F415323

General Info

Members Datasets Scaffolds Average Seq Length
342 226 342 149

Family's Representative Sequence

Representative Sequence 3300048903|Ga0496100_0492478|Ga0496100_0492478_192_665
Length 149
Sequence VSNSQAIEDYAKAVYVLGVDRDGLVPSGEVATRLGVTPATATAMLQKLAELGLADYTPYRGVALTDAGERVALEVIRHHRLIEAFLAEALGMPSDRVHAEAEVLEHYISEDLEAPSHDPHGTPIPGPDLAPPAAEAPLLPPGIGPRTTP

Samples

Sample ID Description Type Environment
1 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
2 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
3 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
14 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
18 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
19 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
20 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
21 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
24 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
25 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
26 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
27 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
28 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
29 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
30 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
31 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
32 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
33 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
34 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
35 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
36 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
37 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
38 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
39 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
40 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
41 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
42 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
43 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
44 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
45 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
46 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
47 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
48 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
49 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
50 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
51 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
52 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
53 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
54 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
55 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
56 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
57 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
58 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
59 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
60 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
61 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
62 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
63 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
64 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
101 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
102 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
103 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
104 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
105 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
106 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
107 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
108 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
109 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
110 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
111 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
112 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
113 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
114 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
115 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
116 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
117 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
118 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
119 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
120 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
121 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
122 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
123 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
124 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
125 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
126 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
127 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
128 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
129 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
130 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
131 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
132 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
133 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
134 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
135 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
136 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
137 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
138 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
139 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
140 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
141 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
142 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
143 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
144 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
145 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
146 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
147 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
148 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
149 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
150 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
151 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
152 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
153 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
154 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
155 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
156 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
157 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
158 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
159 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
160 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
161 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
162 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
163 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
164 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
165 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
166 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
167 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
168 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
169 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
170 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
171 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
172 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
173 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
174 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
175 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
176 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
177 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
178 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
179 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
180 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
181 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
182 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
183 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
184 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
185 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
186 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
187 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
188 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
189 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
190 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
191 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
192 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
193 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
194 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
195 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
196 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
197 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
198 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
199 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
200 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
201 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
202 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
203 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
204 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
205 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
206 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
207 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
208 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
209 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
210 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
211 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
212 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
213 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
214 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
215 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
216 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
217 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
218 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
219 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
220 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
221 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
222 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
223 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
224 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
225 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
226 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.17
Nodule 0
Rhizoplane 9.65
Rhizosphere 86.55
Stem 0
Stem Tuber 0
Unclassified 2.63

