F415520

General Info

Members Datasets Scaffolds Average Seq Length
343 199 686 126

Family's Representative Sequence

Representative Sequence 3300006186|Ga0075369_10526454|Ga0075369_105264542
Length 127
Sequence VPGGSRPARTPRGAAVVDIVLVLXXXXPVVFGILQVGLVLFVRNTLASAASEGARLAATSDRGPAEGAALTRAQINGAISGRYAQDVSARQVGQEVEVTVHARVPALGIGGPSIELTVTGHAVEEPP

Samples

Sample ID Description Type Environment
1 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
21 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
22 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
23 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
24 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
25 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
26 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
27 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
28 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
29 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
30 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
31 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
32 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
33 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
34 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
35 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
36 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
37 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
38 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
39 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
40 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
41 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
42 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
43 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
44 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
45 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
46 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
47 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
48 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
49 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
51 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
52 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
53 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
56 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
57 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
58 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
59 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
60 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
61 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
62 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
63 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
64 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
65 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
66 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
67 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
68 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
69 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
70 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
71 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
72 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
73 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
74 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
75 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
110 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
111 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
112 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
113 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
114 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
115 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
116 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
117 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
118 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
119 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
120 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
121 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
122 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
123 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
124 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
125 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
126 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
127 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
128 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
129 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
130 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
131 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
132 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
133 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
134 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
135 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
136 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
137 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
138 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
139 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
140 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
141 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
142 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
143 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
144 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
145 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
146 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
147 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
148 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
149 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
150 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
151 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
152 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
153 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
154 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
155 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
156 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
157 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
158 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
159 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
160 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
161 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
162 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
163 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
164 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
165 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
166 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
167 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
168 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
169 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
170 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
171 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
172 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
173 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
174 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
175 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
176 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
177 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
178 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
179 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
180 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
181 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
182 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
183 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
184 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
185 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
186 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
187 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
188 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
189 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
190 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
191 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
192 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
193 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
194 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
195 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
196 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
197 2643221615 Nocardioides sp. Root224 Isolate Unclassified
198 2643221657 Nocardioides sp. Root1257 Isolate Unclassified
199 2855386786 Nocardioides ferulae EGI 63112 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.25
Metatranscriptomes 0.87
Isolates 0.87

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.12
Nodule 0
Rhizoplane 16.33
Rhizosphere 74.64
Stem 0
Stem Tuber 0
Unclassified 1.46

