga0070667_1000030255 218
117 3300005367 Ga0070667_100007182 Ga0070667_10000718210 218
118 3300005367 Ga0070667_100035574 Ga0070667_1000355742 218
119 3300005434 Ga0070709_10006547 Ga0070709_100065474 218
120 3300005436 Ga0070713_100221731 Ga0070713_1002217312 218
121 3300005441 Ga0070700_100202180 Ga0070700_1002021802 218
122 3300005455 Ga0070663_100058093 Ga0070663_1000580934 218
123 3300005455 Ga0070663_100087863 Ga0070663_1000878632 218
124 3300005457 Ga0070662_100000350 Ga0070662_10000035026 218
125 3300005458 Ga0070681_10106071 Ga0070681_101060712 218
126 3300005530 Ga0070679_100230279 Ga0070679_1002302793 218
127 3300005543 Ga0070672_100001606 Ga0070672_1000016065 218
128 3300005543 Ga0070672_100182674 Ga0070672_1001826742 218
129 3300005544 Ga0070686_100016200 Ga0070686_1000162003 218
130 3300005545 Ga0070695_100079877 Ga0070695_1000798773 218
131 3300005546 Ga0070696_100357796 Ga0070696_1003577962 218
132 3300005547 Ga0070693_100088957 Ga0070693_1000889572 218
133 3300005564 Ga0070664_100008513 Ga0070664_1000085135 218
134 3300005564 Ga0070664_100042400 Ga0070664_1000424003 218
135 3300005577 Ga0068857_100022191 Ga0068857_1000221916 218
136 3300005577 Ga0068857_100113340 Ga0068857_1001133403 218
137 3300005578 Ga0068854_100245889 Ga0068854_1002458892 218
138 3300005614 Ga0068856_100288326 Ga0068856_1002883262 218
139 3300005616 Ga0068852_100146819 Ga0068852_1001468192 218
140 3300005616 Ga0068852_100153905 Ga0068852_1001539052 218
141 3300005616 Ga0068852_100533963 Ga0068852_1005339632 218
142 3300005617 Ga0068859_100010015 Ga0068859_1000100157 218
143 3300005617 Ga0068859_100066062 Ga0068859_1000660624 218
144 3300005617 Ga0068859_100102714 Ga0068859_1001027143 218
145 3300005618 Ga0068864_100004984 Ga0068864_1000049848 218
146 3300005618 Ga0068864_100023725 Ga0068864_1000237255 218
147 3300005718 Ga0068866_10216673 Ga0068866_102166732 218
148 3300005719 Ga0068861_100015774 Ga0068861_1000157744 218
149 3300005834 Ga0068851_10022273 Ga0068851_100222733 218
150 3300005841 Ga0068863_100010334 Ga0068863_1000103349 218
151 3300005841 Ga0068863_100160431 Ga0068863_1001604313 218
152 3300005841 Ga0068863_100594381 Ga0068863_1005943811 218
153 3300005842 Ga0068858_100000980 Ga0068858_10000098011 218
154 3300005842 Ga0068858_100050243 Ga0068858_1000502432 218
155 3300005843 Ga0068860_100048457 Ga0068860_1000484572 218
156 3300005843 Ga0068860_100048726 Ga0068860_1000487262 218
157 3300005843 Ga0068860_100094960 Ga0068860_1000949603 218
158 3300005844 Ga0068862_100003962 Ga0068862_10000396212 218
159 3300006028 Ga0070717_10030870 Ga0070717_100308707 218
160 3300006237 Ga0097621_100071566 Ga0097621_1000715664 218
161 3300006358 Ga0068871_100024780 Ga0068871_1000247804 218
162 3300006881 Ga0068865_100009912 Ga0068865_1000099124 218
163 3300006931 Ga0097620_100010015 Ga0097620_1000100157 218
164 3300006931 Ga0097620_100066061 Ga0097620_1000660614 218
165 3300006931 Ga0097620_100102711 Ga0097620_1001027112 218
166 3300009011 Ga0105251_10014665 Ga0105251_100146653 218
167 3300009098 Ga0105245_10039260 Ga0105245_100392602 218
168 3300009101 Ga0105247_10129964 Ga0105247_101299642 218