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24748J21848_1000328 3300002074 Bacteria 5472
2 JGI24034J26672_10000561 3300002239 Bacteria 4725
3 JGI24742J22300_10035180 3300002244 Bacteria 883
4 Ga0070683_100003109 3300005329 Bacteria 13374
5 Ga0070683_100012149 3300005329 Bacteria 7473
6 Ga0070683_100012949 3300005329 Bacteria 7260
7 Ga0070683_100053616 3300005329 Bacteria 3737
8 Ga0070670_100407513 3300005331 Bacteria 1201
9 Ga0070677_10000022 3300005333 Bacteria 45355
10 Ga0070682_100000099 3300005337 Bacteria 77574
11 Ga0070682_100000150 3300005337 Bacteria 55238
12 Ga0070682_100562011 3300005337 Bacteria 895
13 Ga0070682_101210200 3300005337 Bacteria 638
14 Ga0068868_100000450 3300005338 Bacteria 27515
15 Ga0070691_10000379 3300005341 Bacteria 16112
16 Ga0070661_101191078 3300005344 Unclassified 637
17 Ga0070692_10025703 3300005345 Bacteria 2905
18 Ga0070675_100000027 3300005354 Bacteria 106172
19 Ga0070674_100000683 3300005356 Bacteria 17159
20 Ga0070688_100003810 3300005365 Bacteria 7820
21 Ga0070659_100013281 3300005366 Bacteria 6126
22 Ga0070659_100038409 3300005366 Bacteria 3734
23 Ga0070667_100139764 3300005367 Bacteria 2120
24 Ga0070714_100021986 3300005435 Bacteria 5224
25 Ga0070714_100253821 3300005435 Bacteria 1627
26 Ga0070714_100661610 3300005435 Bacteria 1006
27 Ga0070711_100000734 3300005439 Bacteria 17090
28 Ga0070700_100896750 3300005441 Unclassified 722
29 Ga0070663_100004257 3300005455 Bacteria 8376
30 Ga0070663_100024055 3300005455 Bacteria 4092
31 Ga0070663_100078648 3300005455 Bacteria 2418
32 Ga0070662_100000004 3300005457 Bacteria 195534
33 Ga0070681_10352533 3300005458 Bacteria 1382
34 Ga0070685_10000141 3300005466 Bacteria 46333
35 Ga0070679_100000243 3300005530 Bacteria 45435
36 Ga0070679_100008639 3300005530 Bacteria 9599
37 Ga0070684_100008707 3300005535 Bacteria 7954
38 Ga0070684_100031674 3300005535 Bacteria 4503
39 Ga0070684_100036240 3300005535 Bacteria 4227
40 Ga0070684_100212087 3300005535 Bacteria 1765
41 Ga0070684_101593764 3300005535 Bacteria 616
42 Ga0068853_100040286 3300005539 Bacteria 3986
43 Ga0068853_100057086 3300005539 Bacteria 3368
44 Ga0070695_100058037 3300005545 Bacteria 2502
45 Ga0070693_100183114 3300005547 Bacteria 1350
46 Ga0070665_100000106 3300005548 Bacteria 157315
47 Ga0070665_100281623 3300005548 Bacteria 1665
48 Ga0068855_101134667 3300005563 Bacteria 816
49 Ga0070664_100050508 3300005564 Bacteria 3520
50 Ga0068857_100783236 3300005577 Bacteria 910
51 Ga0068854_100000156 3300005578 Bacteria 46593
52 Ga0068854_100002911 3300005578 Bacteria 10619
53 Ga0068856_100000629 3300005614 Bacteria 38394
54 Ga0068856_100009027 3300005614 Bacteria 9700
55 Ga0068856_100073487 3300005614 Bacteria 3385
56 Ga0068852_100000006 3300005616 Bacteria 159569
57 Ga0068852_100130217 3300005616 Bacteria 2316
58 Ga0068866_10000001 3300005718 Bacteria 519680
59 Ga0068851_10001416 3300005834 Bacteria 10485
60 Ga0068863_100000342 3300005841 Bacteria 47536
61 Ga0068863_100102836 3300005841 Bacteria 2717
62 Ga0068858_100000009 3300005842 Bacteria 237748
63 Ga0068858_100000065 3300005842 Bacteria 108233
64 Ga0068860_100097151 3300005843 Bacteria 2808
65 Ga0070715_10224982 3300006163 Bacteria 967
66 Ga0070712_100055590 3300006175 Bacteria 2773
67 Ga0070712_100258409 3300006175 Bacteria 1395
68 Ga0075433_10000900 3300006852 Bacteria 20958
69 Ga0075433_10029904 3300006852 Bacteria 4644
70 Ga0068865_100000023 3300006881 Bacteria 100785
71 Ga0105245_10000020 3300009098 Bacteria 181774
72 Ga0105245_10000254 3300009098 Bacteria 50918
73 Ga0105245_10010405 3300009098 Bacteria 8101
74 Ga0105245_10123396 3300009098 Bacteria 2422
75 Ga0105247_10000316 3300009101 Bacteria 43374
76 Ga0114129_10428915 3300009147 Bacteria 1737
77 Ga0105243_10471675 3300009148 Unclassified 1182
78 Ga0105241_10812675 3300009174 Bacteria 862
79 Ga0105242_10000032 3300009176 Bacteria 98198
80 Ga0105242_10000454 3300009176 Bacteria 32662
81 Ga0105242_10311740 3300009176 Bacteria 1440
82 Ga0105248_10000008 3300009177 Bacteria 403910
83 Ga0105237_10212570 3300009545 Bacteria 1934
84 Ga0105238_11879181 3300009551 Bacteria 631
85 Ga0099796_10578156 3300010159 Bacteria 506
86 Ga0105239_10040162 3300010375 Bacteria 5126
87 Ga0105239_10184946 3300010375 Bacteria 2332
88 Ga0105239_10516347 3300010375 Unclassified 1359
89 Ga0105246_10267107 3300011119 Bacteria 1366
90 Ga0157370_10018120 3300013104 Bacteria 7089
91 Ga0157370_10038604 3300013104 Bacteria 4619
92 Ga0157369_10000020 3300013105 Bacteria 241679
93 Ga0157374_10510359 3300013296 Bacteria 1207
94 Ga0157374_10808016 3300013296 Bacteria 954
95 Ga0157372_10000112 3300013307 Bacteria 85902
96 Ga0157375_10001213 3300013308 Bacteria 22205
97 Ga0157375_10001538 3300013308 Bacteria 19849
98 Ga0157379_10405806 3300014968 Bacteria 1253
99 Ga0163161_10034432 3300017792 Bacteria 3624
100 Ga0207656_10000385 3300025321 Bacteria 14857
101 Ga0207682_10000005 3300025893 Bacteria 95617
102 Ga0207642_10000002 3300025899 Bacteria 658166
103 Ga0207710_10000458 3300025900 Bacteria 26155
104 Ga0207685_10040001 3300025905 Bacteria 1744
105 Ga0207707_10320521 3300025912 Bacteria 1338
106 Ga0207707_11039703 3300025912 Bacteria 670
107 Ga0207707_11401048 3300025912 Viruses 558
108 Ga0207671_10462473 3300025914 Bacteria 1011
109 Ga0207693_10015289 3300025915 Bacteria 6159
110 Ga0207663_10000498 3300025916 Bacteria 17164
111 Ga0207649_10247084 3300025920 Bacteria 1283
112 Ga0207652_10002027 3300025921 Bacteria 17455
113 Ga0207652_10009957 3300025921 Bacteria 7653
