F415536

General Info

Members Datasets Scaffolds Average Seq Length
343 149 335 823

Family's Representative Sequence

Representative Sequence 3300009093|Ga0105240_10012734|Ga0105240_100127348
Length 898
Sequence MIRSVQGLFFLFILLTGVAGGPVMAGWGNPSLREEVGPEGSRGGWSVGRIRVFGGQRNGLVISGVVAGGPPGCVIEDTGRKAGHLALPAGSGSLSGRVTDKKGAPISGATVYIPDLKLGVVADTNGYYHFKALPSGKYLIEVHSIGYKTYTKSVTVSGPVSLDLTLNDSYVEESAVVVTGLSKATQIKRNPVPIVAISHDYLATNLSTNAIDAIARIPGIRAVTTGPNISKPFIRGLGYNRILTLYDGIRQEGQQWGDEHGIEVDQYGVDRVEVIKGPASLSFGSDALAGVVNLIPTQPAPEGKMIGDLTLDYQTNNKYLGGSAMLGASRNGLDWMARVSHKQAVDYKDKIDGRVFGTAFNETDASASLGLHRKWGYSHLDFVLFDDLQEIPDGSRDSATRRFTRQISEADTVREIVSDADLNSYKMEKLHQHVQHYRIYSGNSFTLGDAGRLQVNLGFQRSVRREFSHPVLDKIPGLYLQLNSVTYDVKYFLPEFDDWNVTVGLNGMYETNNSTDGTEFVIPSYHQFDIGPFLLAKRSFDKLDIAGGIRFDSRAFTNFQLYTRPDPVTGFDKPVSGADTAGASLQFTNYKKTFAGVSGSLGATYNFSDKFSLKANLARGFRAPNISEVSANGVHPGTNIYQLGNPDFKPEFSLQEDIGLVFSSRYVVASLDLFNNVISNYIYNQKVVTAAGVDSMDGNGDTYFRYVASKARLYGGEFSIDIHPVKALHFENSFSLVYGTNTGSQPKSLGDSAKYLPFIPPAHGLSELRYEFASRSKRFSHAFFKLQLEYSAAQNRVMRAYNTETPTAGYALFNAGVGGRLSDKKGKTIVNVYLMGNNLFNVAYYDHLSRLKYFYFSPTDTNPTHGIYNMGRNVSLKLEFPLDFSLKPERKGGSDGAE

Samples

Sample ID Description Type Environment
1 2599185184 Mucilaginibacter sp. NFR10 Isolate Rhizoplane
2 2739367874 Chryseobacterium sp. T16E-39 Isolate Unclassified
3 2884791551 Chitinophaga oryzae 1310 Isolate Unclassified
4 2919437846 Mucilaginibacter pocheonensis 3262 Isolate Rhizosphere
5 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
6 2928147474 Mucilaginibacter rubeus 2025 Isolate Unclassified
7 2929239360 Chitinophaga sp. R-73072 Hybrid assembly Isolate Unclassified
8 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere
9 2977232053 Mucilaginibacter terrae SORGH_AS 422 Isolate Unclassified
10 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
11 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
12 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
13 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
14 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
15 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
16 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
17 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
18 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
19 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
20 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
21 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
22 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
28 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
29 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
30 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
31 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
32 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
33 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
34 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
35 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
36 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
37 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
38 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
39 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
40 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
41 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
42 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
43 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
44 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
45 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
46 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
47 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
48 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
49 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
50 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
51 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
52 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
53 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
54 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
55 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
56 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
57 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
58 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
59 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
60 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
61 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
62 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
63 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
64 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
65 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
66 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
67 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
94 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
95 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
96 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
97 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
98 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
99 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
100 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
101 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
102 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
103 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
104 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
105 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
106 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
107 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
108 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
109 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
110 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
111 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
112 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
113 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
114 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
115 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
116 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
117 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
118 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
119 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
120 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
121 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
122 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
123 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
124 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
125 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
126 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
127 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
128 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
129 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
130 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
131 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
132 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
133 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
134 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
135 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
136 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
137 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
138 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
139 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
140 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
141 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
142 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
143 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
144 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
145 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
146 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
147 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
148 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
149 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.38
Metatranscriptomes 0
Isolates 2.62

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.96
Nodule 0
Rhizoplane 0.29
Rhizosphere 86.3
Stem 0
Stem Tuber 0
Unclassified 8.45