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075369_10526454 3300006186 Bacteria 563
2 JGI24740J21852_10037710 3300001979 Bacteria 1489
3 JGI24735J21928_10036270 3300002067 Bacteria 1447
4 rootL2_10112001 3300003322 Bacteria 2185
5 Ga0006562J51391_1121498 3300003578 Bacteria 1060
6 Ga0070658_10330015 3300005327 Bacteria 1303
7 Ga0070683_100221223 3300005329 Bacteria 1799
8 Ga0070683_101531994 3300005329 Bacteria 641
9 Ga0068869_100134688 3300005334 Bacteria 1902
10 Ga0070680_100296052 3300005336 Bacteria 1372
11 Ga0070680_100301573 3300005336 Bacteria 1359
12 Ga0070682_100001993 3300005337 Bacteria 11387
13 Ga0070682_100117403 3300005337 Bacteria 1781
14 Ga0070682_100862132 3300005337 Bacteria 741
15 Ga0070682_101723353 3300005337 Bacteria 545
16 Ga0068868_100045513 3300005338 Bacteria 3433
17 Ga0070687_100028479 3300005343 Bacteria 2710
18 Ga0070661_100231197 3300005344 Bacteria 1421
19 Ga0070692_10009984 3300005345 Bacteria 4304
20 Ga0070692_10291493 3300005345 Bacteria 993
21 Ga0070669_100558288 3300005353 Bacteria 955
22 Ga0070675_100258862 3300005354 Bacteria 1524
23 Ga0070671_100386675 3300005355 Bacteria 1196
24 Ga0070671_101015049 3300005355 Bacteria 727
25 Ga0070659_100006302 3300005366 Bacteria 8574
26 Ga0070659_100174459 3300005366 Bacteria 1762
27 Ga0070667_100097343 3300005367 Bacteria 2538
28 Ga0070701_10093800 3300005438 Bacteria 1650
29 Ga0070705_100190792 3300005440 Bacteria 1396
30 Ga0070694_101456401 3300005444 Bacteria 579
31 Ga0070681_10061660 3300005458 Bacteria 3724
32 Ga0068867_100611959 3300005459 Bacteria 951
33 Ga0070707_100068463 3300005468 Bacteria 3417
34 Ga0070698_100006094 3300005471 Bacteria 13131
35 Ga0070679_100002938 3300005530 Bacteria 15518
36 Ga0070679_100419729 3300005530 Bacteria 1283
37 Ga0070684_100000939 3300005535 Bacteria 20742
38 Ga0070684_100163462 3300005535 Bacteria 2020
39 Ga0070684_100975583 3300005535 Bacteria 795
40 Ga0068853_100375519 3300005539 Bacteria 1327
41 Ga0070686_100059463 3300005544 Bacteria 2462
42 Ga0070693_100083717 3300005547 Bacteria 1907
43 Ga0070693_100469445 3300005547 Bacteria 887
44 Ga0070693_100999192 3300005547 Bacteria 633
45 Ga0070665_100004500 3300005548 Bacteria 14627
46 Ga0070665_100723701 3300005548 Bacteria 1008
47 Ga0068855_100117495 3300005563 Bacteria 3047
48 Ga0068857_100003785 3300005577 Bacteria 12722
49 Ga0068854_101001010 3300005578 Bacteria 740
50 Ga0070702_100008554 3300005615 Bacteria 4965
51 Ga0068852_100111955 3300005616 Bacteria 2483
52 Ga0068852_100507427 3300005616 Bacteria 1202
53 Ga0068859_100983754 3300005617 Bacteria 926
54 Ga0068864_100269440 3300005618 Bacteria 1586
55 Ga0068860_100000389 3300005843 Bacteria 57408
56 Ga0068860_100696810 3300005843 Bacteria 1025
57 Ga0068862_100215481 3300005844 Bacteria 1736
58 Ga0081539_10037654 3300005985 Bacteria 2878
59 Ga0075365_10046800 3300006038 Bacteria 2842
60 Ga0075365_10168439 3300006038 Bacteria 1529
61 Ga0075365_10291247 3300006038 Bacteria 1149
62 Ga0075365_10313983 3300006038 Bacteria 1103
63 Ga0075365_10583469 3300006038 Bacteria 791
64 Ga0075365_10686284 3300006038 Bacteria 723
65 Ga0075365_11107169 3300006038 Bacteria 557
66 Ga0075368_10529023 3300006042 Bacteria 528
67 Ga0075363_100076304 3300006048 Bacteria 1827
68 Ga0075364_10117153 3300006051 Bacteria 1781
69 Ga0075364_10446408 3300006051 Bacteria 884
70 Ga0070716_101266010 3300006173 Bacteria 595
71 Ga0075362_10011281 3300006177 Bacteria 3517
72 Ga0097621_100674221 3300006237 Bacteria 950
73 Ga0075434_101603662 3300006871 Bacteria 659
74 Ga0068865_100003345 3300006881 Bacteria 9604
75 Ga0068865_100125502 3300006881 Bacteria 1915
76 Ga0068865_100712365 3300006881 Bacteria 859
77 Ga0075436_100551216 3300006914 Bacteria 846
78 Ga0097620_100983796 3300006931 Bacteria 926
79 Ga0111539_12466792 3300009094 Bacteria 603
80 Ga0105245_10029783 3300009098 Bacteria 4825
81 Ga0105245_11400660 3300009098 Bacteria 749
82 Ga0105243_10061316 3300009148 Bacteria 3008
83 Ga0105242_10335550 3300009176 Bacteria 1392
84 Ga0105242_10546077 3300009176 Bacteria 1110