114 Ga0207659_10000010 3300025926 Bacteria 286639
115 Ga0207687_10000007 3300025927 Bacteria 604185
116 Ga0207687_10000013 3300025927 Bacteria 299826
117 Ga0207687_10002226 3300025927 Bacteria 13218
118 Ga0207687_10005882 3300025927 Bacteria 8110
119 Ga0207664_10220508 3300025929 Bacteria 1644
120 Ga0207664_10557216 3300025929 Bacteria 1029
121 Ga0207690_10012815 3300025932 Bacteria 5023
122 Ga0207690_10061007 3300025932 Bacteria 2562
123 Ga0207706_10000012 3300025933 Bacteria 195475
124 Ga0207686_10000048 3300025934 Bacteria 115595
125 Ga0207686_10000447 3300025934 Bacteria 27400
126 Ga0207686_10066837 3300025934 Bacteria 2297
127 Ga0207669_10000018 3300025937 Bacteria 114254
128 Ga0207704_10000159 3300025938 Bacteria 36005
129 Ga0207691_10003586 3300025940 Bacteria 15090
130 Ga0207711_10000006 3300025941 Bacteria 792692
131 Ga0207661_10000253 3300025944 Bacteria 34627
132 Ga0207661_10000347 3300025944 Bacteria 29715
133 Ga0207661_10007582 3300025944 Bacteria 7717
134 Ga0207661_10011874 3300025944 Bacteria 6327
135 Ga0207661_10312594 3300025944 Bacteria 1411
136 Ga0207661_11319321 3300025944 Bacteria 663
137 Ga0207679_10122020 3300025945 Bacteria 2076
138 Ga0207712_10000007 3300025961 Bacteria 539589
139 Ga0207640_10000038 3300025981 Bacteria 108630
140 Ga0207640_10003186 3300025981 Bacteria 8830
141 Ga0207677_10000200 3300026023 Bacteria 48320
142 Ga0207703_10000018 3300026035 Bacteria 271377
143 Ga0207703_10000023 3300026035 Bacteria 222018
144 Ga0207639_10016651 3300026041 Bacteria 5206
145 Ga0207639_10444627 3300026041 Bacteria 1176
146 Ga0207678_10006053 3300026067 Bacteria 10761
147 Ga0207678_10100948 3300026067 Bacteria 2465
148 Ga0207678_10733710 3300026067 Bacteria 870
149 Ga0207702_10000158 3300026078 Bacteria 79984
150 Ga0207702_10004125 3300026078 Bacteria 13025
151 Ga0207702_10074400 3300026078 Bacteria 2932
152 Ga0207702_10907935 3300026078 Bacteria 873
153 Ga0207641_10000238 3300026088 Bacteria 71152
154 Ga0207641_10005198 3300026088 Bacteria 11129
155 Ga0207674_10311977 3300026116 Bacteria 1522
156 Ga0207675_100160408 3300026118 Bacteria 2145
157 Ga0207698_10000013 3300026142 Bacteria 255414
158 Ga0207698_10051367 3300026142 Bacteria 3152
159 Ga0207698_10147511 3300026142 Bacteria 2037
160 Ga0268266_10000047 3300028379 Bacteria 310996
161 Ga0268266_10458750 3300028379 Bacteria 1212
162 Ga0268264_10077350 3300028381 Bacteria 2834
163 Ga0265337_1000807 3300028556 Bacteria 16498
164 Ga0265326_10000252 3300028558 Bacteria 25133
165 Ga0265322_10000001 3300028654 Bacteria 543854
166 Ga0265336_10021526 3300028666 Bacteria 2060
167 Ga0265338_10223262 3300028800 Bacteria 1406
168 Ga0265324_10000755 3300029957 Bacteria 21443
169 Ga0265330_10058676 3300031235 Bacteria 1677
170 Ga0265328_10001094 3300031239 Bacteria 12441
171 Ga0265320_10000002 3300031240 Bacteria 542875
172 Ga0265329_10010994 3300031242 Bacteria 3303
173 Ga0265339_10037208 3300031249 Bacteria 2720
174 Ga0265331_10009837 3300031250 Bacteria 5330
175 Ga0265327_10000011 3300031251 Bacteria 543807
176 Ga0265316_10058138 3300031344 Bacteria 3014
177 Ga0265313_10051454 3300031595 Bacteria 1971
178 Ga0265314_10000062 3300031711 Bacteria 159496
179 Ga0265342_10154010 3300031712 Bacteria 1274
180 Ga0307409_102382391 3300031995 Bacteria 558
181 Ga0451800_0776785 3300041459 Bacteria 683
182 Ga0451807_0588127 3300041486 Archaea 602
183 Ga0451845_0019532 3300041501 Bacteria 769
184 Ga0451853_1220290 3300041512 Bacteria 2128
185 Ga0466958_0030687 3300045836 Bacteria 3194
186 Ga0466967_0620178 3300045976 Bacteria 1068
187 Ga0466967_0908009 3300045976 Bacteria 876
188 Ga0495592_0155533 3300046454 Bacteria 1578
189 Ga0495592_0204079 3300046454 Bacteria 1332
190 Ga0495603_0081390 3300046455 Bacteria 1897
191 Ga0495629_0045971 3300046459 Bacteria 3063
192 Ga0495629_0093629 3300046459 Bacteria 2096
193 Ga0495641_0000228 3300046461 Bacteria 43671
194 Ga0495641_0171756 3300046461 Bacteria 970
195 Ga0495653_0382741 3300046463 Bacteria 898
196 Ga0495582_0000081 3300046473 Bacteria 48557
197 Ga0495639_0256260 3300046475 Archaea 866
198 Ga0495662_0079180 3300046476 Bacteria 1597
199 Ga0495594_0379057 3300046499 Archaea 805
200 Ga0495620_0000824 3300046515 Bacteria 19119
201 Ga0495628_0009655 3300046516 Bacteria 8232
202 Ga0495628_0047414 3300046516 Bacteria 3409
203 Ga0495630_0264005 3300046517 Bacteria 1315
204 Ga0495630_0788984 3300046517 Unclassified 725
205 Ga0495632_0268612 3300046519 Bacteria 761
206 Ga0495644_0003786 3300046523 Bacteria 5953
207 Ga0495652_0045375 3300046529 Bacteria 3779
208 Ga0495586_0071704 3300046535 Bacteria 1893
209 Ga0495587_0019281 3300046536 Bacteria 4224
210 Ga0495587_0019564 3300046536 Bacteria 4188
211 Ga0495645_0019986 3300046543 Bacteria 4828
212 Ga0495645_0743166 3300046543 Bacteria 592
213 Ga0495667_0380482 3300046559 Bacteria 890
214 Ga0495656_0001090 3300046615 Bacteria 8799
215 Ga0495634_0000059 3300046642 Bacteria 88314
216 Ga0495634_0015499 3300046642 Bacteria 5475
217 Ga0495634_0019163 3300046642 Bacteria 4863
218 Ga0495635_0049606 3300046663 Bacteria 2893
219 Ga0495599_0018403 3300046678 Bacteria 4352
220 Ga0495646_0455973 3300046680 Bacteria 660
221 Ga0495647_0000018 3300046681 Bacteria 81701
222 Ga0495658_0000034 3300046683 Bacteria 69176
223 Ga0495669_0014521 3300046684 Bacteria 3365
224 Ga0495669_0018748 3300046684 Bacteria 2978
225 Ga0495613_0000801 3300046689 Bacteria 24391
226 Ga0495613_0717320 3300046689 Archaea 657
227 Ga0495613_1007922 3300046689 Bacteria 535
