F415335

General Info

Members Datasets Scaffolds Average Seq Length
342 209 684 124

Family's Representative Sequence

Representative Sequence 3300048927|Ga0496124_0030382|Ga0496124_0030382_1089_1502
Length 121
Sequence MVLIAGPYRSGTGDDPAKLAANERAMHEAALEVFRRGHLPVTGEALALPLIRVAAASAPPGSPVFDEIFHPIARRLVARCDAVLRIGGPSAGADEMVAIAREHGATVVHTIDELPDAQVRR

Samples

Sample ID Description Type Environment
1 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
14 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
15 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
16 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
17 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
18 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
19 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
20 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
21 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
22 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
23 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
24 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
25 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
26 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
27 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
28 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
29 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
30 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
31 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
32 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
33 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
34 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
35 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
36 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
37 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
38 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
39 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
40 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
41 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
42 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
43 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
44 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
45 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
46 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
47 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
48 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
49 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
50 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
51 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
52 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
53 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
54 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
55 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
56 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
58 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
59 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
60 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
61 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
63 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
64 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
66 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
67 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
68 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
69 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
70 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
71 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
72 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
73 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
74 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
75 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
76 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
77 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
78 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
79 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
80 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
81 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
82 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
83 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
84 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
85 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
135 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
139 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
140 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
141 3300033547 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 Metagenome Unclassified
142 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
143 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
144 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
145 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
146 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
147 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
148 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
149 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
150 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
151 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
152 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
153 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
154 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
155 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
156 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
157 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
158 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
159 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
160 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
161 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
162 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
163 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
164 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
165 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
166 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
167 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
168 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
169 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
170 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
171 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
172 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
173 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
174 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
175 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
176 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
177 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
178 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
179 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
180 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
181 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
182 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
183 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
184 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
185 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
186 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
187 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
188 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
189 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
190 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
191 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
192 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
193 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
194 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
195 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
196 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
197 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
198 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
199 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
200 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
201 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
202 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
203 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
204 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
205 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
206 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
207 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
208 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
209 2915768154 Amycolatopsis pittospori PIP199 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.12
Metatranscriptomes 0.58
Isolates 0.29

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.02
Nodule 0