169 3300009148 Ga0105243_10122479 Ga0105243_101224792 218
170 3300009174 Ga0105241_10185906 Ga0105241_101859063 218
171 3300009177 Ga0105248_10000390 Ga0105248_1000039035 218
172 3300009177 Ga0105248_10043821 Ga0105248_100438214 218
173 3300009545 Ga0105237_10105840 Ga0105237_101058402 218
174 3300009553 Ga0105249_10009551 Ga0105249_100095516 218
175 3300012512 Ga0157327_1001364 Ga0157327_10013642 218
176 3300013100 Ga0157373_10002479 Ga0157373_100024795 218
177 3300013102 Ga0157371_10169787 Ga0157371_101697872 218
178 3300013296 Ga0157374_10300387 Ga0157374_103003872 218
179 3300013307 Ga0157372_10371958 Ga0157372_103719582 218
180 3300013308 Ga0157375_10332997 Ga0157375_103329972 218
181 3300014325 Ga0163163_10020654 Ga0163163_100206544 218
182 3300014326 Ga0157380_10001142 Ga0157380_100011427 218
183 3300014326 Ga0157380_10003382 Ga0157380_100033829 218
184 3300014497 Ga0182008_10022462 Ga0182008_100224622 218
185 3300014968 Ga0157379_10008156 Ga0157379_1000815610 218
186 3300014968 Ga0157379_10042362 Ga0157379_100423622 218
187 3300025315 Ga0207697_10000333 Ga0207697_1000033321 218
188 3300025893 Ga0207682_10001225 Ga0207682_100012259 218
189 3300025899 Ga0207642_10069218 Ga0207642_100692182 218
190 3300025901 Ga0207688_10004324 Ga0207688_100043247 218
191 3300025901 Ga0207688_10007318 Ga0207688_100073182 218
192 3300025904 Ga0207647_10003326 Ga0207647_100033264 218
193 3300025906 Ga0207699_10099992 Ga0207699_100999922 218
194 3300025907 Ga0207645_10004731 Ga0207645_100047314 218
195 3300025907 Ga0207645_10047397 Ga0207645_100473973 218
196 3300025907 Ga0207645_10206240 Ga0207645_102062402 218
197 3300025907 Ga0207645_10319660 Ga0207645_103196602 218
198 3300025915 Ga0207693_10039708 Ga0207693_100397082 218
199 3300025919 Ga0207657_10137282 Ga0207657_101372822 218
200 3300025919 Ga0207657_10173734 Ga0207657_101737342 218
201 3300025919 Ga0207657_10487546 Ga0207657_104875462 218
202 3300025921 Ga0207652_10149079 Ga0207652_101490792 218
203 3300025923 Ga0207681_10002252 Ga0207681_100022525 218
204 3300025925 Ga0207650_10001160 Ga0207650_1000116014 218
205 3300025926 Ga0207659_10003531 Ga0207659_100035316 218
206 3300025926 Ga0207659_10201143 Ga0207659_102011432 218
207 3300025927 Ga0207687_10020163 Ga0207687_100201632 218
208 3300025928 Ga0207700_10063065 Ga0207700_100630652 218
209 3300025931 Ga0207644_10027342 Ga0207644_100273423 218
210 3300025931 Ga0207644_10136582 Ga0207644_101365822 218
211 3300025933 Ga0207706_10000222 Ga0207706_1000022232 218
212 3300025933 Ga0207706_10000276 Ga0207706_1000027643 218
213 3300025933 Ga0207706_10205867 Ga0207706_102058672 218
214 3300025935 Ga0207709_10080175 Ga0207709_100801753 218
215 3300025936 Ga0207670_10217808 Ga0207670_102178082 218
216 3300025937 Ga0207669_10005678 Ga0207669_100056784 218
217 3300025937 Ga0207669_10076531 Ga0207669_100765312 218
218 3300025938 Ga0207704_10026790 Ga0207704_100267904 218
219 3300025940 Ga0207691_10002789 Ga0207691_1000278910 218
220 3300025940 Ga0207691_10359544 Ga0207691_103595442 218
221 3300025941 Ga0207711_10000190 Ga0207711_1000019068 218