228 Ga0495624_0000647 3300046690 Bacteria 27259
229 Ga0495624_0002509 3300046690 Bacteria 13903
230 Ga0495649_0594347 3300046694 Bacteria 546
231 Ga0495600_0007876 3300046809 Bacteria 6525
232 Ga0495604_0000137 3300047317 Bacteria 62542
233 Ga0495604_0009878 3300047317 Bacteria 7555
234 Ga0495672_0124098 3300047320 Bacteria 1368
235 Ga0495676_0021340 3300047321 Bacteria 5660
236 Ga0495676_0117044 3300047321 Bacteria 1945
237 Ga0495676_0119899 3300047321 Bacteria 1915
238 Ga0495676_0328921 3300047321 Bacteria 1025
239 Ga0495680_0003958 3300047322 Bacteria 14324
240 Ga0495680_0149362 3300047322 Unclassified 1705
241 Ga0495679_010145 3300047446 Bacteria 3718
242 Ga0495679_060490 3300047446 Bacteria 1112
243 Ga0495684_0145117 3300047471 Bacteria 1778
244 Ga0495686_0528858 3300047472 Bacteria 618
245 Ga0495602_0000041 3300048088 Bacteria 126954
246 Ga0495602_0013815 3300048088 Bacteria 8231
247 Ga0495602_0140495 3300048088 Bacteria 1912
248 Ga0495614_0668837 3300048089 Bacteria 501
249 Ga0496100_0000002 3300048903 Bacteria 489057
250 Ga0496100_0492478 3300048903 Bacteria 944
251 Ga0496101_0000001 3300048904 Bacteria 489057
252 Ga0496101_0124072 3300048904 Bacteria 1955
253 Ga0496102_0000115 3300048905 Bacteria 114224
254 Ga0496102_0927346 3300048905 Bacteria 792
255 Ga0496103_0000008 3300048906 Bacteria 340474
256 Ga0496104_0008811 3300048907 Bacteria 8969
257 Ga0496105_0162030 3300048908 Bacteria 1836
258 Ga0496106_0000084 3300048909 Bacteria 74135
259 Ga0496107_0000003 3300048910 Bacteria 304038
260 Ga0496107_0145587 3300048910 Bacteria 1752
261 Ga0496108_0000001 3300048911 Bacteria 919044
262 Ga0496108_0041033 3300048911 Bacteria 3861
263 Ga0496108_1421908 3300048911 Unclassified 579
264 Ga0496109_0000003 3300048912 Bacteria 420862
265 Ga0496109_0000249 3300048912 Bacteria 51718
266 Ga0496109_0001118 3300048912 Bacteria 22284
267 Ga0496110_0000021 3300048913 Bacteria 77064
268 Ga0496110_0011255 3300048913 Bacteria 7314
269 Ga0496111_0000009 3300048914 Bacteria 93943
270 Ga0496111_0418893 3300048914 Bacteria 989
271 Ga0496111_1235152 3300048914 Bacteria 528
272 Ga0496112_0000006 3300048915 Bacteria 365227
273 Ga0496112_0067246 3300048915 Bacteria 3537
274 Ga0496112_0349961 3300048915 Bacteria 1420
275 Ga0496113_0000004 3300048916 Bacteria 109489
276 Ga0496113_0057024 3300048916 Bacteria 2934
277 Ga0496114_0000101 3300048917 Bacteria 61589
278 Ga0496115_0000003 3300048918 Bacteria 354994
279 Ga0496115_0000200 3300048918 Bacteria 55755
280 Ga0496118_0000833 3300048921 Bacteria 49030
281 Ga0496119_0006046 3300048922 Bacteria 11353
282 Ga0496120_0288837 3300048923 Unclassified 755
283 Ga0496121_0031670 3300048924 Bacteria 4826
284 Ga0496121_0075586 3300048924 Bacteria 2690
285 Ga0496125_0064038 3300048928 Bacteria 2926
286 Ga0496125_0376513 3300048928 Bacteria 838
287 Ga0501031_0003265 3300049568 Bacteria 10420
288 Ga0501032_0004103 3300049569 Bacteria 11037
289 Ga0501033_0000900 3300049570 Bacteria 27183
290 Ga0501034_0057726 3300049571 Bacteria 3901
291 Ga0501034_0059249 3300049571 Bacteria 3846
292 Ga0501036_0044867 3300049572 Bacteria 3745
293 Ga0501037_0004199 3300049573 Bacteria 10445
294 Ga0501038_0007149 3300049574 Bacteria 10316
295 Ga0501039_0011339 3300049575 Bacteria 6788
296 Ga0501040_0014116 3300049576 Bacteria 5259
297 Ga0501042_0150840 3300049578 Bacteria 1676
298 Ga0501042_0458563 3300049578 Bacteria 924
299 Ga0501043_0010751 3300049579 Bacteria 7167
300 Ga0501046_0006462 3300049580 Bacteria 10370
301 Ga0501047_0058444 3300049581 Bacteria 3725
302 Ga0501047_0084768 3300049581 Bacteria 3045
303 Ga0501048_0004528 3300049582 Bacteria 10586
304 Ga0501068_0053299 3300049584 Bacteria 2448
305 Ga0501069_0060903 3300049585 Bacteria 2107
306 Ga0501070_0000680 3300049586 Bacteria 31108
307 Ga0501071_0141130 3300049587 Bacteria 1794
308 Ga0501072_1000810 3300049588 Unclassified 652
309 Ga0501073_0004593 3300049589 Bacteria 10377
310 Ga0501074_0043778 3300049590 Bacteria 3240
311 Ga0501075_0265467 3300049591 Bacteria 1308
312 Ga0501076_1655363 3300049592 Unclassified 525
313 Ga0501079_0004743 3300049741 Bacteria 10072
314 Ga0501080_0112944 3300049742 Bacteria 2518
315 Ga0501080_0941486 3300049742 Bacteria 751
316 Ga0501081_0915598 3300049743 Unclassified 661
317 Ga0501083_0035159 3300049744 Bacteria 3423
318 Ga0501083_0040357 3300049744 Bacteria 3168
319 Ga0501035_0000887 3300049822 Bacteria 31755
320 Ga0501044_0009237 3300049823 Bacteria 10767
321 Ga0501044_0246722 3300049823 Bacteria 1728
322 Ga0501044_0475788 3300049823 Bacteria 1153
323 nmdc:mga0yw44_167241_c1 3300050492 Bacteria 1442
324 nmdc:mga0qj67_179563_c1 3300050509 Bacteria 1719
325 nmdc:mga08y16_609188_c1 3300050511 Bacteria 1100
326 nmdc:mga0a205_1483_c2 3300050515 Bacteria 8882
327 nmdc:mga0a205_6_c1 3300050515 Bacteria 129758
328 Ga0495601_0000013 3300053077 Bacteria 226476
329 Ga0495601_0000855 3300053077 Bacteria 16586
330 Ga0495601_0070575 3300053077 Bacteria 2230
331 Ga0495612_0273610 3300053078 Bacteria 754
332 Ga0495655_0000001 3300053083 Bacteria 419518
333 Ga0495655_0011725 3300053083 Bacteria 1768
334 Ga0495595_0010459 3300053084 Bacteria 3856
335 Ga0495619_0000025 3300053085 Bacteria 167905
336 Ga0495619_0000131 3300053085 Bacteria 55500
337 Ga0495619_0000157 3300053085 Bacteria 49848
338 Ga0495619_0076044 3300053085 Bacteria 2254
339 Ga0500566_0055887 3300053094 Bacteria 2246
340 Ga0500614_035832 3300053123 Bacteria 1238
341 Ga0500628_000033 3300053129 Bacteria 52431
342 Ga0501082_0012764 3300060353 Bacteria 7219