Rhizoplane 3.22
Rhizosphere 88.01
Stem 0
Stem Tuber 0
Unclassified 21.35

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496124_0030382 3300048927 Bacteria 4797
2 Ga0070658_10372259 3300005327 Bacteria 1225
3 Ga0070683_100483193 3300005329 Bacteria 1183
4 Ga0070690_101682436 3300005330 Bacteria 516
5 Ga0070670_100133777 3300005331 Unclassified 2142
6 Ga0070680_100045550 3300005336 Bacteria 3566
7 Ga0070660_100095985 3300005339 Bacteria 2344
8 Ga0070689_100034192 3300005340 Unclassified 3877
9 Ga0070689_100648925 3300005340 Bacteria 918
10 Ga0070691_10004369 3300005341 Bacteria 6423
11 Ga0070661_100102778 3300005344 Unclassified 2127
12 Ga0070661_100399452 3300005344 Bacteria 1086
13 Ga0070661_100675593 3300005344 Bacteria 840
14 Ga0070668_100000896 3300005347 Bacteria 20719
15 Ga0070675_100607366 3300005354 Unclassified 992
16 Ga0070688_100064998 3300005365 Unclassified 2317
17 Ga0070688_101089852 3300005365 Bacteria 638
18 Ga0070659_100150653 3300005366 Unclassified 1897
19 Ga0070667_100405931 3300005367 Unclassified 1241
20 Ga0070709_10037234 3300005434 Bacteria 2970
21 Ga0070709_10123606 3300005434 Bacteria 1758
22 Ga0070709_10713675 3300005434 Unclassified 781
23 Ga0070714_100009929 3300005435 Bacteria 7508
24 Ga0070714_100685520 3300005435 Bacteria 988
25 Ga0070713_100000288 3300005436 Bacteria 33342
26 Ga0070713_100017757 3300005436 Bacteria 5393
27 Ga0070713_100723499 3300005436 Bacteria 951
28 Ga0070713_101359605 3300005436 Unclassified 688
29 Ga0070713_101439368 3300005436 Unclassified 668
30 Ga0070710_10032688 3300005437 Unclassified 2820
31 Ga0070710_10038003 3300005437 Bacteria 2641
32 Ga0070711_100015259 3300005439 Bacteria 4860
33 Ga0070711_100024340 3300005439 Bacteria 3948
34 Ga0070711_100057138 3300005439 Bacteria 2701
35 Ga0070711_100216903 3300005439 Bacteria 1485
36 Ga0070711_100290455 3300005439 Bacteria 1297
37 Ga0070705_100139379 3300005440 Bacteria 1594
38 Ga0070678_100445860 3300005456 Bacteria 1133
39 Ga0070678_101837195 3300005456 Bacteria 572
40 Ga0070681_10023094 3300005458 Bacteria 6254
41 Ga0068867_102143418 3300005459 Bacteria 530
42 Ga0070685_10284023 3300005466 Bacteria 1109
43 Ga0070706_101182775 3300005467 Bacteria 703
44 Ga0070679_100008742 3300005530 Bacteria 9553
45 Ga0070684_100062329 3300005535 Unclassified 3266
46 Ga0070684_101366803 3300005535 Unclassified 667
47 Ga0070672_100369668 3300005543 Unclassified 1225
48 Ga0070672_101917632 3300005543 Bacteria 533
49 Ga0070696_100497771 3300005546 Bacteria 969
50 Ga0070696_101284729 3300005546 Bacteria 621
51 Ga0070693_100168590 3300005547 Bacteria 1400
52 Ga0070693_100550544 3300005547 Bacteria 826
53 Ga0070665_100254267 3300005548 Bacteria 1758
54 Ga0068855_100074241 3300005563 Bacteria 3950
55 Ga0068855_100105478 3300005563 Bacteria 3240
56 Ga0068855_101244684 3300005563 Unclassified 772
57 Ga0070664_100003189 3300005564 Bacteria 13252
58 Ga0070664_100017294 3300005564 Bacteria 5920
59 Ga0070664_100908755 3300005564 Bacteria 826
60 Ga0068857_100142455 3300005577 Unclassified 2167
61 Ga0068856_100050487 3300005614 Bacteria 4100
62 Ga0068852_100547085 3300005616 Bacteria 1158
63 Ga0068859_100586979 3300005617 Unclassified 1208
64 Ga0068864_100028580 3300005618 Unclassified 4715
65 Ga0068861_100414231 3300005719 Bacteria 1199
66 Ga0068851_10325294 3300005834 Unclassified 889
67 Ga0068863_101259408 3300005841 Unclassified 746
68 Ga0068858_100123878 3300005842 Bacteria 2419
69 Ga0068860_100174202 3300005843 Bacteria 2079
70 Ga0068860_100216225 3300005843 Bacteria 1860
71 Ga0081455_10062177 3300005937 Bacteria 3139
72 Ga0070717_10054234 3300006028 Bacteria 3306
73 Ga0075363_100326983 3300006048 Bacteria 893
74 Ga0075364_10380295 3300006051 Bacteria 963
75 Ga0070715_10023929 3300006163 Bacteria 2399
76 Ga0070716_100000138 3300006173 Bacteria 29465
77 Ga0070716_100137747 3300006173 Bacteria 1552
78 Ga0070716_100310040 3300006173 Bacteria 1101
79 Ga0070716_100469546 3300006173 Bacteria 921
80 Ga0070712_100003130 3300006175 Bacteria 10204
81 Ga0070712_100010567 3300006175 Bacteria 5828
82 Ga0070712_100023585 3300006175 Bacteria 4067
83 Ga0070712_100045819 3300006175 Bacteria 3021
84 Ga0070712_100155159 3300006175 Bacteria 1762
85 Ga0075362_10694408 3300006177 Bacteria 530
86 Ga0075367_10100542 3300006178 Bacteria 1767
87 Ga0075367_10146055 3300006178 Bacteria 1467
88 Ga0075369_10013694 3300006186 Bacteria 3226