222 3300025942 Ga0207689_10229998 Ga0207689_102299982 218
223 3300025945 Ga0207679_10015858 Ga0207679_100158583 218
224 3300025949 Ga0207667_10018949 Ga0207667_100189495 218
225 3300025960 Ga0207651_10001768 Ga0207651_100017684 218
226 3300025960 Ga0207651_10037268 Ga0207651_100372685 218
227 3300025972 Ga0207668_10000847 Ga0207668_1000084714 218
228 3300025972 Ga0207668_10034584 Ga0207668_100345844 218
229 3300025981 Ga0207640_10002375 Ga0207640_100023753 218
230 3300025981 Ga0207640_10349126 Ga0207640_103491262 218
231 3300025981 Ga0207640_10934050 Ga0207640_109340501 218
232 3300025986 Ga0207658_10020587 Ga0207658_100205872 218
233 3300025986 Ga0207658_10064044 Ga0207658_100640444 218
234 3300026023 Ga0207677_10005685 Ga0207677_100056858 218
235 3300026023 Ga0207677_10006502 Ga0207677_100065024 218
236 3300026035 Ga0207703_10000461 Ga0207703_1000046137 218
237 3300026035 Ga0207703_10199251 Ga0207703_101992512 218
238 3300026067 Ga0207678_10033320 Ga0207678_100333204 218
239 3300026088 Ga0207641_10142526 Ga0207641_101425263 218
240 3300026088 Ga0207641_10483614 Ga0207641_104836142 218
241 3300026095 Ga0207676_10076072 Ga0207676_100760723 218
242 3300026116 Ga0207674_10049277 Ga0207674_100492773 218
243 3300026118 Ga0207675_100059132 Ga0207675_1000591322 218
244 3300026121 Ga0207683_10020656 Ga0207683_100206566 218
245 3300026121 Ga0207683_10036783 Ga0207683_100367837 218
246 3300026121 Ga0207683_10585811 Ga0207683_105858112 218
247 3300028380 Ga0268265_10003443 Ga0268265_100034434 218
248 3300028381 Ga0268264_10062212 Ga0268264_100622123 218
249 3300028381 Ga0268264_10091518 Ga0268264_100915182 218
250 3300028381 Ga0268264_10200502 Ga0268264_102005021 218
251 3300028381 Ga0268264_10397855 Ga0268264_103978552 218
252 3300031548 Ga0307408_100015711 Ga0307408_1000157112 218
253 3300031548 Ga0307408_100221109 Ga0307408_1002211092 218
254 3300031548 Ga0307408_100472466 Ga0307408_1004724662 218
255 3300031731 Ga0307405_10004439 Ga0307405_100044395 218
256 3300031731 Ga0307405_10426186 Ga0307405_104261862 218
257 3300031824 Ga0307413_10001834 Ga0307413_100018348 218
258 3300031824 Ga0307413_10043560 Ga0307413_100435602 218
259 3300031824 Ga0307413_10055490 Ga0307413_100554903 218
260 3300031824 Ga0307413_10096870 Ga0307413_100968702 218
261 3300031824 Ga0307413_10178672 Ga0307413_101786722 218
262 3300031824 Ga0307413_10845450 Ga0307413_108454501 218
263 3300031852 Ga0307410_10001310 Ga0307410_100013106 218
264 3300031852 Ga0307410_10305979 Ga0307410_103059791 218
265 3300031852 Ga0307410_10565863 Ga0307410_105658632 218
266 3300031901 Ga0307406_10005756 Ga0307406_100057565 218
267 3300031901 Ga0307406_10635031 Ga0307406_106350312 218
268 3300031903 Ga0307407_10000602 Ga0307407_1000060210 218
269 3300031903 Ga0307407_10044681 Ga0307407_100446812 218
270 3300031903 Ga0307407_10294907 Ga0307407_102949072 218
271 3300031903 Ga0307407_10321201 Ga0307407_103212011 218
272 3300031911 Ga0307412_10017200 Ga0307412_100172005 218
273 3300031995 Ga0307409_100008476 Ga0307409_1000084763 218
274 3300031995 Ga0307409_100015114 Ga0307409_1000151145 218
275 3300031995 Ga0307409_100088970 Ga0307409_1000889703 218