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005344 Ga0070661_101191078 Ga0070661_1011910781 129
2 3300046519 Ga0495632_0268612 Ga0495632_0268612_194_619 129
3 3300046694 Ga0495649_0594347 Ga0495649_0594347_79_504 129
4 3300010159 Ga0099796_10578156 Ga0099796_105781561 130
5 3300049581 Ga0501047_0084768 Ga0501047_0084768_1237_1701 130
6 3300049744 Ga0501083_0035159 Ga0501083_0035159_945_1409 130
7 3300049823 Ga0501044_0246722 Ga0501044_0246722_867_1331 130
8 3300005548 Ga0070665_100281623 Ga0070665_1002816232 132
9 3300028379 Ga0268266_10458750 Ga0268266_104587502 132
10 3300048921 Ga0496118_0000833 Ga0496118_0000833_3963_4397 132
11 3300048924 Ga0496121_0031670 Ga0496121_0031670_368_802 132
12 3300048928 Ga0496125_0064038 Ga0496125_0064038_173_607 132
13 3300049742 Ga0501080_0941486 Ga0501080_0941486_40_492 136
14 3300005455 Ga0070663_100024055 Ga0070663_1000240552 137
15 3300005458 Ga0070681_10352533 Ga0070681_103525332 137
16 3300005530 Ga0070679_100008639 Ga0070679_1000086392 137
17 3300005535 Ga0070684_101593764 Ga0070684_1015937641 137
18 3300025912 Ga0207707_11039703 Ga0207707_110397032 138
19 3300025920 Ga0207649_10247084 Ga0207649_102470842 138
20 3300025921 Ga0207652_10009957 Ga0207652_100099574 138
21 3300026067 Ga0207678_10006053 Ga0207678_100060539 138
22 3300048903 Ga0496100_0492478 Ga0496100_0492478_192_665 138
23 3300049590 Ga0501074_0043778 Ga0501074_0043778_745_1188 140
24 3300005366 Ga0070659_100013281 Ga0070659_1000132815 143
25 3300005841 Ga0068863_100000342 Ga0068863_10000034244 143
26 3300006852 Ga0075433_10000900 Ga0075433_1000090015 143
27 3300010375 Ga0105239_10516347 Ga0105239_105163472 143
28 3300011119 Ga0105246_10267107 Ga0105246_102671072 143
29 3300025932 Ga0207690_10012815 Ga0207690_100128154 143
30 3300026088 Ga0207641_10000238 Ga0207641_1000023878 143
31 3300041501 Ga0451845_0019532 Ga0451845_0019532_95_556 143
32 3300046535 Ga0495586_0071704 Ga0495586_0071704_1419_1850 143
33 3300046615 Ga0495656_0001090 Ga0495656_0001090_928_1386 143
34 3300046642 Ga0495634_0000059 Ga0495634_0000059_49577_50008 143
35 3300047321 Ga0495676_0328921 Ga0495676_0328921_365_796 143
36 3300049591 Ga0501075_0265467 Ga0501075_0265467_803_1261 143
37 3300050492 nmdc:mga0yw44_167241_c1 nmdc:mga0yw44_167241_c1_878_1330 143
38 3300050515 nmdc:mga0a205_6_c1 nmdc:mga0a205_6_c1_113922_114386 143
39 3300005455 Ga0070663_100004257 Ga0070663_1000042578 144
40 3300026067 Ga0207678_10733710 Ga0207678_107337102 144
41 3300046454 Ga0495592_0155533 Ga0495592_0155533_332_766 144
42 3300046529 Ga0495652_0045375 Ga0495652_0045375_3268_3723 144
43 3300046689 Ga0495613_1007922 Ga0495613_1007922_19_453 144
44 3300048913 Ga0496110_0011255 Ga0496110_0011255_6647_7081 144
45 3300048914 Ga0496111_1235152 Ga0496111_1235152_65_499 144
46 3300005329 Ga0070683_100012149 Ga0070683_1000121495 145
47 3300005329 Ga0070683_100012949 Ga0070683_1000129498 145
48 3300005331 Ga0070670_100407513 Ga0070670_1004075132 145
49 3300005337 Ga0070682_100562011 Ga0070682_1005620112 145
50 3300005365 Ga0070688_100003810 Ga0070688_1000038106 145
51 3300005367 Ga0070667_100139764 Ga0070667_1001397642 145
52 3300005466 Ga0070685_10000141 Ga0070685_1000014149 145
53 3300005535 Ga0070684_100036240 Ga0070684_1000362402 145
54 3300005535 Ga0070684_100212087 Ga0070684_1002120872 145
55 3300005539 Ga0068853_100057086 Ga0068853_1000570864 145
56 3300005577 Ga0068857_100783236 Ga0068857_1007832361 145
57 3300005614 Ga0068856_100000629 Ga0068856_1000006296 145
58 3300005841 Ga0068863_100102836 Ga0068863_1001028362 145
59 3300006163 Ga0070715_10224982 Ga0070715_102249822 145
60 3300006175 Ga0070712_100055590 Ga0070712_1000555902 145
61 3300006881 Ga0068865_100000023 Ga0068865_10000002390 145
62 3300009098 Ga0105245_10123396 Ga0105245_101233962 145
63 3300013105 Ga0157369_10000020 Ga0157369_10000020184 145
64 3300014968 Ga0157379_10405806 Ga0157379_104058062 145
65 3300025915 Ga0207693_10015289 Ga0207693_100152894 145
66 3300025927 Ga0207687_10002226 Ga0207687_100022262 145
67 3300025938 Ga0207704_10000159 Ga0207704_1000015920 145
68 3300025944 Ga0207661_10000253 Ga0207661_1000025334 145
69 3300025944 Ga0207661_10000347 Ga0207661_1000034733 145
70 3300026041 Ga0207639_10444627 Ga0207639_104446272 145
71 3300026078 Ga0207702_10000158 Ga0207702_1000015872 145
72 3300026088 Ga0207641_10005198 Ga0207641_100051982 145
73 3300026116 Ga0207674_10311977 Ga0207674_103119771 145
74 3300026118 Ga0207675_100160408 Ga0207675_1001604083 145
75 3300026142 Ga0207698_10147511 Ga0207698_101475112 145
76 3300041486 Ga0451807_0588127 Ga0451807_0588127_88_555 145
77 3300045836 Ga0466958_0030687 Ga0466958_0030687_1364_1801 145
78 3300045976 Ga0466967_0908009 Ga0466967_0908009_298_735 145
79 3300046459 Ga0495629_0093629 Ga0495629_0093629_947_1387 145
80 3300046516 Ga0495628_0047414 Ga0495628_0047414_1283_1720 145
81 3300046678 Ga0495599_0018403 Ga0495599_0018403_91_528 145
82 3300046680 Ga0495646_0455973 Ga0495646_0455973_187_624 145
83 3300046690 Ga0495624_0000647 Ga0495624_0000647_10004_10441 145
84 3300047321 Ga0495676_0021340 Ga0495676_0021340_2003_2443 145
85 3300048905 Ga0496102_0000115 Ga0496102_0000115_101458_101898 145
86 3300048906 Ga0496103_0000008 Ga0496103_0000008_108483_108923 145
87 3300048911 Ga0496108_0041033 Ga0496108_0041033_3305_3742 145
88 3300048912 Ga0496109_0000249 Ga0496109_0000249_38197_38634 145
89 3300048915 Ga0496112_0349961 Ga0496112_0349961_219_656 145
90 3300049568 Ga0501031_0003265 Ga0501031_0003265_2259_2717 145
91 3300049569 Ga0501032_0004103 Ga0501032_0004103_2190_2648 145
92 3300049570 Ga0501033_0000900 Ga0501033_0000900_18964_19422 145
93 3300049571 Ga0501034_0057726 Ga0501034_0057726_363_821 145
94 3300049571 Ga0501034_0059249 Ga0501034_0059249_3282_3740 145
95 3300049572 Ga0501036_0044867 Ga0501036_0044867_2161_2619 145
96 3300049573 Ga0501037_0004199 Ga0501037_0004199_7668_8126 145
97 3300049574 Ga0501038_0007149 Ga0501038_0007149_2159_2617 145
98 3300049575 Ga0501039_0011339 Ga0501039_0011339_4174_4632 145
99 3300049576 Ga0501040_0014116 Ga0501040_0014116_4416_4874 145
100 3300049578 Ga0501042_0150840 Ga0501042_0150840_372_839 145
101 3300049578 Ga0501042_0458563 Ga0501042_0458563_451_909 145
102 3300049579 Ga0501043_0010751 Ga0501043_0010751_4524_4982 145
103 3300049580 Ga0501046_0006462 Ga0501046_0006462_2154_2612 145
104 3300049581 Ga0501047_0058444 Ga0501047_0058444_2182_2640 145
105 3300049582 Ga0501048_0004528 Ga0501048_0004528_7962_8420 145
106 3300049584 Ga0501068_0053299 Ga0501068_0053299_1168_1626 145
107 3300049585 Ga0501069_0060903 Ga0501069_0060903_633_1091 145
108 3300049586 Ga0501070_0000680 Ga0501070_0000680_7722_8180 145
109 3300049587 Ga0501071_0141130 Ga0501071_0141130_408_866 145
110 3300049589 Ga0501073_0004593 Ga0501073_0004593_7734_8192 145
111 3300049741 Ga0501079_0004743 Ga0501079_0004743_2104_2562 145
112 3300049742 Ga0501080_0112944 Ga0501080_0112944_1076_1534 145
113 3300049744 Ga0501083_0040357 Ga0501083_0040357_568_1026 145
114 3300049822 Ga0501035_0000887 Ga0501035_0000887_22913_23371 145