85 Ga0105242_12311217 3300009176 Bacteria 584
86 Ga0105248_10407960 3300009177 Bacteria 1530
87 Ga0105248_12198585 3300009177 Bacteria 628
88 Ga0105249_11597391 3300009553 Bacteria 725
89 Ga0105239_10002803 3300010375 Bacteria 21789
90 Ga0105246_10051016 3300011119 Bacteria 2839
91 Ga0157371_10365855 3300013102 Bacteria 1051
92 Ga0157369_10018940 3300013105 Bacteria 7712
93 Ga0157374_10647568 3300013296 Bacteria 1068
94 Ga0163162_10027254 3300013306 Bacteria 5650
95 Ga0163162_12426086 3300013306 Bacteria 603
96 Ga0163162_12912798 3300013306 Bacteria 550
97 Ga0157372_10006203 3300013307 Bacteria 12704
98 Ga0157372_11475966 3300013307 Bacteria 783
99 Ga0157375_10005951 3300013308 Bacteria 10631
100 Ga0157375_10246155 3300013308 Bacteria 1948
101 Ga0157375_10248338 3300013308 Bacteria 1940
102 Ga0157375_10251325 3300013308 Bacteria 1929
103 Ga0157375_10610627 3300013308 Bacteria 1249
104 Ga0163163_10101286 3300014325 Bacteria 2903
105 Ga0163163_10216643 3300014325 Bacteria 1963
106 Ga0157380_10490421 3300014326 Bacteria 1191
107 Ga0157376_10529822 3300014969 Bacteria 1162
108 Ga0163161_10063615 3300017792 Bacteria 2690
109 Ga0163161_10335202 3300017792 Bacteria 1199
110 Ga0163161_10342095 3300017792 Bacteria 1187
111 Ga0163161_12099373 3300017792 Bacteria 502
112 Ga0206354_10250222 3300020081 Bacteria 1028
113 Ga0206353_11782954 3300020082 Bacteria 738
114 Ga0213876_10580761 3300021384 Unclassified 596
115 Ga0207688_10053814 3300025901 Bacteria 2257
116 Ga0207647_10019678 3300025904 Bacteria 4537
117 Ga0207643_10399049 3300025908 Bacteria 869
118 Ga0207705_10045562 3300025909 Bacteria 3152
119 Ga0207705_10327276 3300025909 Bacteria 1178
120 Ga0207707_10029548 3300025912 Bacteria 4794
121 Ga0207660_10157183 3300025917 Bacteria 1751
122 Ga0207662_10042256 3300025918 Bacteria 2686
123 Ga0207657_10057283 3300025919 Bacteria 3358
124 Ga0207657_10072539 3300025919 Bacteria 2912
125 Ga0207649_10050492 3300025920 Bacteria 2573
126 Ga0207652_10009962 3300025921 Bacteria 7651
127 Ga0207652_11236700 3300025921 Bacteria 649
128 Ga0207646_10478963 3300025922 Bacteria 1122
129 Ga0207659_10217253 3300025926 Bacteria 1535
130 Ga0207659_11198831 3300025926 Bacteria 653
131 Ga0207687_10111502 3300025927 Bacteria 2031
132 Ga0207690_10008984 3300025932 Bacteria 5931
133 Ga0207690_10679113 3300025932 Bacteria 845
134 Ga0207686_10278469 3300025934 Bacteria 1234
135 Ga0207709_10038285 3300025935 Bacteria 2854
136 Ga0207709_10162442 3300025935 Bacteria 1559
137 Ga0207670_10537233 3300025936 Bacteria 954
138 Ga0207704_10070672 3300025938 Bacteria 2212
139 Ga0207704_10089078 3300025938 Bacteria 2021
140 Ga0207704_10367558 3300025938 Bacteria 1125
141 Ga0207691_10152774 3300025940 Bacteria 2029
142 Ga0207711_10448109 3300025941 Bacteria 1201
143 Ga0207711_10949343 3300025941 Unclassified 799
144 Ga0207689_10184108 3300025942 Bacteria 1722
145 Ga0207661_10058607 3300025944 Bacteria 3099
146 Ga0207661_10152324 3300025944 Bacteria 2000
147 Ga0207661_10709269 3300025944 Bacteria 926
148 Ga0207661_11208496 3300025944 Bacteria 695
149 Ga0207712_10507980 3300025961 Bacteria 1031
150 Ga0207712_10979642 3300025961 Bacteria 750
151 Ga0207658_10074416 3300025986 Bacteria 2581
152 Ga0207658_10747305 3300025986 Bacteria 886
153 Ga0207677_10164966 3300026023 Bacteria 1725
154 Ga0207678_11065730 3300026067 Bacteria 716
155 Ga0207708_10303352 3300026075 Bacteria 1299
156 Ga0207676_10275627 3300026095 Bacteria 1525
157 Ga0207674_10007945 3300026116 Bacteria 12316
158 Ga0207674_10220771 3300026116 Bacteria 1843
159 Ga0207683_10641675 3300026121 Bacteria 983
160 Ga0207698_10447011 3300026142 Bacteria 1247
161 Ga0207698_10569500 3300026142 Bacteria 1113
162 Ga0268266_10054354 3300028379 Bacteria 3440
163 Ga0268266_10468500 3300028379 Bacteria 1199
164 Ga0268265_10556934 3300028380 Bacteria 1089
165 Ga0268264_10000250 3300028381 Bacteria 100909
166 Ga0268264_11139247 3300028381 Bacteria 789
167 Ga0307405_11228369 3300031731 Bacteria 649
168 Ga0307413_10487811 3300031824 Bacteria 987