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24735J21928_10000029 3300002067 Bacteria 81143
2 JGI25162J39368_1000408 3300002737 Bacteria 35183
3 rootH1_10015087 3300003316 Bacteria 11869
4 rootH1_10023928 3300003316 Bacteria 22841
5 rootH2_10005185 3300003320 Bacteria 15650
6 rootH2_10071355 3300003320 Bacteria 4807
7 rootL2_10092265 3300003322 Bacteria 5721
8 rootH1_10074488 3300003323 Bacteria 12488
9 rootH1_10137103 3300003323 Bacteria 2786
10 rootH1_10155099 3300003316 Bacteria 1844
11 rootH1_10155099 3300003323 Bacteria 3495
12 Ga0055535_1001897 3300003761 Bacteria 8806
13 Ga0070658_10053581 3300005327 Bacteria 3275
14 Ga0070683_100000629 3300005329 Bacteria 25373
15 Ga0070666_10000026 3300005335 Bacteria 152379
16 Ga0070666_10000031 3300005335 Bacteria 132089
17 Ga0070666_10015795 3300005335 Bacteria 4821
18 Ga0070680_100009300 3300005336 Bacteria 7546
19 Ga0070680_100012535 3300005336 Bacteria 6588
20 Ga0070680_100025293 3300005336 Bacteria 4744
21 Ga0070682_100000462 3300005337 Bacteria 25664
22 Ga0068868_100005055 3300005338 Bacteria 9260
23 Ga0070673_100009990 3300005364 Bacteria 6401
24 Ga0070659_100000372 3300005366 Bacteria 33822
25 Ga0070713_100037075 3300005436 Bacteria 3940
26 Ga0070681_10072636 3300005458 Unclassified 3403
27 Ga0070679_100000650 3300005530 Bacteria 29628
28 Ga0070679_100001610 3300005530 Bacteria 20288
29 Ga0070679_100007939 3300005530 Bacteria 9960
30 Ga0070679_100031034 3300005530 Bacteria 5280
31 Ga0070679_100059583 3300005530 Bacteria 3805
32 Ga0070684_100003856 3300005535 Bacteria 11345
33 Ga0068853_100001508 3300005539 Bacteria 16919
34 Ga0068853_100005465 3300005539 Bacteria 9958
35 Ga0068853_100018593 3300005539 Bacteria 5754
36 Ga0068853_100032422 3300005539 Bacteria 4426
37 Ga0070693_100016883 3300005547 Unclassified 3785
38 Ga0070665_100000018 3300005548 Bacteria 434118
39 Ga0070665_100001841 3300005548 Bacteria 24099
40 Ga0068855_100001212 3300005563 Bacteria 32000
41 Ga0068855_100002649 3300005563 Bacteria 22067
42 Ga0068855_100022378 3300005563 Bacteria 7574
43 Ga0068855_100023764 3300005563 Bacteria 7342
44 Ga0068855_100036898 3300005563 Bacteria 5815
45 Ga0068855_100041045 3300005563 Bacteria 5487
46 Ga0068855_100062203 3300005563 Bacteria 4358
47 Ga0068855_100070227 3300005563 Bacteria 4075
48 Ga0068857_100002912 3300005577 Bacteria 14102
49 Ga0068857_100087958 3300005577 Bacteria 2779
50 Ga0068852_100004973 3300005616 Bacteria 9451
51 Ga0068852_100005573 3300005616 Bacteria 9028
52 Ga0068859_100000045 3300005617 Bacteria 143607
53 Ga0068859_100000047 3300005617 Bacteria 140570
54 Ga0068859_100011894 3300005617 Bacteria 8744
55 Ga0068864_100001153 3300005618 Bacteria 21991
56 Ga0068864_100007922 3300005618 Bacteria 8754
57 Ga0068864_100022115 3300005618 Bacteria 5331
58 Ga0068851_10011151 3300005834 Unclassified 4209
59 Ga0068863_100003352 3300005841 Bacteria 15823
60 Ga0068858_100026708 3300005842 Bacteria 5363
61 Ga0068860_100000006 3300005843 Bacteria 461966
62 Ga0068860_100000040 3300005843 Bacteria 231652
63 Ga0068860_100005946 3300005843 Bacteria 12281
64 Ga0068860_100014411 3300005843 Bacteria 7745
65 Ga0081540_1007357 3300005983 Bacteria 7863
66 Ga0081540_1012762 3300005983 Bacteria 5502
67 Ga0075366_10009273 3300006195 Bacteria 5495
68 Ga0097621_100003725 3300006237 Bacteria 10556
69 Ga0097621_100006975 3300006237 Bacteria 8046
70 Ga0068871_100002260 3300006358 Bacteria 13097
71 Ga0068871_100003730 3300006358 Bacteria 10479
72 Ga0068871_100047658 3300006358 Bacteria 3457
73 Ga0097620_100000045 3300006931 Bacteria 143607
74 Ga0097620_100000047 3300006931 Bacteria 140570
75 Ga0097620_100011894 3300006931 Bacteria 8744
76 Ga0105240_10000155 3300009093 Bacteria 140485
77 Ga0105240_10000472 3300009093 Bacteria 74359
78 Ga0105240_10001144 3300009093 Bacteria 46441
79 Ga0105240_10001908 3300009093 Bacteria 34614
80 Ga0105240_10002330 3300009093 Bacteria 30727
81 Ga0105240_10003587 3300009093 Bacteria 24072
82 Ga0105240_10011237 3300009093 Bacteria 12484
83 Ga0105240_10012734 3300009093 Bacteria 11592
84 Ga0105240_10014688 3300009093 Bacteria 10685
85 Ga0105240_10019262 3300009093 Bacteria 9121
86 Ga0105240_10034681 3300009093 Bacteria 6507
87 Ga0105240_10046964 3300009093 Bacteria 5466
88 Ga0105241_10000616 3300009174 Bacteria 26772
89 Ga0105241_10001652 3300009174 Bacteria 16986
90 Ga0105241_10004626 3300009174 Bacteria 10175
91 Ga0105241_10005212 3300009174 Bacteria 9597
92 Ga0105241_10018498 3300009174 Bacteria 5125
93 Ga0105248_10091532 3300009177 Bacteria 3425
94 Ga0105237_10000061 3300009545 Bacteria 146107
95 Ga0105237_10002015 3300009545 Bacteria 25851
96 Ga0105237_10002084 3300009545 Bacteria 25287
97 Ga0105237_10006920 3300009545 Bacteria 12507
98 Ga0105237_10008408 3300009545 Bacteria 11183
99 Ga0105237_10010190 3300009545 Bacteria 10015
100 Ga0105237_10012154 3300009545 Bacteria 9082
101 Ga0105237_10013960 3300009545 Bacteria 8406
102 Ga0105237_10017015 3300009545 Bacteria 7546
103 Ga0105237_10028913 3300009545 Bacteria 5641
104 Ga0105237_10032297 3300009545 Bacteria 5300
105 Ga0105237_10037161 3300009545 Unclassified 4924
106 Ga0105237_10061367 3300009545 Bacteria 3759
107 Ga0105237_10068015 3300009545 Bacteria 3556
108 Ga0105237_10080640 3300009545 Bacteria 3244
109 Ga0105238_10000689 3300009551 Bacteria 35468
110 Ga0105238_10010861 3300009551 Bacteria 9153
111 Ga0105238_10039903 3300009551 Bacteria 4758
112 Ga0105238_10066572 3300009551 Bacteria 3604