115 3300049823 Ga0501044_0009237 Ga0501044_0009237_2302_2760 145
116 3300049823 Ga0501044_0475788 Ga0501044_0475788_437_874 145
117 3300050511 nmdc:mga08y16_609188_c1 nmdc:mga08y16_609188_c1_452_889 145
118 3300053077 Ga0495601_0000855 Ga0495601_0000855_13495_13932 145
119 3300053083 Ga0495655_0011725 Ga0495655_0011725_48_485 145
120 3300060353 Ga0501082_0012764 Ga0501082_0012764_1342_1800 145
121 3300005337 Ga0070682_100000150 Ga0070682_10000015044 146
122 3300005337 Ga0070682_101210200 Ga0070682_1012102002 146
123 3300005345 Ga0070692_10025703 Ga0070692_100257032 146
124 3300005354 Ga0070675_100000027 Ga0070675_10000002740 146
125 3300005366 Ga0070659_100038409 Ga0070659_1000384092 146
126 3300005435 Ga0070714_100253821 Ga0070714_1002538212 146
127 3300005435 Ga0070714_100661610 Ga0070714_1006616102 146
128 3300005455 Ga0070663_100078648 Ga0070663_1000786481 146
129 3300005563 Ga0068855_101134667 Ga0068855_1011346672 146
130 3300005614 Ga0068856_100009027 Ga0068856_1000090275 146
131 3300005616 Ga0068852_100000006 Ga0068852_100000006143 146
132 3300005834 Ga0068851_10001416 Ga0068851_100014168 146
133 3300005842 Ga0068858_100000065 Ga0068858_10000006540 146
134 3300009098 Ga0105245_10000254 Ga0105245_1000025411 146
135 3300009098 Ga0105245_10010405 Ga0105245_100104059 146
136 3300009101 Ga0105247_10000316 Ga0105247_1000031630 146
137 3300009147 Ga0114129_10428915 Ga0114129_104289152 146
138 3300009174 Ga0105241_10812675 Ga0105241_108126752 146
139 3300009176 Ga0105242_10311740 Ga0105242_103117402 146
140 3300009177 Ga0105248_10000008 Ga0105248_10000008303 146
141 3300009545 Ga0105237_10212570 Ga0105237_102125702 146
142 3300009551 Ga0105238_11879181 Ga0105238_118791811 146
143 3300010375 Ga0105239_10040162 Ga0105239_100401622 146
144 3300010375 Ga0105239_10184946 Ga0105239_101849462 146
145 3300013104 Ga0157370_10038604 Ga0157370_100386042 146
146 3300013296 Ga0157374_10808016 Ga0157374_108080162 146
147 3300013307 Ga0157372_10000112 Ga0157372_1000011243 146
148 3300013308 Ga0157375_10001213 Ga0157375_100012135 146
149 3300025321 Ga0207656_10000385 Ga0207656_1000038513 146
150 3300025900 Ga0207710_10000458 Ga0207710_1000045811 146
151 3300025905 Ga0207685_10040001 Ga0207685_100400012 146
152 3300025914 Ga0207671_10462473 Ga0207671_104624732 146
153 3300025926 Ga0207659_10000010 Ga0207659_1000001059 146
154 3300025927 Ga0207687_10000007 Ga0207687_10000007437 146
155 3300025927 Ga0207687_10005882 Ga0207687_100058822 146
156 3300025929 Ga0207664_10220508 Ga0207664_102205082 146
157 3300025929 Ga0207664_10557216 Ga0207664_105572162 146
158 3300025932 Ga0207690_10061007 Ga0207690_100610074 146
159 3300025934 Ga0207686_10066837 Ga0207686_100668372 146
160 3300025940 Ga0207691_10003586 Ga0207691_100035869 146
161 3300025941 Ga0207711_10000006 Ga0207711_10000006697 146
162 3300025944 Ga0207661_11319321 Ga0207661_113193211 146
163 3300026035 Ga0207703_10000018 Ga0207703_1000001840 146
164 3300026067 Ga0207678_10100948 Ga0207678_101009481 146
165 3300026078 Ga0207702_10074400 Ga0207702_100744002 146
166 3300026142 Ga0207698_10000013 Ga0207698_1000001346 146
167 3300028556 Ga0265337_1000807 Ga0265337_10008076 146
168 3300028558 Ga0265326_10000252 Ga0265326_100002527 146
169 3300028654 Ga0265322_10000001 Ga0265322_10000001377 146
170 3300028666 Ga0265336_10021526 Ga0265336_100215262 146
171 3300028800 Ga0265338_10223262 Ga0265338_102232622 146
172 3300029957 Ga0265324_10000755 Ga0265324_100007555 146
173 3300031235 Ga0265330_10058676 Ga0265330_100586762 146
174 3300031239 Ga0265328_10001094 Ga0265328_100010947 146
175 3300031240 Ga0265320_10000002 Ga0265320_10000002376 146
176 3300031242 Ga0265329_10010994 Ga0265329_100109942 146
177 3300031249 Ga0265339_10037208 Ga0265339_100372084 146
178 3300031250 Ga0265331_10009837 Ga0265331_100098377 146
179 3300031251 Ga0265327_10000011 Ga0265327_10000011376 146
180 3300031344 Ga0265316_10058138 Ga0265316_100581382 146
181 3300031595 Ga0265313_10051454 Ga0265313_100514542 146
182 3300031711 Ga0265314_10000062 Ga0265314_10000062110 146
183 3300031712 Ga0265342_10154010 Ga0265342_101540102 146
184 3300046454 Ga0495592_0204079 Ga0495592_0204079_786_1226 146
185 3300046475 Ga0495639_0256260 Ga0495639_0256260_221_661 146
186 3300046476 Ga0495662_0079180 Ga0495662_0079180_1000_1443 146
187 3300046499 Ga0495594_0379057 Ga0495594_0379057_209_649 146
188 3300046515 Ga0495620_0000824 Ga0495620_0000824_15347_15814 146
189 3300046516 Ga0495628_0009655 Ga0495628_0009655_3178_3621 146
190 3300046536 Ga0495587_0019564 Ga0495587_0019564_2457_2897 146
191 3300046689 Ga0495613_0000801 Ga0495613_0000801_19276_19716 146
192 3300046689 Ga0495613_0717320 Ga0495613_0717320_50_511 146
193 3300046809 Ga0495600_0007876 Ga0495600_0007876_5022_5462 146
194 3300047317 Ga0495604_0000137 Ga0495604_0000137_56164_56604 146
195 3300047317 Ga0495604_0009878 Ga0495604_0009878_2831_3271 146
196 3300047321 Ga0495676_0117044 Ga0495676_0117044_106_561 146
197 3300048088 Ga0495602_0000041 Ga0495602_0000041_71406_71846 146
198 3300048088 Ga0495602_0013815 Ga0495602_0013815_3630_4073 146
199 3300048089 Ga0495614_0668837 Ga0495614_0668837_19_459 146
200 3300048904 Ga0496101_0124072 Ga0496101_0124072_870_1343 146
201 3300048907 Ga0496104_0008811 Ga0496104_0008811_7308_7781 146
202 3300048910 Ga0496107_0145587 Ga0496107_0145587_164_637 146
203 3300048911 Ga0496108_1421908 Ga0496108_1421908_48_521 146
204 3300048913 Ga0496110_0000021 Ga0496110_0000021_2429_2869 146
205 3300048914 Ga0496111_0000009 Ga0496111_0000009_74232_74672 146
206 3300048914 Ga0496111_0418893 Ga0496111_0418893_17_490 146
207 3300048916 Ga0496113_0000004 Ga0496113_0000004_104_544 146
208 3300048922 Ga0496119_0006046 Ga0496119_0006046_4255_4728 146
209 3300048923 Ga0496120_0288837 Ga0496120_0288837_243_716 146
210 3300048924 Ga0496121_0075586 Ga0496121_0075586_797_1270 146
211 3300048928 Ga0496125_0376513 Ga0496125_0376513_319_792 146
212 3300049592 Ga0501076_1655363 Ga0501076_1655363_33_503 146
213 3300053077 Ga0495601_0000013 Ga0495601_0000013_23397_23837 146
214 3300053077 Ga0495601_0070575 Ga0495601_0070575_1023_1463 146
215 3300053084 Ga0495595_0010459 Ga0495595_0010459_2592_3032 146
216 3300053085 Ga0495619_0000025 Ga0495619_0000025_126756_127217 146
217 3300053085 Ga0495619_0076044 Ga0495619_0076044_1315_1755 146
218 3300002074 JGI24748J21848_1000328 JGI24748J21848_10003282 147
219 3300002239 JGI24034J26672_10000561 JGI24034J26672_100005614 147
220 3300002244 JGI24742J22300_10035180 JGI24742J22300_100351802 147
221 3300005329 Ga0070683_100003109 Ga0070683_1000031093 147
222 3300005329 Ga0070683_100053616 Ga0070683_1000536162 147
223 3300005333 Ga0070677_10000022 Ga0070677_1000002234 147
224 3300005337 Ga0070682_100000099 Ga0070682_10000009989 147
225 3300005338 Ga0068868_100000450 Ga0068868_10000045014 147
226 3300005341 Ga0070691_10000379 Ga0070691_1000037912 147
227 3300005356 Ga0070674_100000683 Ga0070674_1000006837 147
228 3300005435 Ga0070714_100021986 Ga0070714_1000219862 147
229 3300005439 Ga0070711_100000734 Ga0070711_1000007344 147