169 Ga0307410_10053520 3300031852 Bacteria 2732
170 Ga0307409_100044307 3300031995 Bacteria 3350
171 Ga0307409_100899800 3300031995 Bacteria 899
172 Ga0307409_102600888 3300031995 Bacteria 535
173 Ga0307416_101282187 3300032002 Bacteria 838
174 Ga0307414_11708761 3300032004 Bacteria 587
175 Ga0307411_11309435 3300032005 Bacteria 660
176 Ga0307415_100046883 3300032126 Bacteria 2906
177 Ga0307415_100951937 3300032126 Bacteria 795
178 Ga0373938_0071472 3300034957 Bacteria 830
179 Ga0395898_1434675 3300037466 Bacteria 617
180 Ga0395898_1863463 3300037466 Bacteria 522
181 Ga0436365_1525134 3300039437 Bacteria 744
182 Ga0436365_1829795 3300039437 Bacteria 700
183 Ga0451845_0931596 3300041501 Bacteria 955
184 Ga0451853_1102564 3300041512 Bacteria 1463
185 Ga0466965_0040154 3300044683 Bacteria 2303
186 Ga0466966_0554746 3300044684 Bacteria 691
187 Ga0466963_0085325 3300044694 Bacteria 2143
188 Ga0466963_0817823 3300044694 Bacteria 657
189 Ga0466964_0013168 3300044706 Bacteria 3136
190 Ga0466971_0018276 3300044719 Bacteria 3105
191 Ga0466968_0159494 3300044735 Bacteria 1040
192 Ga0466968_0179864 3300044735 Bacteria 983
193 Ga0466970_0474477 3300044765 Bacteria 719
194 Ga0466957_0482910 3300044842 Bacteria 857
195 Ga0466960_0074148 3300044901 Bacteria 1700
196 Ga0466960_0320166 3300044901 Bacteria 878
197 Ga0451576_0286004 3300045051 Bacteria 1724
198 Ga0466967_0072992 3300045976 Bacteria 3077
199 Ga0466967_0079100 3300045976 Bacteria 2963
200 Ga0466967_0287925 3300045976 Bacteria 1577
201 Ga0466967_0351788 3300045976 Bacteria 1426
202 Ga0466967_0534683 3300045976 Bacteria 1153
203 Ga0466967_1475831 3300045976 Bacteria 677
204 Ga0466967_1590581 3300045976 Bacteria 651
205 Ga0495603_0421281 3300046455 Bacteria 765
206 Ga0495629_0768713 3300046459 Bacteria 637
207 Ga0495658_0952547 3300046683 Bacteria 548
208 Ga0495600_0311222 3300046809 Bacteria 992
209 Ga0496100_0049431 3300048903 Bacteria 2720
210 Ga0496100_0219172 3300048903 Bacteria 1395
211 Ga0496100_0361078 3300048903 Bacteria 1099
212 Ga0496100_0621910 3300048903 Bacteria 840
213 Ga0496100_1261072 3300048903 Bacteria 583
214 Ga0496100_1423813 3300048903 Bacteria 547
215 Ga0496101_0026185 3300048904 Bacteria 4054
216 Ga0496101_0097605 3300048904 Bacteria 2194
217 Ga0496101_0210824 3300048904 Bacteria 1505
218 Ga0496102_0007936 3300048905 Bacteria 9073
219 Ga0496102_0014225 3300048905 Bacteria 6914
220 Ga0496102_0394802 3300048905 Bacteria 1301
221 Ga0496102_0516998 3300048905 Bacteria 1116
222 Ga0496103_0827196 3300048906 Unclassified 583
223 Ga0496104_0124437 3300048907 Bacteria 2476
224 Ga0496105_0024270 3300048908 Bacteria 4927
225 Ga0496105_0415223 3300048908 Bacteria 1066
226 Ga0496106_0556339 3300048909 Bacteria 920
227 Ga0496107_0021612 3300048910 Bacteria 4548
228 Ga0496107_0310292 3300048910 Bacteria 1174
229 Ga0496107_0889888 3300048910 Bacteria 649
230 Ga0496107_1101665 3300048910 Bacteria 574
231 Ga0496108_0190788 3300048911 Bacteria 1776
232 Ga0496108_0196788 3300048911 Bacteria 1748
233 Ga0496108_0202602 3300048911 Bacteria 1722
234 Ga0496108_0228944 3300048911 Bacteria 1616
235 Ga0496108_0935424 3300048911 Bacteria 743
236 Ga0496109_0011332 3300048912 Bacteria 7660
237 Ga0496109_0023312 3300048912 Bacteria 5492
238 Ga0496109_0055196 3300048912 Bacteria 3624
239 Ga0496109_0073196 3300048912 Bacteria 3148
240 Ga0496109_0242068 3300048912 Bacteria 1698
241 Ga0496109_0436760 3300048912 Bacteria 1237
242 Ga0496109_0490968 3300048912 Bacteria 1159
243 Ga0496109_0906014 3300048912 Bacteria 820
244 Ga0496110_0026214 3300048913 Bacteria 4985
245 Ga0496110_0113171 3300048913 Bacteria 2440
246 Ga0496110_0196645 3300048913 Bacteria 1831
247 Ga0496110_0471435 3300048913 Bacteria 1144
248 Ga0496110_0806089 3300048913 Bacteria 843
249 Ga0496111_0002454 3300048914 Bacteria 11190
250 Ga0496111_0267174 3300048914 Bacteria 1269
251 Ga0496111_0344861 3300048914 Bacteria 1103
252 Ga0496111_1132130 3300048914 Unclassified 557
253 Ga0496111_1237239 3300048914 Bacteria 528