113 Ga0105238_10082584 3300009551 Bacteria 3203
114 Ga0105249_10001437 3300009553 Bacteria 20858
115 Ga0105249_10007946 3300009553 Bacteria 9247
116 Ga0105239_10000155 3300010375 Bacteria 98415
117 Ga0105239_10000537 3300010375 Bacteria 54882
118 Ga0105239_10002895 3300010375 Bacteria 21449
119 Ga0105239_10003947 3300010375 Bacteria 17968
120 Ga0105239_10005530 3300010375 Bacteria 14792
121 Ga0105239_10006393 3300010375 Bacteria 13684
122 Ga0105239_10011055 3300010375 Bacteria 10077
123 Ga0105239_10020209 3300010375 Bacteria 7346
124 Ga0105239_10022256 3300010375 Bacteria 6986
125 Ga0105239_10047628 3300010375 Bacteria 4698
126 Ga0105239_10108070 3300010375 Bacteria 3082
127 Ga0157373_10007972 3300013100 Bacteria 7876
128 Ga0157373_10010186 3300013100 Bacteria 6924
129 Ga0157373_10042932 3300013100 Bacteria 3230
130 Ga0157371_10005373 3300013102 Bacteria 10824
131 Ga0157371_10006742 3300013102 Bacteria 9390
132 Ga0157371_10010446 3300013102 Bacteria 7233
133 Ga0157371_10012930 3300013102 Bacteria 6356
134 Ga0157371_10026403 3300013102 Bacteria 4222
135 Ga0157371_10027789 3300013102 Bacteria 4100
136 Ga0157370_10000405 3300013104 Bacteria 54383
137 Ga0157370_10001205 3300013104 Bacteria 32309
138 Ga0157370_10003729 3300013104 Bacteria 17809
139 Ga0157370_10004808 3300013104 Bacteria 15354
140 Ga0157370_10011156 3300013104 Bacteria 9418
141 Ga0157370_10014812 3300013104 Bacteria 7959
142 Ga0157370_10083860 3300013104 Bacteria 2996
143 Ga0157369_10016348 3300013105 Bacteria 8350
144 Ga0157369_10031341 3300013105 Bacteria 5855
145 Ga0157369_10039456 3300013105 Bacteria 5160
146 Ga0157369_10058537 3300013105 Bacteria 4156
147 Ga0157374_10000003 3300013296 Bacteria 854471
148 Ga0157374_10000025 3300013296 Bacteria 245131
149 Ga0157378_10016741 3300013297 Bacteria 6423
150 Ga0157378_10030229 3300013297 Unclassified 4786
151 Ga0163162_10001051 3300013306 Bacteria 25638
152 Ga0163162_10002657 3300013306 Bacteria 16942
153 Ga0163162_10002669 3300013306 Bacteria 16916
154 Ga0163162_10020645 3300013306 Bacteria 6474
155 Ga0163162_10021495 3300013306 Bacteria 6357
156 Ga0157372_10000080 3300013307 Bacteria 100216
157 Ga0157372_10000491 3300013307 Bacteria 43650
158 Ga0157372_10002023 3300013307 Bacteria 22030
159 Ga0157372_10010926 3300013307 Bacteria 9663
160 Ga0157372_10041498 3300013307 Bacteria 5088
161 Ga0157372_10060194 3300013307 Bacteria 4249
162 Ga0157372_10071999 3300013307 Bacteria 3895
163 Ga0157372_10109486 3300013307 Bacteria 3163
164 Ga0182008_10014547 3300014497 Bacteria 4118
165 Ga0157379_10008588 3300014968 Bacteria 8888
166 Ga0157379_10028763 3300014968 Bacteria 4942
167 Ga0157376_10000106 3300014969 Bacteria 60118
168 Ga0157376_10021603 3300014969 Bacteria 5001
169 Ga0157376_10022553 3300014969 Bacteria 4911
170 Ga0157376_10039493 3300014969 Bacteria 3850
171 Ga0157376_10040223 3300014969 Bacteria 3820
172 Ga0209437_100144 3300025233 Bacteria 164794
173 Ga0209258_100029 3300025242 Bacteria 490648
174 Ga0209148_1000194 3300025254 Bacteria 112740
175 Ga0207680_10000025 3300025903 Bacteria 79971
176 Ga0207680_10000141 3300025903 Bacteria 34433
177 Ga0207705_10026247 3300025909 Bacteria 4155
178 Ga0207705_10049905 3300025909 Bacteria 3012
179 Ga0207654_10001512 3300025911 Bacteria 12252
180 Ga0207654_10001648 3300025911 Bacteria 11678
181 Ga0207654_10005323 3300025911 Bacteria 6499
182 Ga0207707_10004161 3300025912 Bacteria 12820
183 Ga0207707_10053100 3300025912 Bacteria 3528
184 Ga0207707_10055934 3300025912 Unclassified 3432
185 Ga0207695_10000043 3300025913 Bacteria 444585
186 Ga0207695_10000146 3300025913 Bacteria 209416
187 Ga0207695_10000282 3300025913 Bacteria 126242
188 Ga0207695_10001656 3300025913 Bacteria 35897
189 Ga0207695_10006618 3300025913 Bacteria 14970
190 Ga0207695_10010167 3300025913 Bacteria 11545
191 Ga0207695_10011088 3300025913 Bacteria 10945
192 Ga0207695_10041655 3300025913 Bacteria 4915
193 Ga0207695_10067810 3300025913 Bacteria 3658
194 Ga0207671_10001487 3300025914 Bacteria 27036
195 Ga0207671_10001661 3300025914 Bacteria 25296
196 Ga0207671_10003937 3300025914 Bacteria 14476
197 Ga0207671_10008358 3300025914 Bacteria 8788
198 Ga0207671_10008559 3300025914 Bacteria 8657
199 Ga0207671_10016933 3300025914 Bacteria 5642
200 Ga0207671_10022650 3300025914 Bacteria 4746
201 Ga0207671_10028171 3300025914 Bacteria 4199
202 Ga0207671_10030509 3300025914 Bacteria 4021
203 Ga0207660_10000723 3300025917 Bacteria 21964
204 Ga0207660_10018419 3300025917 Bacteria 4654
205 Ga0207657_10079957 3300025919 Bacteria 2749
206 Ga0207652_10000210 3300025921 Bacteria 61797
207 Ga0207652_10000397 3300025921 Bacteria 45365
208 Ga0207652_10008482 3300025921 Bacteria 8271
209 Ga0207652_10048277 3300025921 Bacteria 3638
210 Ga0207700_10027741 3300025928 Bacteria 3971
211 Ga0207690_10000508 3300025932 Bacteria 25218
212 Ga0207706_10014095 3300025933 Bacteria 7248
213 Ga0207691_10002284 3300025940 Bacteria 18761
214 Ga0207691_10068228 3300025940 Unclassified 3213
215 Ga0207711_10071525 3300025941 Bacteria 3010
216 Ga0207689_10000416 3300025942 Bacteria 39850
217 Ga0207689_10002535 3300025942 Bacteria 16961
218 Ga0207661_10005151 3300025944 Bacteria 9186
219 Ga0207667_10000445 3300025949 Bacteria 55443
220 Ga0207667_10000838 3300025949 Bacteria 39676
221 Ga0207667_10000913 3300025949 Bacteria 37630
222 Ga0207667_10006449 3300025949 Bacteria 14203
223 Ga0207667_10029218 3300025949 Bacteria 5980