230 3300005441 Ga0070700_100896750 Ga0070700_1008967502 147
231 3300005457 Ga0070662_100000004 Ga0070662_100000004157 147
232 3300005530 Ga0070679_100000243 Ga0070679_1000002431 147
233 3300005535 Ga0070684_100008707 Ga0070684_1000087077 147
234 3300005535 Ga0070684_100031674 Ga0070684_1000316742 147
235 3300005539 Ga0068853_100040286 Ga0068853_1000402865 147
236 3300005545 Ga0070695_100058037 Ga0070695_1000580372 147
237 3300005547 Ga0070693_100183114 Ga0070693_1001831142 147
238 3300005548 Ga0070665_100000106 Ga0070665_10000010617 147
239 3300005564 Ga0070664_100050508 Ga0070664_1000505082 147
240 3300005578 Ga0068854_100000156 Ga0068854_10000015648 147
241 3300005578 Ga0068854_100002911 Ga0068854_10000291111 147
242 3300005614 Ga0068856_100073487 Ga0068856_1000734872 147
243 3300005616 Ga0068852_100130217 Ga0068852_1001302173 147
244 3300005718 Ga0068866_10000001 Ga0068866_10000001420 147
245 3300005842 Ga0068858_100000009 Ga0068858_100000009172 147
246 3300005843 Ga0068860_100097151 Ga0068860_1000971512 147
247 3300006175 Ga0070712_100258409 Ga0070712_1002584092 147
248 3300006852 Ga0075433_10029904 Ga0075433_100299046 147
249 3300009098 Ga0105245_10000020 Ga0105245_1000002014 147
250 3300009148 Ga0105243_10471675 Ga0105243_104716752 147
251 3300009176 Ga0105242_10000032 Ga0105242_1000003229 147
252 3300009176 Ga0105242_10000454 Ga0105242_100004548 147
253 3300013104 Ga0157370_10018120 Ga0157370_100181206 147
254 3300013296 Ga0157374_10510359 Ga0157374_105103592 147
255 3300013308 Ga0157375_10001538 Ga0157375_100015385 147
256 3300017792 Ga0163161_10034432 Ga0163161_100344325 147
257 3300025893 Ga0207682_10000005 Ga0207682_1000000543 147
258 3300025899 Ga0207642_10000002 Ga0207642_10000002139 147
259 3300025912 Ga0207707_10320521 Ga0207707_103205211 147
260 3300025912 Ga0207707_11401048 Ga0207707_114010481 147
261 3300025916 Ga0207663_10000498 Ga0207663_100004984 147
262 3300025921 Ga0207652_10002027 Ga0207652_1000202718 147
263 3300025927 Ga0207687_10000013 Ga0207687_1000001356 147
264 3300025933 Ga0207706_10000012 Ga0207706_1000001261 147
265 3300025934 Ga0207686_10000048 Ga0207686_1000004829 147
266 3300025934 Ga0207686_10000447 Ga0207686_1000044713 147
267 3300025937 Ga0207669_10000018 Ga0207669_100000187 147
268 3300025944 Ga0207661_10007582 Ga0207661_100075828 147
269 3300025944 Ga0207661_10011874 Ga0207661_100118743 147
270 3300025944 Ga0207661_10312594 Ga0207661_103125942 147
271 3300025945 Ga0207679_10122020 Ga0207679_101220202 147
272 3300025961 Ga0207712_10000007 Ga0207712_10000007430 147
273 3300025981 Ga0207640_10000038 Ga0207640_1000003847 147
274 3300025981 Ga0207640_10003186 Ga0207640_100031865 147
275 3300026023 Ga0207677_10000200 Ga0207677_1000020032 147
276 3300026035 Ga0207703_10000023 Ga0207703_1000002379 147
277 3300026041 Ga0207639_10016651 Ga0207639_100166512 147
278 3300026078 Ga0207702_10004125 Ga0207702_1000412515 147
279 3300026078 Ga0207702_10907935 Ga0207702_109079352 147
280 3300026142 Ga0207698_10051367 Ga0207698_100513672 147
281 3300028379 Ga0268266_10000047 Ga0268266_10000047169 147
282 3300028381 Ga0268264_10077350 Ga0268264_100773502 147
283 3300031995 Ga0307409_102382391 Ga0307409_1023823911 147
284 3300041459 Ga0451800_0776785 Ga0451800_0776785_42_485 147
285 3300041512 Ga0451853_1220290 Ga0451853_1220290_591_1034 147
286 3300045976 Ga0466967_0620178 Ga0466967_0620178_522_992 147
287 3300046455 Ga0495603_0081390 Ga0495603_0081390_1358_1804 147
288 3300046459 Ga0495629_0045971 Ga0495629_0045971_19_477 147
289 3300046461 Ga0495641_0000228 Ga0495641_0000228_12404_12847 147
290 3300046461 Ga0495641_0171756 Ga0495641_0171756_444_887 147
291 3300046463 Ga0495653_0382741 Ga0495653_0382741_28_474 147
292 3300046473 Ga0495582_0000081 Ga0495582_0000081_46716_47159 147
293 3300046517 Ga0495630_0264005 Ga0495630_0264005_126_584 147
294 3300046517 Ga0495630_0788984 Ga0495630_0788984_255_698 147
295 3300046523 Ga0495644_0003786 Ga0495644_0003786_460_906 147
296 3300046536 Ga0495587_0019281 Ga0495587_0019281_917_1375 147
297 3300046543 Ga0495645_0019986 Ga0495645_0019986_243_689 147
298 3300046543 Ga0495645_0743166 Ga0495645_0743166_96_539 147
299 3300046559 Ga0495667_0380482 Ga0495667_0380482_25_471 147
300 3300046642 Ga0495634_0015499 Ga0495634_0015499_4388_4831 147
301 3300046642 Ga0495634_0019163 Ga0495634_0019163_3886_4332 147
302 3300046663 Ga0495635_0049606 Ga0495635_0049606_2304_2747 147
303 3300046681 Ga0495647_0000018 Ga0495647_0000018_79866_80312 147
304 3300046683 Ga0495658_0000034 Ga0495658_0000034_49216_49659 147
305 3300046684 Ga0495669_0014521 Ga0495669_0014521_1516_1989 147
306 3300046684 Ga0495669_0018748 Ga0495669_0018748_400_867 147
307 3300046690 Ga0495624_0002509 Ga0495624_0002509_3899_4345 147
308 3300047320 Ga0495672_0124098 Ga0495672_0124098_270_752 147
309 3300047321 Ga0495676_0119899 Ga0495676_0119899_1390_1833 147
310 3300047322 Ga0495680_0003958 Ga0495680_0003958_5676_6119 147
311 3300047322 Ga0495680_0149362 Ga0495680_0149362_66_509 147
312 3300047446 Ga0495679_010145 Ga0495679_010145_227_670 147
313 3300047446 Ga0495679_060490 Ga0495679_060490_337_780 147
314 3300047471 Ga0495684_0145117 Ga0495684_0145117_1061_1504 147
315 3300047472 Ga0495686_0528858 Ga0495686_0528858_23_505 147
316 3300048088 Ga0495602_0140495 Ga0495602_0140495_729_1175 147
317 3300048903 Ga0496100_0000002 Ga0496100_0000002_435807_436280 147
318 3300048904 Ga0496101_0000001 Ga0496101_0000001_435807_436280 147
319 3300048905 Ga0496102_0927346 Ga0496102_0927346_255_698 147
320 3300048908 Ga0496105_0162030 Ga0496105_0162030_551_1018 147
321 3300048909 Ga0496106_0000084 Ga0496106_0000084_52750_53223 147
322 3300048910 Ga0496107_0000003 Ga0496107_0000003_84550_85023 147
323 3300048911 Ga0496108_0000001 Ga0496108_0000001_731333_731779 147
324 3300048912 Ga0496109_0000003 Ga0496109_0000003_405879_406325 147
325 3300048912 Ga0496109_0001118 Ga0496109_0001118_13877_14323 147
326 3300048915 Ga0496112_0000006 Ga0496112_0000006_279302_279766 147
327 3300048915 Ga0496112_0067246 Ga0496112_0067246_1522_1989 147
328 3300048916 Ga0496113_0057024 Ga0496113_0057024_2218_2661 147
329 3300048917 Ga0496114_0000101 Ga0496114_0000101_23981_24439 147
330 3300048918 Ga0496115_0000003 Ga0496115_0000003_112119_112577 147
331 3300048918 Ga0496115_0000200 Ga0496115_0000200_31317_31775 147
332 3300049588 Ga0501072_1000810 Ga0501072_1000810_25_489 147
333 3300049743 Ga0501081_0915598 Ga0501081_0915598_35_478 147
334 3300050509 nmdc:mga0qj67_179563_c1 nmdc:mga0qj67_179563_c1_106_585 147
335 3300050515 nmdc:mga0a205_1483_c2 nmdc:mga0a205_1483_c2_130_576 147
336 3300053078 Ga0495612_0273610 Ga0495612_0273610_22_468 147
337 3300053083 Ga0495655_0000001 Ga0495655_0000001_292985_293443 147
338 3300053085 Ga0495619_0000131 Ga0495619_0000131_82_543 147
339 3300053085 Ga0495619_0000157 Ga0495619_0000157_33663_34106 147
340 3300053094 Ga0500566_0055887 Ga0500566_0055887_761_1219 147
341 3300053123 Ga0500614_035832 Ga0500614_035832_710_1153 147
342 3300053129 Ga0500628_000033 Ga0500628_000033_45016_45474 147