89 Ga0075366_10017530 3300006195 Bacteria 4121
90 Ga0075366_10772379 3300006195 Bacteria 597
91 Ga0097621_100232164 3300006237 Bacteria 1611
92 Ga0097621_100739567 3300006237 Bacteria 908
93 Ga0068871_101371970 3300006358 Unclassified 666
94 Ga0075428_100106931 3300006844 Bacteria 3049
95 Ga0075433_10086454 3300006852 Bacteria 2768
96 Ga0075434_100354034 3300006871 Bacteria 1489
97 Ga0075434_102404254 3300006871 Bacteria 529
98 Ga0097620_100586942 3300006931 Unclassified 1208
99 Ga0099795_10087260 3300007788 Bacteria 1204
100 Ga0099795_10510707 3300007788 Bacteria 561
101 Ga0105240_10383044 3300009093 Bacteria 1588
102 Ga0111539_10859879 3300009094 Bacteria 1055
103 Ga0105245_10037959 3300009098 Bacteria 4284
104 Ga0105245_10185630 3300009098 Bacteria 1989
105 Ga0105245_11044561 3300009098 Bacteria 862
106 Ga0105245_11236411 3300009098 Bacteria 795
107 Ga0105245_13041572 3300009098 Unclassified 520
108 Ga0105243_10726311 3300009148 Unclassified 971
109 Ga0105241_10013870 3300009174 Bacteria 5904
110 Ga0105241_11492522 3300009174 Bacteria 650
111 Ga0105242_10355865 3300009176 Bacteria 1354
112 Ga0105242_12576009 3300009176 Bacteria 557
113 Ga0105238_10141480 3300009551 Bacteria 2383
114 Ga0105238_10179970 3300009551 Bacteria 2091
115 Ga0105238_10202616 3300009551 Bacteria 1960
116 Ga0105238_10894588 3300009551 Unclassified 906
117 Ga0105249_12994245 3300009553 Unclassified 542
118 Ga0105239_10756225 3300010375 Bacteria 1112
119 Ga0105239_11324490 3300010375 Unclassified 831
120 Ga0105246_10070171 3300011119 Unclassified 2464
121 Ga0157371_10272982 3300013102 Unclassified 1220
122 Ga0157369_10035147 3300013105 Bacteria 5496
123 Ga0157369_10832585 3300013105 Bacteria 947
124 Ga0157374_10000558 3300013296 Bacteria 33101
125 Ga0157374_11375253 3300013296 Unclassified 728
126 Ga0157378_10052263 3300013297 Bacteria 3636
127 Ga0157378_11549648 3300013297 Bacteria 708
128 Ga0157378_12664137 3300013297 Bacteria 552
129 Ga0163162_10164680 3300013306 Bacteria 2341
130 Ga0163162_11782782 3300013306 Bacteria 703
131 Ga0163162_12002227 3300013306 Bacteria 664
132 Ga0157372_10194481 3300013307 Bacteria 2350
133 Ga0157372_10333893 3300013307 Unclassified 1765
134 Ga0157372_10653571 3300013307 Bacteria 1224
135 Ga0157375_10039926 3300013308 Unclassified 4520
136 Ga0163163_10001157 3300014325 Bacteria 22416
137 Ga0163163_10994107 3300014325 Bacteria 902
138 Ga0157377_10129570 3300014745 Unclassified 1539
139 Ga0157379_10001261 3300014968 Bacteria 20577
140 Ga0157379_10169918 3300014968 Unclassified 1968
141 Ga0157376_11083933 3300014969 Unclassified 826
142 Ga0157376_12336432 3300014969 Unclassified 574
143 Ga0157376_12874817 3300014969 Bacteria 521
144 Ga0207426_1005904 3300025302 Bacteria 5448
145 Ga0207656_10204157 3300025321 Unclassified 955
146 Ga0207692_10023131 3300025898 Unclassified 2870
147 Ga0207692_10247915 3300025898 Bacteria 1066
148 Ga0207688_10624480 3300025901 Unclassified 680
149 Ga0207688_10958272 3300025901 Bacteria 541
150 Ga0207680_10725495 3300025903 Unclassified 712
151 Ga0207647_10277924 3300025904 Unclassified 956
152 Ga0207699_10183526 3300025906 Unclassified 1408
153 Ga0207645_10409099 3300025907 Bacteria 913
154 Ga0207645_10793258 3300025907 Bacteria 644
155 Ga0207643_10099826 3300025908 Bacteria 1701
156 Ga0207705_10021537 3300025909 Bacteria 4601
157 Ga0207705_10277164 3300025909 Bacteria 1283
158 Ga0207654_10023595 3300025911 Bacteria 3297
159 Ga0207654_10529618 3300025911 Bacteria 835
160 Ga0207707_10072488 3300025912 Bacteria 3002
161 Ga0207707_10123987 3300025912 Bacteria 2259
162 Ga0207695_10126641 3300025913 Bacteria 2515
163 Ga0207671_10057047 3300025914 Bacteria 2894
164 Ga0207693_10004517 3300025915 Bacteria 11764
165 Ga0207693_10009708 3300025915 Bacteria 7834
166 Ga0207693_10016441 3300025915 Bacteria 5912
167 Ga0207663_10018918 3300025916 Bacteria 3869
168 Ga0207663_10377917 3300025916 Bacteria 1079
169 Ga0207663_10446886 3300025916 Bacteria 996
170 Ga0207660_10029471 3300025917 Bacteria 3765
171 Ga0207662_10155251 3300025918 Unclassified 1458
172 Ga0207649_10157482 3300025920 Unclassified 1570
173 Ga0207649_10394213 3300025920 Bacteria 1035
174 Ga0207649_10465686 3300025920 Unclassified 956
175 Ga0207649_10530449 3300025920 Bacteria 899
176 Ga0207652_10133524 3300025921 Bacteria 2215
177 Ga0207652_11258055 3300025921 Unclassified 642
178 Ga0207681_10387341 3300025923 Bacteria 1126