224 Ga0207667_10029386 3300025949 Bacteria 5961
225 Ga0207667_10031526 3300025949 Bacteria 5722
226 Ga0207667_10057044 3300025949 Bacteria 4101
227 Ga0207667_10130993 3300025949 Bacteria 2583
228 Ga0207712_10001513 3300025961 Bacteria 15777
229 Ga0207668_10004746 3300025972 Bacteria 7997
230 Ga0207703_10007544 3300026035 Bacteria 8627
231 Ga0207703_10025227 3300026035 Bacteria 4675
232 Ga0207639_10002969 3300026041 Bacteria 11409
233 Ga0207639_10016323 3300026041 Bacteria 5251
234 Ga0207641_10000038 3300026088 Bacteria 205418
235 Ga0207641_10000146 3300026088 Bacteria 100666
236 Ga0207674_10001573 3300026116 Bacteria 29387
237 Ga0207674_10004216 3300026116 Bacteria 17351
238 Ga0207698_10017030 3300026142 Unclassified 4920
239 Ga0207698_10028133 3300026142 Unclassified 4003
240 Ga0268266_10000026 3300028379 Bacteria 434485
241 Ga0268264_10000015 3300028381 Bacteria 508501
242 Ga0268264_10000019 3300028381 Bacteria 488112
243 Ga0268264_10000054 3300028381 Bacteria 317048
244 Ga0268264_10000640 3300028381 Bacteria 41542
245 Ga0268264_10003376 3300028381 Bacteria 13787
246 Ga0268264_10015093 3300028381 Bacteria 6336
247 Ga0268264_10028196 3300028381 Unclassified 4591
248 Ga0265334_10006818 3300028573 Bacteria 4903
249 Ga0307517_10003459 3300028786 Bacteria 24556
250 Ga0307515_10001027 3300028794 Bacteria 63746
251 Ga0307515_10001736 3300028794 Bacteria 48546
252 Ga0307511_10000138 3300030521 Bacteria 67742
253 Ga0307511_10000509 3300030521 Bacteria 41790
254 Ga0265327_10000048 3300031251 Bacteria 269173
255 Ga0265327_10000055 3300031251 Bacteria 247188
256 Ga0265327_10000099 3300031251 Bacteria 190474
257 Ga0265327_10001630 3300031251 Bacteria 27046
258 Ga0265327_10014945 3300031251 Bacteria 5048
259 Ga0265316_10013847 3300031344 Bacteria 7142
260 Ga0307513_10112235 3300031456 Bacteria 2717
261 Ga0307509_10027856 3300031507 Bacteria 6284
262 Ga0307509_10044688 3300031507 Bacteria 4784
263 Ga0307508_10002720 3300031616 Bacteria 18476
264 Ga0307516_10000246 3300031730 Bacteria 69826
265 Ga0307516_10001145 3300031730 Bacteria 37050
266 Ga0307507_10000036 3300033179 Bacteria 187512
267 Ga0307510_10000416 3300033180 Bacteria 40773
268 Ga0307510_10002732 3300033180 Bacteria 20188
269 Ga0395899_0000064 3300037312 Bacteria 207082
270 Ga0395899_0004788 3300037312 Bacteria 10547
271 Ga0395900_0013108 3300037418 Bacteria 8470
272 Ga0395898_0000730 3300037466 Bacteria 57720
273 Ga0395898_0004015 3300037466 Bacteria 16181
274 Ga0395898_0010250 3300037466 Bacteria 9811
275 Ga0395898_0115141 3300037466 Bacteria 2576
276 Ga0395905_0001098 3300037471 Bacteria 34054
277 Ga0395905_0021197 3300037471 Bacteria 6150
278 Ga0395901_0000987 3300038443 Bacteria 30708
279 Ga0395901_0001357 3300038443 Bacteria 25621
280 Ga0395901_0001794 3300038443 Bacteria 22140
281 Ga0436365_0261205 3300039437 Bacteria 3963
282 Ga0451577_0035741 3300042876 Bacteria 4475
283 Ga0466972_0000036 3300044658 Bacteria 146007
284 Ga0466972_0006163 3300044658 Bacteria 6025
285 Ga0466966_0016806 3300044684 Bacteria 4834
286 Ga0453684_0010891 3300044712 Bacteria 15401
287 Ga0466959_0001443 3300045049 Bacteria 14558
288 Ga0495629_0043849 3300046459 Unclassified 3140
289 Ga0495650_0000025 3300046471 Bacteria 486001
290 Ga0495650_0018467 3300046471 Bacteria 3464
291 Ga0495580_0015364 3300046472 Bacteria 5775
292 Ga0495585_0000018 3300046492 Bacteria 162473
293 Ga0495606_0000026 3300046507 Bacteria 259118
294 Ga0495606_0005486 3300046507 Bacteria 12139
295 Ga0495606_0016907 3300046507 Bacteria 5538
296 Ga0495610_0001506 3300046512 Bacteria 20469
297 Ga0495616_0006760 3300046513 Bacteria 6915
298 Ga0495648_0001332 3300046524 Bacteria 24462
299 Ga0495648_0002037 3300046524 Bacteria 19167
300 Ga0495648_0020521 3300046524 Bacteria 4605
301 Ga0495648_0024387 3300046524 Bacteria 4121
302 Ga0495663_0002124 3300046525 Bacteria 6067
303 Ga0495609_0007233 3300046538 Bacteria 5569
304 Ga0495609_0022945 3300046538 Bacteria 2873
305 Ga0495633_0000027 3300046558 Bacteria 204613
306 Ga0495633_0001125 3300046558 Bacteria 21482
307 Ga0495668_0000112 3300046616 Bacteria 128501
308 Ga0495611_0000079 3300046648 Bacteria 68471
309 Ga0495625_0000008 3300046660 Bacteria 536165
310 Ga0495625_0000785 3300046660 Bacteria 44141
311 Ga0495625_0001065 3300046660 Bacteria 35829
312 Ga0495661_0001927 3300046665 Bacteria 16511
313 Ga0495649_0000006 3300046694 Bacteria 542188
314 Ga0495660_0023160 3300046810 Bacteria 3544
315 Ga0495687_000031 3300047443 Bacteria 274659
316 Ga0495687_000158 3300047443 Bacteria 103129
317 Ga0495687_002101 3300047443 Bacteria 16699
318 Ga0495686_0000005 3300047472 Bacteria 827143
319 Ga0495686_0000306 3300047472 Bacteria 83341
320 Ga0495678_001295 3300049459 Bacteria 20204
321 Ga0501070_0033734 3300049586 Bacteria 4284
322 Ga0501071_0078491 3300049587 Bacteria 2413
323 Ga0501083_0026660 3300049744 Bacteria 3992
324 nmdc:mga0k408_9937_c1 3300050493 Bacteria 5138
325 Ga0500644_0000259 3300053088 Bacteria 30005
326 Ga0500618_000040 3300053125 Bacteria 112548
327 Ga0500559_0006948 3300053136 Bacteria 5061
328 Ga0500577_0000492 3300053142 Bacteria 10152
329 Ga0500590_029941 3300053148 Unclassified 2825
330 Ga0500622_0000923 3300053156 Bacteria 24952
331 Ga0500622_0009454 3300053156 Bacteria 5395
332 Ga0500624_000135 3300053157 Bacteria 31636
333 Ga0500637_0011351 3300053178 Bacteria 4604
334 Ga0500661_000248 3300055283 Bacteria 9693
335 Ga0501082_0057793 3300060353 Unclassified 3341