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01325

Fe_dep_repress

Iron dependent repressor, N-terminal DNA binding domain

3

62

0.96

PF02742

Fe_dep_repr_C

Iron dependent repressor, metal binding and dimerisation domain

65

126

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
4ija-assembly1.cif.gz_B structure of s. aureus methicillin resistance factor mecr2 0.8774 8 65
2h09-assembly1.cif.gz_A-2 crystal structure of diphtheria toxin repressor like protein from e. coli 0.8625 4 108
3k2z-assembly1.cif.gz_A crystal structure of a lexa protein from thermotoga maritima 0.8596 8 65
1stz-assembly1.cif.gz_C crystal structure of a hypothetical protein at 2.2 a resolution 0.8582 8 79
1stz-assembly1.cif.gz_A crystal structure of a hypothetical protein at 2.2 a resolution 0.8546 8 79
ID Description Score Start End Superfamily
3r61B01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9525 7 75 1.10.10.10
4hx4A01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9515 8 75 1.10.10.10
3r61A01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9511 7 75 1.10.10.10
4hv5A01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9495 7 75 1.10.10.10
2f5eB01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.949 8 75 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A538KEP2-F1-model_v4 Manganese transport regulator 0.9742 9 100 GO:0003700
GO:0043565
GO:0046914
GO:0046983
AF-A0A7V9M3A4-F1-model_v4 Manganese transport regulator 0.9653 8 100 GO:0003677
GO:0003700
GO:0005737
GO:0046914
GO:0046983
AF-A0A3C0A557-F1-model_v4 Iron-dependent repressor 0.9469 6 107 GO:0003677
GO:0003700
GO:0005737
GO:0046914
GO:0046983
AF-A0A538KEP2-F1-model_v4 Manganese transport regulator 0.9441 9 100 GO:0003700
GO:0043565
GO:0046914
GO:0046983
AF-A0A4Y9H9G0-F1-model_v4 deleted 0.9401 8 99

Feature Viewer

pLDDT pTM Quality
85.63 0.72 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map