254 Ga0496112_0357048 3300048915 Bacteria 1404
255 Ga0496112_0941691 3300048915 Bacteria 785
256 Ga0496113_0094506 3300048916 Bacteria 2310
257 Ga0496113_0357434 3300048916 Bacteria 1172
258 Ga0496114_0017206 3300048917 Bacteria 5831
259 Ga0496114_0040013 3300048917 Bacteria 3879
260 Ga0496114_0096407 3300048917 Bacteria 2518
261 Ga0496114_0164108 3300048917 Bacteria 1933
262 Ga0496114_0658265 3300048917 Bacteria 921
263 Ga0496115_0166925 3300048918 Bacteria 1820
264 Ga0496115_1354669 3300048918 Bacteria 527
265 Ga0501031_0016521 3300049568 Bacteria 4794
266 Ga0501032_0159881 3300049569 Bacteria 1479
267 Ga0501032_0188202 3300049569 Bacteria 1350
268 Ga0501034_0076974 3300049571 Bacteria 3342
269 Ga0501036_0023302 3300049572 Bacteria 5214
270 Ga0501036_0302135 3300049572 Bacteria 1338
271 Ga0501037_0015840 3300049573 Bacteria 5550
272 Ga0501038_0110964 3300049574 Bacteria 2272
273 Ga0501039_0167629 3300049575 Bacteria 1726
274 Ga0501039_0301327 3300049575 Unclassified 1260
275 Ga0501039_0524215 3300049575 Bacteria 930
276 Ga0501040_0015328 3300049576 Bacteria 5068
277 Ga0501041_0007539 3300049577 Bacteria 6388
278 Ga0501041_0009728 3300049577 Bacteria 5664
279 Ga0501041_0374947 3300049577 Bacteria 900
280 Ga0501042_0005886 3300049578 Bacteria 7928
281 Ga0501043_0182596 3300049579 Bacteria 1634
282 Ga0501046_0000746 3300049580 Bacteria 31351
283 Ga0501046_0013252 3300049580 Bacteria 6986
284 Ga0501046_0147174 3300049580 Bacteria 1778
285 Ga0501047_0018661 3300049581 Bacteria 6651
286 Ga0501047_0148190 3300049581 Bacteria 2223
287 Ga0501048_0019802 3300049582 Bacteria 4934
288 Ga0501067_0001140 3300049583 Bacteria 14406
289 Ga0501067_0221544 3300049583 Bacteria 1054
290 Ga0501068_0010706 3300049584 Bacteria 5156
291 Ga0501068_0049405 3300049584 Bacteria 2540
292 Ga0501069_0089133 3300049585 Bacteria 1744
293 Ga0501070_0001061 3300049586 Bacteria 24745
294 Ga0501070_0019487 3300049586 Bacteria 5689
295 Ga0501070_0119110 3300049586 Bacteria 2182
296 Ga0501070_0242044 3300049586 Bacteria 1477
297 Ga0501071_0004136 3300049587 Bacteria 9171
298 Ga0501071_0015619 3300049587 Bacteria 5213
299 Ga0501072_0020065 3300049588 Bacteria 5174
300 Ga0501072_0033426 3300049588 Bacteria 4030
301 Ga0501073_0004092 3300049589 Bacteria 10941
302 Ga0501073_0029375 3300049589 Bacteria 3930
303 Ga0501073_0187592 3300049589 Bacteria 1431
304 Ga0501073_0651983 3300049589 Bacteria 727
305 Ga0501074_0001028 3300049590 Bacteria 18144
306 Ga0501074_0018662 3300049590 Bacteria 5041
307 Ga0501074_0208477 3300049590 Bacteria 1392
308 Ga0501075_0057969 3300049591 Bacteria 2916
309 Ga0501076_0016257 3300049592 Bacteria 5638
310 Ga0501077_0035207 3300049593 Bacteria 3187
311 Ga0501077_0056575 3300049593 Bacteria 2490
312 Ga0501079_0021905 3300049741 Bacteria 4894
313 Ga0501079_0088765 3300049741 Bacteria 2394
314 Ga0501080_0013405 3300049742 Bacteria 7541
315 Ga0501080_0021376 3300049742 Bacteria 5990
316 Ga0501080_0054565 3300049742 Bacteria 3721
317 Ga0501081_0068925 3300049743 Bacteria 2463
318 Ga0501081_0225483 3300049743 Bacteria 1364
319 Ga0501083_0012109 3300049744 Bacteria 6039
320 Ga0501035_0020412 3300049822 Bacteria 6084
321 Ga0501035_1216564 3300049822 Bacteria 584
322 Ga0501044_0439829 3300049823 Bacteria 1212
323 Ga0501044_0491418 3300049823 Bacteria 1129
324 Ga0501045_0018904 3300049824 Bacteria 4906
325 nmdc:mga03683_233398_c1 3300050489 Bacteria 851
326 nmdc:mga00v17_108345_c1 3300050491 Bacteria 1760
327 nmdc:mga0yw44_121977_c1 3300050492 Bacteria 1679
328 nmdc:mga0yw44_289563_c1 3300050492 Bacteria 1096
329 nmdc:mga0sz30_343103_c1 3300050516 Bacteria 667
330 Ga0495619_0058301 3300053085 Bacteria 2563
331 Ga0500556_0007159 3300053104 Bacteria 3187
332 Ga0500593_038738 3300053117 Bacteria 2131
333 Ga0500573_0057841 3300053140 Bacteria 2224
334 Ga0501084_0011337 3300054114 Bacteria 7383
335 Ga0501084_0032339 3300054114 Bacteria 4376
336 Ga0501082_0017180 3300060353 Bacteria 6233
337 Ga0501082_1044362 3300060353 Bacteria 714
338 Ga0466962_0031933 3300061719 Bacteria 2521