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005563 Ga0068855_100041045 Ga0068855_1000410451 763
2 3300025949 Ga0207667_10029218 Ga0207667_100292187 763
3 3300049587 Ga0501071_0078491 Ga0501071_0078491_20_2332 763
4 3300045049 Ga0466959_0001443 Ga0466959_0001443_4695_7055 775
5 3300031251 Ga0265327_10000048 Ga0265327_10000048102 780
6 3300009545 Ga0105237_10012154 Ga0105237_100121547 783
7 3300025914 Ga0207671_10016933 Ga0207671_100169333 783
8 3300025949 Ga0207667_10130993 Ga0207667_101309931 783
9 3300014497 Ga0182008_10014547 Ga0182008_100145472 785
10 3300005563 Ga0068855_100023764 Ga0068855_1000237645 787
11 3300025949 Ga0207667_10031526 Ga0207667_100315264 787
12 3300050493 nmdc:mga0k408_9937_c1 nmdc:mga0k408_9937_c1_51_2414 787
13 3300013102 Ga0157371_10010446 Ga0157371_100104462 788
14 3300046507 Ga0495606_0016907 Ga0495606_0016907_1873_4302 788
15 3300046525 Ga0495663_0002124 Ga0495663_0002124_2260_4689 788
16 3300009545 Ga0105237_10037161 Ga0105237_100371612 789
17 3300025914 Ga0207671_10008358 Ga0207671_100083586 789
18 3300037466 Ga0395898_0010250 Ga0395898_0010250_5233_7665 789
19 3300003316 rootH1_10015087 rootH1_100150879 790
20 3300003323 rootH1_10155099 rootH1_101550992 790
21 3300009545 Ga0105237_10032297 Ga0105237_100322971 790
22 3300013102 Ga0157371_10026403 Ga0157371_100264033 790
23 3300025913 Ga0207695_10010167 Ga0207695_100101678 790
24 3300037466 Ga0395898_0115141 Ga0395898_0115141_31_2505 790
25 3300005530 Ga0070679_100059583 Ga0070679_1000595833 792
26 3300009093 Ga0105240_10000472 Ga0105240_1000047241 792
27 3300009174 Ga0105241_10004626 Ga0105241_100046263 792
28 3300009545 Ga0105237_10017015 Ga0105237_100170152 792
29 3300009551 Ga0105238_10000689 Ga0105238_100006896 792
30 3300010375 Ga0105239_10022256 Ga0105239_100222562 792
31 3300025914 Ga0207671_10030509 Ga0207671_100305092 792
32 3300005843 Ga0068860_100014411 Ga0068860_1000144114 793
33 3300009551 Ga0105238_10039903 Ga0105238_100399032 793
34 3300010375 Ga0105239_10047628 Ga0105239_100476282 793
35 3300013104 Ga0157370_10014812 Ga0157370_100148123 793
36 3300013105 Ga0157369_10058537 Ga0157369_100585373 793
37 3300013307 Ga0157372_10000080 Ga0157372_1000008075 793
38 3300028381 Ga0268264_10028196 Ga0268264_100281962 793
39 3300031251 Ga0265327_10001630 Ga0265327_1000163010 793
40 3300005563 Ga0068855_100002649 Ga0068855_10000264911 794
41 3300009093 Ga0105240_10034681 Ga0105240_100346817 794
42 3300009545 Ga0105237_10010190 Ga0105237_100101905 794
43 3300013104 Ga0157370_10004808 Ga0157370_100048082 794
44 3300013307 Ga0157372_10010926 Ga0157372_100109266 794
45 3300031730 Ga0307516_10000246 Ga0307516_1000024610 794
46 3300038443 Ga0395901_0001357 Ga0395901_0001357_15330_17789 794
47 3300006237 Ga0097621_100006975 Ga0097621_1000069751 795
48 3300006358 Ga0068871_100003730 Ga0068871_1000037308 795
49 3300009093 Ga0105240_10011237 Ga0105240_100112379 795
50 3300025913 Ga0207695_10000146 Ga0207695_100001469 795
51 3300047472 Ga0495686_0000005 Ga0495686_0000005_61894_64365 795
52 3300013296 Ga0157374_10000025 Ga0157374_10000025135 796
53 3300014969 Ga0157376_10000106 Ga0157376_1000010635 796
54 3300028573 Ga0265334_10006818 Ga0265334_100068184 796
55 3300005539 Ga0068853_100001508 Ga0068853_1000015082 797
56 3300009093 Ga0105240_10000155 Ga0105240_100001557 797
57 3300009545 Ga0105237_10013960 Ga0105237_100139603 797
58 3300009551 Ga0105238_10066572 Ga0105238_100665722 797
59 3300010375 Ga0105239_10006393 Ga0105239_1000639315 797
60 3300013104 Ga0157370_10000405 Ga0157370_1000040519 797
61 3300025913 Ga0207695_10000043 Ga0207695_1000004323 797
62 3300025913 Ga0207695_10067810 Ga0207695_100678103 797
63 3300026041 Ga0207639_10002969 Ga0207639_1000296913 797
64 3300049744 Ga0501083_0026660 Ga0501083_0026660_264_2732 797
65 3300006237 Ga0097621_100003725 Ga0097621_1000037252 798
66 3300006358 Ga0068871_100002260 Ga0068871_10000226010 798
67 3300014969 Ga0157376_10021603 Ga0157376_100216032 798
68 3300014969 Ga0157376_10039493 Ga0157376_100394931 798
69 3300014969 Ga0157376_10040223 Ga0157376_100402231 798
70 3300044658 Ga0466972_0000036 Ga0466972_0000036_140313_142742 798
71 3300046459 Ga0495629_0043849 Ga0495629_0043849_84_2549 799
72 3300046472 Ga0495580_0015364 Ga0495580_0015364_1989_4454 799
73 iso_pu_bacteria 2739367874 2740057924 799
74 3300003320 rootH2_10005185 rootH2_100051857 800
75 3300005335 Ga0070666_10015795 Ga0070666_100157952 800
76 3300005364 Ga0070673_100009990 Ga0070673_1000099903 800
77 3300005436 Ga0070713_100037075 Ga0070713_1000370751 800
78 3300005548 Ga0070665_100001841 Ga0070665_10000184122 800
79 3300005618 Ga0068864_100022115 Ga0068864_1000221152 800
80 3300005842 Ga0068858_100026708 Ga0068858_1000267081 800
81 3300006358 Ga0068871_100047658 Ga0068871_1000476583 800
82 3300009177 Ga0105248_10091532 Ga0105248_100915322 800
83 3300009545 Ga0105237_10000061 Ga0105237_1000006187 800
84 3300013297 Ga0157378_10016741 Ga0157378_100167414 800
85 3300013306 Ga0163162_10020645 Ga0163162_100206453 800
86 3300013307 Ga0157372_10109486 Ga0157372_101094863 800
87 3300014968 Ga0157379_10008588 Ga0157379_100085885 800
88 3300014969 Ga0157376_10022553 Ga0157376_100225533 800
89 3300025914 Ga0207671_10001487 Ga0207671_1000148712 800
90 3300025928 Ga0207700_10027741 Ga0207700_100277413 800
91 3300025933 Ga0207706_10014095 Ga0207706_100140956 800
92 3300025940 Ga0207691_10002284 Ga0207691_100022846 800
93 3300025941 Ga0207711_10071525 Ga0207711_100715252 800
94 3300025972 Ga0207668_10004746 Ga0207668_100047463 800
95 3300026035 Ga0207703_10007544 Ga0207703_100075444 800
96 3300030521 Ga0307511_10000509 Ga0307511_1000050934 800
97 3300039437 Ga0436365_0261205 Ga0436365_0261205_64_2535 800
98 3300033180 Ga0307510_10002732 Ga0307510_1000273215 801
99 3300044684 Ga0466966_0016806 Ga0466966_0016806_1733_4240 801
100 3300025913 Ga0207695_10001656 Ga0207695_1000165622 802
101 3300031251 Ga0265327_10000099 Ga0265327_10000099113 802
102 3300031344 Ga0265316_10013847 Ga0265316_100138473 802
103 3300042876 Ga0451577_0035741 Ga0451577_0035741_376_2814 802
104 3300044712 Ga0453684_0010891 Ga0453684_0010891_11392_13830 802
105 3300005539 Ga0068853_100005465 Ga0068853_10000546510 803
106 3300005577 Ga0068857_100002912 Ga0068857_1000029125 803
107 3300005616 Ga0068852_100004973 Ga0068852_1000049739 803
108 3300009093 Ga0105240_10001144 Ga0105240_1000114430 803
109 3300009174 Ga0105241_10005212 Ga0105241_100052128 803
110 3300009545 Ga0105237_10068015 Ga0105237_100680152 803
111 3300009545 Ga0105237_10080640 Ga0105237_100806402 803
112 3300009551 Ga0105238_10010861 Ga0105238_100108614 803
113 3300009551 Ga0105238_10082584 Ga0105238_100825842 803
114 3300013104 Ga0157370_10003729 Ga0157370_1000372919 803
115 3300013105 Ga0157369_10016348 Ga0157369_100163487 803