179 Ga0207694_10022403 3300025924 Bacteria 4792
180 Ga0207694_10359071 3300025924 Bacteria 1207
181 Ga0207694_10631679 3300025924 Bacteria 902
182 Ga0207650_10389833 3300025925 Unclassified 1151
183 Ga0207659_10232096 3300025926 Unclassified 1489
184 Ga0207687_10422522 3300025927 Bacteria 1100
185 Ga0207687_11539589 3300025927 Unclassified 571
186 Ga0207700_10012969 3300025928 Bacteria 5400
187 Ga0207700_10050248 3300025928 Bacteria 3107
188 Ga0207700_11622700 3300025928 Unclassified 572
189 Ga0207664_10550201 3300025929 Bacteria 1035
190 Ga0207690_11305299 3300025932 Bacteria 606
191 Ga0207706_11169896 3300025933 Unclassified 640
192 Ga0207686_10180592 3300025934 Bacteria 1496
193 Ga0207670_10135047 3300025936 Unclassified 1812
194 Ga0207670_10537010 3300025936 Bacteria 954
195 Ga0207665_10000187 3300025939 Bacteria 41612
196 Ga0207665_10249998 3300025939 Bacteria 1310
197 Ga0207665_10367212 3300025939 Bacteria 1089
198 Ga0207691_10087110 3300025940 Unclassified 2801
199 Ga0207661_10005489 3300025944 Bacteria 8945
200 Ga0207661_10578002 3300025944 Bacteria 1030
201 Ga0207661_12155816 3300025944 Bacteria 503
202 Ga0207679_10025443 3300025945 Bacteria 4070
203 Ga0207679_10041546 3300025945 Unclassified 3298
204 Ga0207679_10095367 3300025945 Bacteria 2312
205 Ga0207679_10865143 3300025945 Bacteria 826
206 Ga0207667_10274805 3300025949 Bacteria 1722
207 Ga0207667_10310188 3300025949 Bacteria 1612
208 Ga0207667_10637224 3300025949 Unclassified 1072
209 Ga0207667_11276157 3300025949 Bacteria 712
210 Ga0207667_11291447 3300025949 Unclassified 707
211 Ga0207712_11134826 3300025961 Unclassified 696
212 Ga0207668_10001532 3300025972 Bacteria 13520
213 Ga0207640_10043298 3300025981 Bacteria 2877
214 Ga0207677_10091316 3300026023 Bacteria 2215
215 Ga0207703_10526250 3300026035 Unclassified 1113
216 Ga0207639_10023286 3300026041 Bacteria 4471
217 Ga0207639_10539876 3300026041 Bacteria 1069
218 Ga0207678_11317343 3300026067 Unclassified 639
219 Ga0207702_10286102 3300026078 Bacteria 1560
220 Ga0207641_10431983 3300026088 Unclassified 1270
221 Ga0207676_10039864 3300026095 Unclassified 3596
222 Ga0207674_10015651 3300026116 Bacteria 8328
223 Ga0207674_10178671 3300026116 Bacteria 2074
224 Ga0207674_11673025 3300026116 Bacteria 605
225 Ga0207675_100507080 3300026118 Bacteria 1202
226 Ga0207683_10731984 3300026121 Bacteria 917
227 Ga0207698_10723115 3300026142 Bacteria 992
228 Ga0207698_10891824 3300026142 Bacteria 896
229 Ga0207428_10315635 3300027907 Bacteria 1155
230 Ga0268266_10061357 3300028379 Bacteria 3243
231 Ga0268266_10081428 3300028379 Bacteria 2823
232 Ga0268266_10116621 3300028379 Unclassified 2372
233 Ga0268265_10031155 3300028380 Bacteria 3850
234 Ga0268264_10289388 3300028381 Bacteria 1538
235 Ga0268264_10301591 3300028381 Bacteria 1508
236 Ga0268264_11928246 3300028381 Bacteria 600
237 Ga0265334_10201321 3300028573 Bacteria 692
238 Ga0265760_10005063 3300031090 Bacteria 3773
239 Ga0307412_10552114 3300031911 Bacteria 968
240 Ga0316212_1020393 3300033547 Bacteria 930
241 Ga0373940_0102730 3300035088 Bacteria 869
242 Ga0373923_0053039 3300035111 Bacteria 1705
243 Ga0373936_0010497 3300035113 Bacteria 3495
244 Ga0373945_0008912 3300035116 Bacteria 3278
245 Ga0373945_0248282 3300035116 Bacteria 751
246 Ga0373943_0125868 3300035170 Bacteria 1366
247 Ga0373946_0093444 3300035171 Bacteria 1336
248 Ga0373931_0015337 3300035691 Bacteria 3757
249 Ga0373931_0074665 3300035691 Bacteria 1858
250 Ga0373931_0324120 3300035691 Bacteria 958
251 Ga0373931_0705711 3300035691 Bacteria 667
252 Ga0373935_0001983 3300035692 Bacteria 11537
253 Ga0373935_0033304 3300035692 Bacteria 3205
254 Ga0373935_0147860 3300035692 Bacteria 1592
255 Ga0373935_0329385 3300035692 Bacteria 1085
256 Ga0373935_0607138 3300035692 Unclassified 800
257 Ga0373927_0330204 3300035695 Bacteria 1005
258 Ga0373933_0484827 3300035724 Bacteria 810
259 Ga0373947_0028565 3300035725 Bacteria 3271
260 Ga0373947_1209836 3300035725 Bacteria 514
261 Ga0373937_0347046 3300036401 Bacteria 1406
262 Ga0372808_005434 3300036459 Bacteria 1681
263 Ga0373925_0005107 3300037068 Bacteria 9826
264 Ga0373925_0109686 3300037068 Bacteria 2130
265 Ga0373925_0128886 3300037068 Bacteria 1971
266 Ga0373925_0315614 3300037068 Bacteria 1264
267 Ga0373925_0730835 3300037068 Unclassified 816
268 Ga0395899_0016260 3300037312 Bacteria 5672
269 Ga0395900_0003890 3300037418 Bacteria 15950