276 3300031995 Ga0307409_100100363 Ga0307409_1001003632 218
277 3300031995 Ga0307409_100322172 Ga0307409_1003221722 218
278 3300031995 Ga0307409_100351212 Ga0307409_1003512122 218
279 3300031995 Ga0307409_100707401 Ga0307409_1007074012 218
280 3300032002 Ga0307416_100012428 Ga0307416_1000124283 218
281 3300032002 Ga0307416_100059842 Ga0307416_1000598423 218
282 3300032002 Ga0307416_100158873 Ga0307416_1001588733 218
283 3300032002 Ga0307416_100177788 Ga0307416_1001777882 218
284 3300032002 Ga0307416_100202874 Ga0307416_1002028742 218
285 3300032002 Ga0307416_100222842 Ga0307416_1002228423 218
286 3300032002 Ga0307416_100317873 Ga0307416_1003178732 218
287 3300032004 Ga0307414_10005495 Ga0307414_100054956 218
288 3300032004 Ga0307414_10056434 Ga0307414_100564343 218
289 3300032004 Ga0307414_10262253 Ga0307414_102622532 218
290 3300032004 Ga0307414_10479058 Ga0307414_104790582 218
291 3300032005 Ga0307411_10006465 Ga0307411_100064652 218
292 3300032005 Ga0307411_10014729 Ga0307411_100147295 218
293 3300032005 Ga0307411_10026761 Ga0307411_100267612 218
294 3300032005 Ga0307411_10137644 Ga0307411_101376442 218
295 3300032005 Ga0307411_10153925 Ga0307411_101539251 218
296 3300032005 Ga0307411_10188786 Ga0307411_101887863 218
297 3300032005 Ga0307411_10299233 Ga0307411_102992332 218
298 3300032126 Ga0307415_100009831 Ga0307415_1000098313 218
299 3300032126 Ga0307415_100382600 Ga0307415_1003826002 218
300 3300035090 Ga0373949_0068831 Ga0373949_0068831_158_814 218
301 3300037312 Ga0395899_0008289 Ga0395899_0008289_1432_2202 218
302 3300037312 Ga0395899_0010294 Ga0395899_0010294_4921_5577 218
303 3300037418 Ga0395900_0028200 Ga0395900_0028200_59_715 218
304 3300037466 Ga0395898_0821100 Ga0395898_0821100_89_745 218
305 3300037471 Ga0395905_0000541 Ga0395905_0000541_11889_12545 218
306 3300037471 Ga0395905_0661419 Ga0395905_0661419_14_811 218
307 3300038443 Ga0395901_0002184 Ga0395901_0002184_14922_15578 218
308 3300038443 Ga0395901_0032170 Ga0395901_0032170_4466_5236 218
309 3300042004 Ga0439445_0000370 Ga0439445_0000370_2340_2996 218
310 3300044656 Ga0466969_0020689 Ga0466969_0020689_1841_2611 218
311 3300044684 Ga0466966_0031208 Ga0466966_0031208_2429_3199 218
312 3300044694 Ga0466963_0014720 Ga0466963_0014720_2165_2935 218
313 3300044694 Ga0466963_0296905 Ga0466963_0296905_392_1051 218
314 3300044719 Ga0466971_0069194 Ga0466971_0069194_540_1310 218
315 3300044765 Ga0466970_0001624 Ga0466970_0001624_175_945 218
316 3300044842 Ga0466957_0068187 Ga0466957_0068187_1323_2093 218
317 3300045049 Ga0466959_0139473 Ga0466959_0139473_655_1425 218
318 3300045836 Ga0466958_0000786 Ga0466958_0000786_8407_9177 218
319 3300046507 Ga0495606_0208478 Ga0495606_0208478_387_1064 218
320 3300046515 Ga0495620_0045216 Ga0495620_0045216_145_822 218
321 3300046525 Ga0495663_0010118 Ga0495663_0010118_1878_2534 218
322 3300046525 Ga0495663_0018913 Ga0495663_0018913_1176_1832 218
323 3300046525 Ga0495663_0090608 Ga0495663_0090608_24_680 218
324 3300046528 Ga0495642_0044415 Ga0495642_0044415_418_1074 218
325 3300046539 Ga0495621_0091748 Ga0495621_0091748_195_851 218