339 Ga0530510_0014014 3300061734 Bacteria 5650
340 Ga0530510_0244159 3300061734 Bacteria 1337
341 2644091702 2643221615 Bacteria 5487866
342 2644321505 2643221657 Bacteria 5490246
343 2855388989 2855386786 Bacteria 4752232
344 Ga0075369_10526454
345 JGI24740J21852_10037710
346 JGI24735J21928_10036270
347 rootL2_10112001
348 Ga0006562J51391_1121498
349 Ga0070658_10330015
350 Ga0070683_100221223
351 Ga0070683_101531994
352 Ga0068869_100134688
353 Ga0070680_100296052
354 Ga0070680_100301573
355 Ga0070682_100001993
356 Ga0070682_100117403
357 Ga0070682_100862132
358 Ga0070682_101723353
359 Ga0068868_100045513
360 Ga0070687_100028479
361 Ga0070661_100231197
362 Ga0070692_10009984
363 Ga0070692_10291493
364 Ga0070669_100558288
365 Ga0070675_100258862
366 Ga0070671_100386675
367 Ga0070671_101015049
368 Ga0070659_100006302
369 Ga0070659_100174459
370 Ga0070667_100097343
371 Ga0070701_10093800
372 Ga0070705_100190792
373 Ga0070694_101456401
374 Ga0070681_10061660
375 Ga0068867_100611959
376 Ga0070707_100068463
377 Ga0070698_100006094
378 Ga0070679_100002938
379 Ga0070679_100419729
380 Ga0070684_100000939
381 Ga0070684_100163462
382 Ga0070684_100975583
383 Ga0068853_100375519
384 Ga0070686_100059463
385 Ga0070693_100083717
386 Ga0070693_100469445
387 Ga0070693_100999192
388 Ga0070665_100004500
389 Ga0070665_100723701
390 Ga0068855_100117495
391 Ga0068857_100003785
392 Ga0068854_101001010
393 Ga0070702_100008554
394 Ga0068852_100111955
395 Ga0068852_100507427
396 Ga0068859_100983754
397 Ga0068864_100269440
398 Ga0068860_100000389
399 Ga0068860_100696810
400 Ga0068862_100215481
401 Ga0081539_10037654
402 Ga0075365_10046800
403 Ga0075365_10168439
404 Ga0075365_10291247
405 Ga0075365_10313983
406 Ga0075365_10583469
407 Ga0075365_10686284
408 Ga0075365_11107169
409 Ga0075368_10529023
410 Ga0075363_100076304
411 Ga0075364_10117153
412 Ga0075364_10446408
413 Ga0070716_101266010
414 Ga0075362_10011281
415 Ga0097621_100674221
416 Ga0075434_101603662
417 Ga0068865_100003345
418 Ga0068865_100125502
419 Ga0068865_100712365
420 Ga0075436_100551216
421 Ga0097620_100983796
422 Ga0111539_12466792
423 Ga0105245_10029783
424 Ga0105245_11400660
425 Ga0105243_10061316
426 Ga0105242_10335550
427 Ga0105242_10546077
428 Ga0105242_12311217
429 Ga0105248_10407960
430 Ga0105248_12198585
431 Ga0105249_11597391
432 Ga0105239_10002803
433 Ga0105246_10051016
434 Ga0157371_10365855
435 Ga0157369_10018940
436 Ga0157374_10647568
437 Ga0163162_10027254
438 Ga0163162_12426086
439 Ga0163162_12912798
440 Ga0157372_10006203
441 Ga0157372_11475966
442 Ga0157375_10005951
443 Ga0157375_10246155
444 Ga0157375_10248338
445 Ga0157375_10251325
446 Ga0157375_10610627
447 Ga0163163_10101286
448 Ga0163163_10216643
449 Ga0157380_10490421
450 Ga0157376_10529822
451 Ga0163161_10063615
452 Ga0163161_10335202
453 Ga0163161_10342095
454 Ga0163161_12099373
455 Ga0206354_10250222
456 Ga0206353_11782954
457 Ga0213876_10580761
458 Ga0207688_10053814
459 Ga0207647_10019678
460 Ga0207643_10399049
461 Ga0207705_10045562
462 Ga0207705_10327276
463 Ga0207707_10029548
464 Ga0207660_10157183
465 Ga0207662_10042256
466 Ga0207657_10057283
467 Ga0207657_10072539
468 Ga0207649_10050492
469 Ga0207652_10009962
470 Ga0207652_11236700
471 Ga0207646_10478963
472 Ga0207659_10217253
473 Ga0207659_11198831
474 Ga0207687_10111502
475 Ga0207690_10008984
476 Ga0207690_10679113
477 Ga0207686_10278469
478 Ga0207709_10038285
479 Ga0207709_10162442
480 Ga0207670_10537233
481 Ga0207704_10070672
482 Ga0207704_10089078
483 Ga0207704_10367558
484 Ga0207691_10152774
485 Ga0207711_10448109
486 Ga0207711_10949343
487 Ga0207689_10184108
488 Ga0207661_10058607
489 Ga0207661_10152324
490 Ga0207661_10709269
491 Ga0207661_11208496
492 Ga0207712_10507980
493 Ga0207712_10979642
494 Ga0207658_10074416
495 Ga0207658_10747305
496 Ga0207677_10164966
497 Ga0207678_11065730
498 Ga0207708_10303352
499 Ga0207676_10275627
500 Ga0207674_10007945
501 Ga0207674_10220771
502 Ga0207683_10641675
503 Ga0207698_10447011
504 Ga0207698_10569500
505 Ga0268266_10054354