116 3300013307 Ga0157372_10000491 Ga0157372_100004919 803
117 3300025913 Ga0207695_10011088 Ga0207695_100110884 803
118 3300025914 Ga0207671_10003937 Ga0207671_100039373 803
119 3300025949 Ga0207667_10000913 Ga0207667_1000091325 803
120 3300026116 Ga0207674_10004216 Ga0207674_1000421610 803
121 3300026142 Ga0207698_10028133 Ga0207698_100281333 803
122 3300031507 Ga0307509_10027856 Ga0307509_100278563 803
123 3300037471 Ga0395905_0001098 Ga0395905_0001098_24631_27096 803
124 3300005336 Ga0070680_100025293 Ga0070680_1000252932 804
125 3300005337 Ga0070682_100000462 Ga0070682_1000004628 804
126 3300005530 Ga0070679_100000650 Ga0070679_1000006506 804
127 3300005539 Ga0068853_100018593 Ga0068853_1000185933 804
128 3300005547 Ga0070693_100016883 Ga0070693_1000168833 804
129 3300005563 Ga0068855_100070227 Ga0068855_1000702272 804
130 3300005843 Ga0068860_100000006 Ga0068860_100000006196 804
131 3300009093 Ga0105240_10001908 Ga0105240_1000190831 804
132 3300009093 Ga0105240_10012734 Ga0105240_100127348 804
133 3300009093 Ga0105240_10014688 Ga0105240_100146887 804
134 3300009174 Ga0105241_10001652 Ga0105241_1000165213 804
135 3300010375 Ga0105239_10000537 Ga0105239_1000053742 804
136 3300013104 Ga0157370_10011156 Ga0157370_100111567 804
137 3300013306 Ga0163162_10002657 Ga0163162_100026575 804
138 3300025911 Ga0207654_10001648 Ga0207654_100016489 804
139 3300025912 Ga0207707_10004161 Ga0207707_100041619 804
140 3300025913 Ga0207695_10041655 Ga0207695_100416552 804
141 3300025917 Ga0207660_10000723 Ga0207660_1000072317 804
142 3300025921 Ga0207652_10000397 Ga0207652_100003978 804
143 3300025949 Ga0207667_10029386 Ga0207667_100293863 804
144 3300028381 Ga0268264_10000640 Ga0268264_1000064026 804
145 3300030521 Ga0307511_10000138 Ga0307511_1000013816 804
146 3300033180 Ga0307510_10000416 Ga0307510_1000041610 804
147 3300046524 Ga0495648_0002037 Ga0495648_0002037_4072_6669 804
148 3300047443 Ga0495687_000158 Ga0495687_000158_12129_14609 804
149 3300053156 Ga0500622_0000923 Ga0500622_0000923_17647_20244 804
150 3300053178 Ga0500637_0011351 Ga0500637_0011351_580_3060 804
151 3300005335 Ga0070666_10000026 Ga0070666_1000002692 805
152 3300005335 Ga0070666_10000031 Ga0070666_1000003167 805
153 3300005577 Ga0068857_100087958 Ga0068857_1000879581 805
154 3300005616 Ga0068852_100005573 Ga0068852_1000055732 805
155 3300005617 Ga0068859_100000045 Ga0068859_10000004570 805
156 3300005617 Ga0068859_100000047 Ga0068859_10000004754 805
157 3300005618 Ga0068864_100001153 Ga0068864_10000115317 805
158 3300005618 Ga0068864_100007922 Ga0068864_1000079224 805
159 3300005834 Ga0068851_10011151 Ga0068851_100111513 805
160 3300005841 Ga0068863_100003352 Ga0068863_10000335211 805
161 3300005843 Ga0068860_100005946 Ga0068860_1000059463 805
162 3300005983 Ga0081540_1007357 Ga0081540_10073578 805
163 3300005983 Ga0081540_1012762 Ga0081540_10127622 805
164 3300006931 Ga0097620_100000045 Ga0097620_10000004571 805
165 3300006931 Ga0097620_100000047 Ga0097620_10000004754 805
166 3300009174 Ga0105241_10000616 Ga0105241_100006167 805
167 3300009545 Ga0105237_10002015 Ga0105237_100020152 805
168 3300009545 Ga0105237_10006920 Ga0105237_100069207 805
169 3300009553 Ga0105249_10001437 Ga0105249_100014374 805
170 3300009553 Ga0105249_10007946 Ga0105249_100079465 805
171 3300010375 Ga0105239_10108070 Ga0105239_101080702 805
172 3300013296 Ga0157374_10000003 Ga0157374_10000003448 805
173 3300013306 Ga0163162_10001051 Ga0163162_1000105121 805
174 3300014968 Ga0157379_10028763 Ga0157379_100287633 805
175 3300025903 Ga0207680_10000025 Ga0207680_1000002555 805
176 3300025903 Ga0207680_10000141 Ga0207680_100001411 805
177 3300025911 Ga0207654_10001512 Ga0207654_100015126 805
178 3300025911 Ga0207654_10005323 Ga0207654_100053232 805
179 3300025940 Ga0207691_10068228 Ga0207691_100682283 805
180 3300025942 Ga0207689_10000416 Ga0207689_1000041627 805
181 3300025942 Ga0207689_10002535 Ga0207689_1000253510 805
182 3300025949 Ga0207667_10000445 Ga0207667_1000044523 805
183 3300025961 Ga0207712_10001513 Ga0207712_1000151311 805
184 3300026035 Ga0207703_10025227 Ga0207703_100252273 805
185 3300026088 Ga0207641_10000038 Ga0207641_1000003865 805
186 3300026088 Ga0207641_10000146 Ga0207641_1000014664 805
187 3300026116 Ga0207674_10001573 Ga0207674_100015737 805
188 3300026142 Ga0207698_10017030 Ga0207698_100170302 805
189 3300028381 Ga0268264_10003376 Ga0268264_100033763 805
190 3300028381 Ga0268264_10015093 Ga0268264_100150934 805
191 3300031456 Ga0307513_10112235 Ga0307513_101122351 805
192 3300031507 Ga0307509_10044688 Ga0307509_100446883 805
193 3300031616 Ga0307508_10002720 Ga0307508_100027208 805
194 3300038443 Ga0395901_0000987 Ga0395901_0000987_25316_27790 805
195 3300060353 Ga0501082_0057793 Ga0501082_0057793_110_2554 805
196 3300005539 Ga0068853_100032422 Ga0068853_1000324223 806
197 3300009093 Ga0105240_10003587 Ga0105240_1000358713 806
198 3300009093 Ga0105240_10046964 Ga0105240_100469643 806
199 3300010375 Ga0105239_10002895 Ga0105239_100028954 806
200 3300031730 Ga0307516_10001145 Ga0307516_1000114526 806
201 3300037312 Ga0395899_0000064 Ga0395899_0000064_126755_129253 806
202 3300046648 Ga0495611_0000079 Ga0495611_0000079_23017_25560 806
203 3300005327 Ga0070658_10053581 Ga0070658_100535812 807
204 3300005329 Ga0070683_100000629 Ga0070683_10000062919 807
205 3300005336 Ga0070680_100012535 Ga0070680_1000125357 807
206 3300005530 Ga0070679_100001610 Ga0070679_10000161016 807
207 3300005530 Ga0070679_100007939 Ga0070679_1000079392 807
208 3300005530 Ga0070679_100031034 Ga0070679_1000310342 807
209 3300005535 Ga0070684_100003856 Ga0070684_1000038565 807
210 3300005548 Ga0070665_100000018 Ga0070665_100000018196 807
211 3300005563 Ga0068855_100001212 Ga0068855_10000121226 807
212 3300005563 Ga0068855_100036898 Ga0068855_1000368983 807
213 3300005843 Ga0068860_100000040 Ga0068860_100000040111 807
214 3300009093 Ga0105240_10002330 Ga0105240_100023304 807
215 3300009093 Ga0105240_10019262 Ga0105240_100192625 807
216 3300009174 Ga0105241_10018498 Ga0105241_100184982 807
217 3300009545 Ga0105237_10002084 Ga0105237_1000208418 807
218 3300009545 Ga0105237_10008408 Ga0105237_100084085 807
219 3300009545 Ga0105237_10028913 Ga0105237_100289132 807
220 3300010375 Ga0105239_10000155 Ga0105239_1000015576 807
221 3300010375 Ga0105239_10011055 Ga0105239_100110555 807
222 3300013100 Ga0157373_10042932 Ga0157373_100429322 807
223 3300013102 Ga0157371_10027789 Ga0157371_100277891 807
224 3300013105 Ga0157369_10039456 Ga0157369_100394562 807
225 3300013306 Ga0163162_10002669 Ga0163162_100026695 807
226 3300013307 Ga0157372_10071999 Ga0157372_100719993 807
227 3300025909 Ga0207705_10026247 Ga0207705_100262474 807
228 3300025909 Ga0207705_10049905 Ga0207705_100499051 807
229 3300025913 Ga0207695_10000282 Ga0207695_100002829 807
230 3300025913 Ga0207695_10006618 Ga0207695_100066187 807