270 Ga0395901_0007809 3300038443 Bacteria 10795
271 Ga0451849_0191665 3300041505 Unclassified 735
272 Ga0451577_0039560 3300042876 Bacteria 4237
273 Ga0451577_0066514 3300042876 Bacteria 3214
274 Ga0451577_0187812 3300042876 Bacteria 1864
275 Ga0453683_0001154 3300044673 Bacteria 23962
276 Ga0453683_0362784 3300044673 Unclassified 931
277 Ga0453683_0588499 3300044673 Unclassified 725
278 Ga0466965_0763834 3300044683 Bacteria 558
279 Ga0453684_0056292 3300044712 Bacteria 5103
280 Ga0453684_0125403 3300044712 Bacteria 3091
281 Ga0453684_0127177 3300044712 Bacteria 3065
282 Ga0453684_0921268 3300044712 Bacteria 934
283 Ga0453684_2383390 3300044712 Unclassified 524
284 Ga0451576_0070219 3300045051 Bacteria 3645
285 Ga0451576_0529384 3300045051 Bacteria 1238
286 Ga0466967_0392157 3300045976 Bacteria 1350
287 Ga0495629_0010014 3300046459 Bacteria 6919
288 Ga0495580_0000232 3300046472 Bacteria 43742
289 Ga0495580_0219437 3300046472 Bacteria 1307
290 Ga0495582_0001190 3300046473 Bacteria 14658
291 Ga0495582_0501591 3300046473 Unclassified 702
292 Ga0495594_0267672 3300046499 Bacteria 973
293 Ga0495594_0518059 3300046499 Bacteria 677
294 Ga0495594_0593045 3300046499 Unclassified 628
295 Ga0495630_0030180 3300046517 Bacteria 4032
296 Ga0495640_0156405 3300046533 Bacteria 1463
297 Ga0495598_0172394 3300046537 Bacteria 767
298 Ga0495645_0137986 3300046543 Bacteria 1704
299 Ga0495599_0191782 3300046678 Bacteria 1257
300 Ga0495647_0173832 3300046681 Bacteria 934
301 Ga0495613_0077694 3300046689 Bacteria 2415
302 Ga0495624_0706187 3300046690 Bacteria 598
303 Ga0495674_0010742 3300047319 Bacteria 8661
304 Ga0495674_0181403 3300047319 Bacteria 1753
305 Ga0495674_0524881 3300047319 Unclassified 945
306 Ga0495674_1079379 3300047319 Unclassified 612
307 Ga0496100_0033225 3300048903 Bacteria 3227
308 Ga0496100_1193227 3300048903 Unclassified 600
309 Ga0496102_0008366 3300048905 Bacteria 8860
310 Ga0496103_0011205 3300048906 Bacteria 5310
311 Ga0496104_0160505 3300048907 Bacteria 2156
312 Ga0496105_0081674 3300048908 Bacteria 2670
313 Ga0496106_1408210 3300048909 Bacteria 538
314 Ga0496107_0028160 3300048910 Bacteria 3992
315 Ga0496112_0053249 3300048915 Bacteria 3974
316 Ga0496112_0725461 3300048915 Bacteria 921
317 Ga0496115_0696534 3300048918 Bacteria 799
318 Ga0496117_0391060 3300048920 Bacteria 705
319 Ga0501034_0010714 3300049571 Bacteria 9524
320 Ga0501034_0270357 3300049571 Bacteria 1641
321 Ga0501034_0780722 3300049571 Bacteria 849
322 Ga0501042_0858666 3300049578 Bacteria 661
323 Ga0501070_0306905 3300049586 Bacteria 1292
324 Ga0501080_0483944 3300049742 Bacteria 1107
325 nmdc:mga03683_20006_c1 3300050489 Bacteria 2562
326 nmdc:mga03683_231023_c1 3300050489 Bacteria 855
327 nmdc:mga0k408_11510_c1 3300050493 Bacteria 4820
328 nmdc:mga06z11_77467_c1 3300050494 Bacteria 1775
329 nmdc:mga04h51_152350_c1 3300050495 Bacteria 884
330 nmdc:mga08y16_801892_c1 3300050511 Bacteria 934
331 nmdc:mga0sz30_22908_c2 3300050516 Bacteria 2204
332 Ga0500610_0411317 3300053079 Bacteria 545
333 Ga0500644_0456192 3300053088 Bacteria 560
334 Ga0500583_0382060 3300053092 Bacteria 678
335 Ga0500651_0201370 3300053093 Bacteria 1175
336 Ga0500642_0361266 3300053130 Bacteria 642
337 Ga0500577_0161259 3300053142 Bacteria 955
338 Ga0500616_0002247 3300053153 Bacteria 16514
339 Ga0500645_113922 3300053730 Bacteria 757
340 Ga0500552_003406 3300053733 Bacteria 1613
341 Ga0501082_0000088 3300060353 Bacteria 70209
342 2915769129 2915768154 Bacteria 8424322
343 Ga0496124_0030382
344 Ga0070658_10372259
345 Ga0070683_100483193
346 Ga0070690_101682436
347 Ga0070670_100133777
348 Ga0070680_100045550
349 Ga0070660_100095985
350 Ga0070689_100034192
351 Ga0070689_100648925
352 Ga0070691_10004369
353 Ga0070661_100102778
354 Ga0070661_100399452
355 Ga0070661_100675593
356 Ga0070668_100000896
357 Ga0070675_100607366
358 Ga0070688_100064998
359 Ga0070688_101089852
360 Ga0070659_100150653
361 Ga0070667_100405931
362 Ga0070709_10037234
363 Ga0070709_10123606
364 Ga0070709_10713675
365 Ga0070714_100009929
366 Ga0070714_100685520
367 Ga0070713_100000288
368 Ga0070713_100017757
369 Ga0070713_100723499
370 Ga0070713_101359605
371 Ga0070713_101439368
372 Ga0070710_10032688
373 Ga0070710_10038003
374 Ga0070711_100015259
375 Ga0070711_100024340
376 Ga0070711_100057138
377 Ga0070711_100216903
378 Ga0070711_100290455
379 Ga0070705_100139379