506 Ga0268266_10468500
507 Ga0268265_10556934
508 Ga0268264_10000250
509 Ga0268264_11139247
510 Ga0307405_11228369
511 Ga0307413_10487811
512 Ga0307410_10053520
513 Ga0307409_100044307
514 Ga0307409_100899800
515 Ga0307409_102600888
516 Ga0307416_101282187
517 Ga0307414_11708761
518 Ga0307411_11309435
519 Ga0307415_100046883
520 Ga0307415_100951937
521 Ga0373938_0071472
522 Ga0395898_1434675
523 Ga0395898_1863463
524 Ga0436365_1525134
525 Ga0436365_1829795
526 Ga0451845_0931596
527 Ga0451853_1102564
528 Ga0466965_0040154
529 Ga0466966_0554746
530 Ga0466963_0085325
531 Ga0466963_0817823
532 Ga0466964_0013168
533 Ga0466971_0018276
534 Ga0466968_0159494
535 Ga0466968_0179864
536 Ga0466970_0474477
537 Ga0466957_0482910
538 Ga0466960_0074148
539 Ga0466960_0320166
540 Ga0451576_0286004
541 Ga0466967_0072992
542 Ga0466967_0079100
543 Ga0466967_0287925
544 Ga0466967_0351788
545 Ga0466967_0534683
546 Ga0466967_1475831
547 Ga0466967_1590581
548 Ga0495603_0421281
549 Ga0495629_0768713
550 Ga0495658_0952547
551 Ga0495600_0311222
552 Ga0496100_0049431
553 Ga0496100_0219172
554 Ga0496100_0361078
555 Ga0496100_0621910
556 Ga0496100_1261072
557 Ga0496100_1423813
558 Ga0496101_0026185
559 Ga0496101_0097605
560 Ga0496101_0210824
561 Ga0496102_0007936
562 Ga0496102_0014225
563 Ga0496102_0394802
564 Ga0496102_0516998
565 Ga0496103_0827196
566 Ga0496104_0124437
567 Ga0496105_0024270
568 Ga0496105_0415223
569 Ga0496106_0556339
570 Ga0496107_0021612
571 Ga0496107_0310292
572 Ga0496107_0889888
573 Ga0496107_1101665
574 Ga0496108_0190788
575 Ga0496108_0196788
576 Ga0496108_0202602
577 Ga0496108_0228944
578 Ga0496108_0935424
579 Ga0496109_0011332
580 Ga0496109_0023312
581 Ga0496109_0055196
582 Ga0496109_0073196
583 Ga0496109_0242068
584 Ga0496109_0436760
585 Ga0496109_0490968
586 Ga0496109_0906014
587 Ga0496110_0026214
588 Ga0496110_0113171
589 Ga0496110_0196645
590 Ga0496110_0471435
591 Ga0496110_0806089
592 Ga0496111_0002454
593 Ga0496111_0267174
594 Ga0496111_0344861
595 Ga0496111_1132130
596 Ga0496111_1237239
597 Ga0496112_0357048
598 Ga0496112_0941691
599 Ga0496113_0094506
600 Ga0496113_0357434
601 Ga0496114_0017206
602 Ga0496114_0040013
603 Ga0496114_0096407
604 Ga0496114_0164108
605 Ga0496114_0658265
606 Ga0496115_0166925
607 Ga0496115_1354669
608 Ga0501031_0016521
609 Ga0501032_0159881
610 Ga0501032_0188202
611 Ga0501034_0076974
612 Ga0501036_0023302
613 Ga0501036_0302135
614 Ga0501037_0015840
615 Ga0501038_0110964
616 Ga0501039_0167629
617 Ga0501039_0301327
618 Ga0501039_0524215
619 Ga0501040_0015328
620 Ga0501041_0007539
621 Ga0501041_0009728
622 Ga0501041_0374947
623 Ga0501042_0005886
624 Ga0501043_0182596
625 Ga0501046_0000746
626 Ga0501046_0013252
627 Ga0501046_0147174
628 Ga0501047_0018661
629 Ga0501047_0148190
630 Ga0501048_0019802
631 Ga0501067_0001140
632 Ga0501067_0221544
633 Ga0501068_0010706
634 Ga0501068_0049405
635 Ga0501069_0089133
636 Ga0501070_0001061
637 Ga0501070_0019487
638 Ga0501070_0119110
639 Ga0501070_0242044
640 Ga0501071_0004136
641 Ga0501071_0015619
642 Ga0501072_0020065
643 Ga0501072_0033426
644 Ga0501073_0004092
645 Ga0501073_0029375
646 Ga0501073_0187592
647 Ga0501073_0651983
648 Ga0501074_0001028
649 Ga0501074_0018662
650 Ga0501074_0208477
651 Ga0501075_0057969
652 Ga0501076_0016257
653 Ga0501077_0035207
654 Ga0501077_0056575
655 Ga0501079_0021905
656 Ga0501079_0088765
657 Ga0501080_0013405
658 Ga0501080_0021376
659 Ga0501080_0054565
660 Ga0501081_0068925
661 Ga0501081_0225483
662 Ga0501083_0012109
663 Ga0501035_0020412
664 Ga0501035_1216564
665 Ga0501044_0439829
666 Ga0501044_0491418
667 Ga0501045_0018904
668 nmdc:mga03683_233398_c1
669 nmdc:mga00v17_108345_c1
670 nmdc:mga0yw44_121977_c1
671 nmdc:mga0yw44_289563_c1
672 nmdc:mga0sz30_343103_c1
673 Ga0495619_0058301
674 Ga0500556_0007159
675 Ga0500593_038738
676 Ga0500573_0057841
677 Ga0501084_0011337
678 Ga0501084_0032339
679 Ga0501082_0017180
680 Ga0501082_1044362
681 Ga0466962_0031933
682 Ga0530510_0014014
683 Ga0530510_0244159
684 2644091702
685 2644321505
686 2855388989