326 3300046558 Ga0495633_0021453 Ga0495633_0021453_145_801 218
327 3300046664 Ga0495659_0013125 Ga0495659_0013125_2020_2676 218
328 3300046664 Ga0495659_0016855 Ga0495659_0016855_1114_1770 218
329 3300046684 Ga0495669_0011154 Ga0495669_0011154_2754_3410 218
330 3300046684 Ga0495669_0127738 Ga0495669_0127738_515_1171 218
331 3300046691 Ga0495670_0012219 Ga0495670_0012219_1282_1938 218
332 3300046691 Ga0495670_0028244 Ga0495670_0028244_1288_1944 218
333 3300047445 Ga0495677_0018721 Ga0495677_0018721_1501_2157 218
334 3300047445 Ga0495677_0089873 Ga0495677_0089873_476_1132 218
335 3300047445 Ga0495677_0137041 Ga0495677_0137041_117_773 218
336 3300048906 Ga0496103_0161129 Ga0496103_0161129_423_1079 218
337 3300048909 Ga0496106_0487668 Ga0496106_0487668_197_853 218
338 3300048910 Ga0496107_0266409 Ga0496107_0266409_186_842 218
339 3300048912 Ga0496109_0018675 Ga0496109_0018675_279_935 218
340 3300048917 Ga0496114_0000016 Ga0496114_0000016_109856_110512 218
341 3300049765 Ga0501268_002988 Ga0501268_002988_1609_2265 218
342 3300050510 nmdc:mga06r32_126452_c1 nmdc:mga06r32_126452_c1_361_1017 218
343 3300061719 Ga0466962_0004150 Ga0466962_0004150_2103_2873 218

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01168

Ala_racemase_N

Alanine racemase, N-terminal domain

7

213

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
3r79-assembly3.cif.gz_A-2 crystal structure of an uncharactertized protein from agrobacterium tumefaciens 0.981 2 216
3r79-assembly3.cif.gz_B crystal structure of an uncharactertized protein from agrobacterium tumefaciens 0.9792 3 218
3r79-assembly3.cif.gz_A-2 crystal structure of an uncharactertized protein from agrobacterium tumefaciens 0.9633 2 216
3r79-assembly3.cif.gz_B crystal structure of an uncharactertized protein from agrobacterium tumefaciens 0.9571 3 218
7uau-assembly1.cif.gz_A the crystal structure of the k137a mutant of e. coli yggs in complex with plp 0.9371 5 218
ID Description Score Start End Superfamily
3r79B00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Alanine racemase 0.9725 3 218 3.20.20.10
af_Q9Z2Y8_11_258_3.20.20.10 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Alanine racemase 0.9378 2 218 3.20.20.10
af_P9WFQ7_2_257_3.20.20.10 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Alanine racemase 0.9327 3 218 3.20.20.10
af_B9EWG6_2_244_3.20.20.10 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Alanine racemase 0.9319 2 218 3.20.20.10
af_Q9Z2Y8_11_258_3.20.20.10 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Alanine racemase 0.9296 2 218 3.20.20.10
ID Description Score Start End GO Terms
AF-A0A529LS87-F1-model_v4 YggS family pyridoxal phosphate-dependent enzyme 0.9967 32 130 GO:0030170
AF-A0A7H0GB16-F1-model_v4 deleted 0.9945 2 218
AF-A0A1H7ASL7-F1-model_v4 Pyridoxal phosphate homeostasis protein (PLP homeostasis protein) 0.9941 2 218 GO:0030170
AF-A0A1S1H9R3-F1-model_v4 Pyridoxal phosphate homeostasis protein (PLP homeostasis protein) 0.9934 7 218 GO:0030170
AF-D8NHC9-F1-model_v4 deleted 0.9925 8 104

Feature Viewer

pLDDT pTM Quality
95.08 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map