380 Ga0070678_100445860
381 Ga0070678_101837195
382 Ga0070681_10023094
383 Ga0068867_102143418
384 Ga0070685_10284023
385 Ga0070706_101182775
386 Ga0070679_100008742
387 Ga0070684_100062329
388 Ga0070684_101366803
389 Ga0070672_100369668
390 Ga0070672_101917632
391 Ga0070696_100497771
392 Ga0070696_101284729
393 Ga0070693_100168590
394 Ga0070693_100550544
395 Ga0070665_100254267
396 Ga0068855_100074241
397 Ga0068855_100105478
398 Ga0068855_101244684
399 Ga0070664_100003189
400 Ga0070664_100017294
401 Ga0070664_100908755
402 Ga0068857_100142455
403 Ga0068856_100050487
404 Ga0068852_100547085
405 Ga0068859_100586979
406 Ga0068864_100028580
407 Ga0068861_100414231
408 Ga0068851_10325294
409 Ga0068863_101259408
410 Ga0068858_100123878
411 Ga0068860_100174202
412 Ga0068860_100216225
413 Ga0081455_10062177
414 Ga0070717_10054234
415 Ga0075363_100326983
416 Ga0075364_10380295
417 Ga0070715_10023929
418 Ga0070716_100000138
419 Ga0070716_100137747
420 Ga0070716_100310040
421 Ga0070716_100469546
422 Ga0070712_100003130
423 Ga0070712_100010567
424 Ga0070712_100023585
425 Ga0070712_100045819
426 Ga0070712_100155159
427 Ga0075362_10694408
428 Ga0075367_10100542
429 Ga0075367_10146055
430 Ga0075369_10013694
431 Ga0075366_10017530
432 Ga0075366_10772379
433 Ga0097621_100232164
434 Ga0097621_100739567
435 Ga0068871_101371970
436 Ga0075428_100106931
437 Ga0075433_10086454
438 Ga0075434_100354034
439 Ga0075434_102404254
440 Ga0097620_100586942
441 Ga0099795_10087260
442 Ga0099795_10510707
443 Ga0105240_10383044
444 Ga0111539_10859879
445 Ga0105245_10037959
446 Ga0105245_10185630
447 Ga0105245_11044561
448 Ga0105245_11236411
449 Ga0105245_13041572
450 Ga0105243_10726311
451 Ga0105241_10013870
452 Ga0105241_11492522
453 Ga0105242_10355865
454 Ga0105242_12576009
455 Ga0105238_10141480
456 Ga0105238_10179970
457 Ga0105238_10202616
458 Ga0105238_10894588
459 Ga0105249_12994245
460 Ga0105239_10756225
461 Ga0105239_11324490
462 Ga0105246_10070171
463 Ga0157371_10272982
464 Ga0157369_10035147
465 Ga0157369_10832585
466 Ga0157374_10000558
467 Ga0157374_11375253
468 Ga0157378_10052263
469 Ga0157378_11549648
470 Ga0157378_12664137
471 Ga0163162_10164680
472 Ga0163162_11782782
473 Ga0163162_12002227
474 Ga0157372_10194481
475 Ga0157372_10333893
476 Ga0157372_10653571
477 Ga0157375_10039926
478 Ga0163163_10001157
479 Ga0163163_10994107
480 Ga0157377_10129570
481 Ga0157379_10001261
482 Ga0157379_10169918
483 Ga0157376_11083933
484 Ga0157376_12336432
485 Ga0157376_12874817
486 Ga0207426_1005904
487 Ga0207656_10204157
488 Ga0207692_10023131
489 Ga0207692_10247915
490 Ga0207688_10624480
491 Ga0207688_10958272
492 Ga0207680_10725495
493 Ga0207647_10277924
494 Ga0207699_10183526
495 Ga0207645_10409099
496 Ga0207645_10793258
497 Ga0207643_10099826
498 Ga0207705_10021537
499 Ga0207705_10277164
500 Ga0207654_10023595
501 Ga0207654_10529618
502 Ga0207707_10072488
503 Ga0207707_10123987
504 Ga0207695_10126641
505 Ga0207671_10057047
506 Ga0207693_10004517
507 Ga0207693_10009708
508 Ga0207693_10016441
509 Ga0207663_10018918
510 Ga0207663_10377917
511 Ga0207663_10446886
512 Ga0207660_10029471
513 Ga0207662_10155251
514 Ga0207649_10157482
515 Ga0207649_10394213
516 Ga0207649_10465686
517 Ga0207649_10530449
518 Ga0207652_10133524
519 Ga0207652_11258055
520 Ga0207681_10387341
521 Ga0207694_10022403
522 Ga0207694_10359071
523 Ga0207694_10631679
524 Ga0207650_10389833
525 Ga0207659_10232096
526 Ga0207687_10422522
527 Ga0207687_11539589
528 Ga0207700_10012969
529 Ga0207700_10050248
530 Ga0207700_11622700
531 Ga0207664_10550201
532 Ga0207690_11305299
533 Ga0207706_11169896
534 Ga0207686_10180592
535 Ga0207670_10135047
536 Ga0207670_10537010
537 Ga0207665_10000187
538 Ga0207665_10249998
539 Ga0207665_10367212
540 Ga0207691_10087110
541 Ga0207661_10005489
542 Ga0207661_10578002
543 Ga0207661_12155816
544 Ga0207679_10025443
545 Ga0207679_10041546
546 Ga0207679_10095367
547 Ga0207679_10865143
548 Ga0207667_10274805
549 Ga0207667_10310188
550 Ga0207667_10637224
551 Ga0207667_11276157
552 Ga0207667_11291447
553 Ga0207712_11134826
554 Ga0207668_10001532
555 Ga0207640_10043298
556 Ga0207677_10091316
557 Ga0207703_10526250
558 Ga0207639_10023286
559 Ga0207639_10539876
560 Ga0207678_11317343
561 Ga0207702_10286102
562 Ga0207641_10431983
563 Ga0207676_10039864
564 Ga0207674_10015651
565 Ga0207674_10178671
566 Ga0207674_11673025
567 Ga0207675_100507080