231 3300025914 Ga0207671_10001661 Ga0207671_100016617 807
232 3300025914 Ga0207671_10022650 Ga0207671_100226503 807
233 3300025921 Ga0207652_10000210 Ga0207652_100002107 807
234 3300025921 Ga0207652_10048277 Ga0207652_100482772 807
235 3300025944 Ga0207661_10005151 Ga0207661_100051515 807
236 3300025949 Ga0207667_10000838 Ga0207667_100008384 807
237 3300025949 Ga0207667_10006449 Ga0207667_100064498 807
238 3300026041 Ga0207639_10016323 Ga0207639_100163231 807
239 3300028379 Ga0268266_10000026 Ga0268266_10000026165 807
240 3300028381 Ga0268264_10000015 Ga0268264_1000001538 807
241 3300028381 Ga0268264_10000019 Ga0268264_10000019134 807
242 3300028381 Ga0268264_10000054 Ga0268264_10000054232 807
243 3300037312 Ga0395899_0004788 Ga0395899_0004788_1756_4218 807
244 3300037418 Ga0395900_0013108 Ga0395900_0013108_4715_7177 807
245 3300037466 Ga0395898_0000730 Ga0395898_0000730_13542_16004 807
246 3300038443 Ga0395901_0001794 Ga0395901_0001794_11142_13604 807
247 3300046507 Ga0495606_0005486 Ga0495606_0005486_2140_4659 807
248 3300046524 Ga0495648_0001332 Ga0495648_0001332_15219_17702 807
249 3300047443 Ga0495687_000031 Ga0495687_000031_177383_179881 807
250 3300005338 Ga0068868_100005055 Ga0068868_1000050553 808
251 3300005617 Ga0068859_100011894 Ga0068859_1000118943 808
252 3300006931 Ga0097620_100011894 Ga0097620_1000118943 808
253 3300028786 Ga0307517_10003459 Ga0307517_1000345915 808
254 3300031251 Ga0265327_10000055 Ga0265327_10000055217 808
255 3300005336 Ga0070680_100009300 Ga0070680_1000093003 809
256 3300005458 Ga0070681_10072636 Ga0070681_100726363 809
257 3300005563 Ga0068855_100022378 Ga0068855_1000223783 809
258 3300005563 Ga0068855_100062203 Ga0068855_1000622032 809
259 3300013100 Ga0157373_10007972 Ga0157373_100079726 809
260 3300013100 Ga0157373_10010186 Ga0157373_100101863 809
261 3300013102 Ga0157371_10005373 Ga0157371_100053737 809
262 3300013102 Ga0157371_10006742 Ga0157371_100067425 809
263 3300013102 Ga0157371_10012930 Ga0157371_100129305 809
264 3300013104 Ga0157370_10001205 Ga0157370_1000120511 809
265 3300013104 Ga0157370_10083860 Ga0157370_100838602 809
266 3300013307 Ga0157372_10060194 Ga0157372_100601944 809
267 3300025912 Ga0207707_10053100 Ga0207707_100531002 809
268 3300025912 Ga0207707_10055934 Ga0207707_100559343 809
269 3300025917 Ga0207660_10018419 Ga0207660_100184192 809
270 3300025919 Ga0207657_10079957 Ga0207657_100799572 809
271 3300025921 Ga0207652_10008482 Ga0207652_100084826 809
272 3300025949 Ga0207667_10057044 Ga0207667_100570442 809
273 3300037466 Ga0395898_0004015 Ga0395898_0004015_3971_6445 809
274 3300037471 Ga0395905_0021197 Ga0395905_0021197_110_2584 809
275 3300046524 Ga0495648_0024387 Ga0495648_0024387_823_3255 809
276 3300046660 Ga0495625_0001065 Ga0495625_0001065_11753_14185 809
277 3300049586 Ga0501070_0033734 Ga0501070_0033734_768_3242 809
278 3300003323 rootH1_10137103 rootH1_101371031 810
279 3300013297 Ga0157378_10030229 Ga0157378_100302297 810
280 3300031251 Ga0265327_10014945 Ga0265327_100149453 810
281 3300046492 Ga0495585_0000018 Ga0495585_0000018_107176_109608 810
282 3300044658 Ga0466972_0006163 Ga0466972_0006163_2405_4861 813
283 iso_pu_bacteria 2884791551 2884796980 813
284 iso_pu_bacteria 2929239360 2929239911 814
285 3300003761 Ga0055535_1001897 Ga0055535_10018973 815
286 3300025242 Ga0209258_100029 Ga0209258_100029398 815
287 3300025254 Ga0209148_1000194 Ga0209148_100019410 815
288 3300053088 Ga0500644_0000259 Ga0500644_0000259_5361_7835 815
289 3300053136 Ga0500559_0006948 Ga0500559_0006948_296_2770 815
290 3300053142 Ga0500577_0000492 Ga0500577_0000492_4403_6877 815
291 3300053148 Ga0500590_029941 Ga0500590_029941_254_2728 815
292 3300055283 Ga0500661_000248 Ga0500661_000248_2092_4584 816
293 iso_pu_bacteria 2977232053 2977235531 816
294 iso_pu_bacteria 2599185184 2599480209 817
295 iso_pu_bacteria 2919437846 2919439437 817
296 3300053156 Ga0500622_0009454 Ga0500622_0009454_805_3261 818
297 3300010375 Ga0105239_10005530 Ga0105239_100055309 819
298 3300013307 Ga0157372_10041498 Ga0157372_100414983 819
299 3300002737 JGI25162J39368_1000408 JGI25162J39368_10004082 820
300 3300003323 rootH1_10074488 rootH1_100744885 820
301 3300005366 Ga0070659_100000372 Ga0070659_10000037211 820
302 3300006195 Ga0075366_10009273 Ga0075366_100092732 820
303 3300009545 Ga0105237_10061367 Ga0105237_100613672 820
304 3300010375 Ga0105239_10003947 Ga0105239_100039475 820
305 3300010375 Ga0105239_10020209 Ga0105239_100202094 820
306 3300025233 Ga0209437_100144 Ga0209437_100144107 820
307 3300025914 Ga0207671_10008559 Ga0207671_100085593 820
308 3300025914 Ga0207671_10028171 Ga0207671_100281712 820
309 3300025932 Ga0207690_10000508 Ga0207690_100005087 820
310 3300046471 Ga0495650_0018467 Ga0495650_0018467_293_2758 820
311 3300046513 Ga0495616_0006760 Ga0495616_0006760_768_3233 820
312 3300046524 Ga0495648_0020521 Ga0495648_0020521_670_3159 820
313 3300046538 Ga0495609_0007233 Ga0495609_0007233_1984_4449 820
314 3300046616 Ga0495668_0000112 Ga0495668_0000112_63714_66179 820
315 3300046660 Ga0495625_0000785 Ga0495625_0000785_20084_22549 820
316 3300046810 Ga0495660_0023160 Ga0495660_0023160_571_3036 820
317 3300047472 Ga0495686_0000306 Ga0495686_0000306_4420_6885 820
318 3300049459 Ga0495678_001295 Ga0495678_001295_4714_7179 820
319 3300053125 Ga0500618_000040 Ga0500618_000040_10037_12502 820
320 3300053157 Ga0500624_000135 Ga0500624_000135_9959_12427 820
321 3300002067 JGI24735J21928_10000029 JGI24735J21928_1000002915 821
322 3300003316 rootH1_10023928 rootH1_1002392813 821
323 3300003320 rootH2_10071355 rootH2_100713551 821
324 3300003322 rootL2_10092265 rootL2_100922652 821
325 3300013105 Ga0157369_10031341 Ga0157369_100313412 821
326 3300013306 Ga0163162_10021495 Ga0163162_100214954 821
327 3300013307 Ga0157372_10002023 Ga0157372_100020237 821
328 3300028794 Ga0307515_10001027 Ga0307515_1000102730 821
329 3300028794 Ga0307515_10001736 Ga0307515_1000173618 821
330 3300033179 Ga0307507_10000036 Ga0307507_1000003636 821
331 3300046471 Ga0495650_0000025 Ga0495650_0000025_165367_167832 821
332 3300046507 Ga0495606_0000026 Ga0495606_0000026_175380_177848 821
333 3300046512 Ga0495610_0001506 Ga0495610_0001506_15119_17584 821
334 3300046538 Ga0495609_0022945 Ga0495609_0022945_256_2721 821
335 3300046558 Ga0495633_0000027 Ga0495633_0000027_63475_65943 821
336 3300046558 Ga0495633_0001125 Ga0495633_0001125_7718_10183 821
337 3300046660 Ga0495625_0000008 Ga0495625_0000008_136042_138507 821
338 3300046665 Ga0495661_0001927 Ga0495661_0001927_7706_10171 821
339 3300046694 Ga0495649_0000006 Ga0495649_0000006_361542_364007 821
340 3300047443 Ga0495687_002101 Ga0495687_002101_7535_10000 821
341 iso_pu_bacteria 2928078545 2928083514 821
342 iso_pu_bacteria 2928147474 2928151222 821
343 iso_pu_bacteria 2932082852 2932084521 821