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07811

TadE

TadE-like protein

13

55

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
6mna-assembly1.cif.gz_A crystal structure of lpqn involved in cell envelope biogenesis of mycobacterium tuberculosis 0.7641 82 122
4pws-assembly1.cif.gz_A crystal structure of secreted proline rich antigen mtc28 (rv0040c) at 2.15 a with bound chloride from mycobacterium tuberculosis 0.7495 82 122
6cz6-assembly1.cif.gz_D mycobacterium tuberculosis transcriptional regulator 0.7442 80 122
6cyj-assembly1.cif.gz_A mycobacterium tuberculosis transcriptional regulator 0.7394 80 122
6cyy-assembly1.cif.gz_A mycobacterium tuberculosis transcriptional regulator 0.7377 80 122
ID Description Score Start End Superfamily
af_Q8IIT5_845_912_3.30.200.20 Alpha Beta;2-Layer Sandwich;Phosphorylase Kinase; domain 1;Phosphorylase Kinase; domain 1 0.8175 81 99 3.30.200.20
af_E7FCT0_374_739_3.40.850.10 Alpha Beta;3-Layer(aba) Sandwich;Kinesin;Kinesin motor domain 0.7929 93 123 3.40.850.10
af_O53780_84_228_3.40.1000.10 Alpha Beta;3-Layer(aba) Sandwich;Protein Transport Mog1p; Chain A;Mog1/PsbP, alpha/beta/alpha sandwich 0.7878 82 122 3.40.1000.10
af_Q58AU7_45_139_3.30.200.20 Alpha Beta;2-Layer Sandwich;Phosphorylase Kinase; domain 1;Phosphorylase Kinase; domain 1 0.771 80 104 3.30.200.20
af_P9WK59_83_224_3.40.1000.10 Alpha Beta;3-Layer(aba) Sandwich;Protein Transport Mog1p; Chain A;Mog1/PsbP, alpha/beta/alpha sandwich 0.7585 82 122 3.40.1000.10
ID Description Score Start End GO Terms
AF-A0A7Y9F297-F1-model_v4 Flp pilus assembly protein TadG 0.9794 1 126 GO:0016020
AF-A0A4R4W560-F1-model_v4 Pilus assembly protein 0.9734 16 126 GO:0016020
AF-A0A7Y9F297-F1-model_v4 Flp pilus assembly protein TadG 0.9718 1 126 GO:0016020
AF-A0A6G7YK96-F1-model_v4 Pilus assembly protein 0.9706 17 124
AF-A0A3N0GNB1-F1-model_v4 Pilus assembly protein 0.9697 2 126 GO:0016020

Map