568 Ga0207683_10731984
569 Ga0207698_10723115
570 Ga0207698_10891824
571 Ga0207428_10315635
572 Ga0268266_10061357
573 Ga0268266_10081428
574 Ga0268266_10116621
575 Ga0268265_10031155
576 Ga0268264_10289388
577 Ga0268264_10301591
578 Ga0268264_11928246
579 Ga0265334_10201321
580 Ga0265760_10005063
581 Ga0307412_10552114
582 Ga0316212_1020393
583 Ga0373940_0102730
584 Ga0373923_0053039
585 Ga0373936_0010497
586 Ga0373945_0008912
587 Ga0373945_0248282
588 Ga0373943_0125868
589 Ga0373946_0093444
590 Ga0373931_0015337
591 Ga0373931_0074665
592 Ga0373931_0324120
593 Ga0373931_0705711
594 Ga0373935_0001983
595 Ga0373935_0033304
596 Ga0373935_0147860
597 Ga0373935_0329385
598 Ga0373935_0607138
599 Ga0373927_0330204
600 Ga0373933_0484827
601 Ga0373947_0028565
602 Ga0373947_1209836
603 Ga0373937_0347046
604 Ga0372808_005434
605 Ga0373925_0005107
606 Ga0373925_0109686
607 Ga0373925_0128886
608 Ga0373925_0315614
609 Ga0373925_0730835
610 Ga0395899_0016260
611 Ga0395900_0003890
612 Ga0395901_0007809
613 Ga0451849_0191665
614 Ga0451577_0039560
615 Ga0451577_0066514
616 Ga0451577_0187812
617 Ga0453683_0001154
618 Ga0453683_0362784
619 Ga0453683_0588499
620 Ga0466965_0763834
621 Ga0453684_0056292
622 Ga0453684_0125403
623 Ga0453684_0127177
624 Ga0453684_0921268
625 Ga0453684_2383390
626 Ga0451576_0070219
627 Ga0451576_0529384
628 Ga0466967_0392157
629 Ga0495629_0010014
630 Ga0495580_0000232
631 Ga0495580_0219437
632 Ga0495582_0001190
633 Ga0495582_0501591
634 Ga0495594_0267672
635 Ga0495594_0518059
636 Ga0495594_0593045
637 Ga0495630_0030180
638 Ga0495640_0156405
639 Ga0495598_0172394
640 Ga0495645_0137986
641 Ga0495599_0191782
642 Ga0495647_0173832
643 Ga0495613_0077694
644 Ga0495624_0706187
645 Ga0495674_0010742
646 Ga0495674_0181403
647 Ga0495674_0524881
648 Ga0495674_1079379
649 Ga0496100_0033225
650 Ga0496100_1193227
651 Ga0496102_0008366
652 Ga0496103_0011205
653 Ga0496104_0160505
654 Ga0496105_0081674
655 Ga0496106_1408210
656 Ga0496107_0028160
657 Ga0496112_0053249
658 Ga0496112_0725461
659 Ga0496115_0696534
660 Ga0496117_0391060
661 Ga0501034_0010714
662 Ga0501034_0270357
663 Ga0501034_0780722
664 Ga0501042_0858666
665 Ga0501070_0306905
666 Ga0501080_0483944
667 nmdc:mga03683_20006_c1
668 nmdc:mga03683_231023_c1
669 nmdc:mga0k408_11510_c1
670 nmdc:mga06z11_77467_c1
671 nmdc:mga04h51_152350_c1
672 nmdc:mga08y16_801892_c1
673 nmdc:mga0sz30_22908_c2
674 Ga0500610_0411317
675 Ga0500644_0456192
676 Ga0500583_0382060
677 Ga0500651_0201370
678 Ga0500642_0361266
679 Ga0500577_0161259
680 Ga0500616_0002247
681 Ga0500645_113922
682 Ga0500552_003406
683 Ga0501082_0000088
684 2915769129

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
7o62-assembly1.cif.gz_B crystal structure of a 2`-deoxyribosyltransferase from the psychrophilic bacterium desulfotalea psychrophila. 0.8399 2 111
1t1j-assembly2.cif.gz_B crystal structure of genomics apc5043 0.7956 3 112
6evs-assembly1.cif.gz_A characterization of 2-deoxyribosyltransferase from psychrotolerant bacterium bacillus psychrosaccharolyticus: a suitable biocatalyst for the industrial synthesis of antiviral and antitumoral nucleosides 0.7901 6 111
4kxn-assembly1.cif.gz_B crystal structure of dnph1 (rcl) with kinetine riboside monophosphate 0.7767 6 111
4fyh-assembly1.cif.gz_A crystal structure of rcl with phospho-triciribine 0.7557 4 111
ID Description Score Start End Superfamily
1t1jA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Hypothetical protein PA1492 0.7641 4 112 3.40.50.10400
af_A0A0P0V2V1_3_148_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.7498 5 111 3.40.50.2300
af_Q59R20_472_596_3.40.50.800 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Anticodon-binding domain 0.7463 4 47 3.40.50.800
af_Q19133_1_311_3.40.1190.20 Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Ribokinase 0.7085 73 111 3.40.1190.20
3ry7A00 Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Ribokinase 0.7003 73 111 3.40.1190.20
ID Description Score Start End GO Terms
AF-A0A7G5C3T2-F1-model_v4 NUDIX domain-containing protein 0.9966 4 122 GO:0005829
GO:0006753
GO:0016818
GO:0019693
GO:0046872
AF-A0A534A374-F1-model_v4 DUF4406 domain-containing protein 0.9935 6 119
AF-A0A2L0F0V3-F1-model_v4 NUDIX hydrolase 0.9932 2 119 GO:0016787
AF-A0A1W2FRA8-F1-model_v4 DUF4406 domain-containing protein 0.9927 4 119
AF-A0A0N9IH61-F1-model_v4 NUDIX hydrolase 0.9925 6 119 GO:0016787

Map