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07715

Plug

TonB-dependent Receptor Plug Domain

186

291

0.96

PF13715

CarbopepD_reg_2

CarboxypepD_reg-like domain

94

178

0.93

PF13620

CarboxypepD_reg

Carboxypeptidase regulatory-like domain

93

167

0.91

PF14905

OMP_b-brl_3

Outer membrane protein beta-barrel family

533

875

0.69

PF00593

TonB_dep_Rec_b-barrel

TonB dependent receptor-like, beta-barrel

307

839

0.66

Structural Annotation

Top 5 Hits

ID Description Score Start End
1qmu-assembly1.cif.gz_A duck carboxypeptidase d domain ii 0.878 19 99
6hif-assembly1.cif.gz_Y kuenenia stuttgartiensis hydrazine dehydrogenase complex 0.8726 18 97
4rvw-assembly1.cif.gz_A structure of the bacterial zn-transporter znud from neisseria meningitidis (soaked with 20 micromolar zinc) 0.8647 118 821
3rgm-assembly1.cif.gz_A crystal structure of spin-labeled btub t156r1 0.8641 107 821
1nqf-assembly1.cif.gz_A outer membrane cobalamin transporter (btub) from e. coli, methionine substiution construct for se-met sad phasing 0.8641 119 821
ID Description Score Start End Superfamily
af_P15087_375_469_2.60.40.1120 Mainly Beta;Sandwich;Immunoglobulin-like;Carboxypeptidase-like, regulatory domain 0.9241 23 100 2.60.40.1120
af_Q9JHW1_795_903_2.60.40.1120 Mainly Beta;Sandwich;Immunoglobulin-like;Carboxypeptidase-like, regulatory domain 0.9172 23 99 2.60.40.1120
af_E7F254_344_443_2.60.40.1120 Mainly Beta;Sandwich;Immunoglobulin-like;Carboxypeptidase-like, regulatory domain 0.9169 23 99 2.60.40.1120
af_F1RAC0_1040_1118_2.60.40.1120 Mainly Beta;Sandwich;Immunoglobulin-like;Carboxypeptidase-like, regulatory domain 0.916 23 99 2.60.40.1120
af_E7FFQ7_717_794_2.60.40.1120 Mainly Beta;Sandwich;Immunoglobulin-like;Carboxypeptidase-like, regulatory domain 0.915 24 99 2.60.40.1120
ID Description Score Start End GO Terms
AF-A0A1K1NX38-F1-model_v4 Iron complex outermembrane recepter protein 0.9758 99 821 GO:0009279
GO:0015344
AF-A0A0S7XMK4-F1-model_v4 Carboxypeptidase regulatory-like domain-containing protein 0.9436 19 99 GO:0016020
GO:0030246
AF-A0A836RV53-F1-model_v4 TonB-dependent receptor 0.9435 11 99 GO:0030246
AF-A0A1K1NX38-F1-model_v4 Iron complex outermembrane recepter protein 0.943 99 821 GO:0009279
GO:0015344
AF-A0A1L6LXA6-F1-model_v4 deleted 0.929 22 101

Feature Viewer

pLDDT pTM Quality
84.03 0.8 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map