F415210

General Info

Members Datasets Scaffolds Average Seq Length
342 174 684 246

Family's Representative Sequence

Representative Sequence 3300031239|Ga0265328_10013004|Ga0265328_100130044
Length 282
Sequence VTGARIHLRHTFPVIYSQGQVRVRADIFSIIEVRMSGHSKWATIKHKKGALDAKRGKIFTRLLKEIAVAAKGGGNPDTNARLRTAVAAAKAENMPQDNIKRAIQRGTGELEGVNYEEITFEGYGPGGVAIVVETLTDNRNRTVSEIRHAFSKNGGNLGSTGSVLHMFSKKGVIAVEKGAATEEQLMDIVLEHGGEDLNDEGEAWEIITDPGSYEAVLSAVKAAGITPAMNEVTMVASTYTKLEGPAAGQMVRLLEALEDFDDAQNVYSNFDMSSEQIEQVAG

Samples

Sample ID Description Type Environment
1 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
8 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
9 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
10 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
11 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
12 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
13 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
14 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
15 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
16 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
17 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
18 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
19 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
20 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
21 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
22 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
23 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
24 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
25 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
26 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
27 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
28 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
29 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
30 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
31 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
32 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
33 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
34 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
35 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
36 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
37 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
38 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
39 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
40 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
41 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
42 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
43 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
44 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
45 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
46 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
47 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
48 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
49 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
50 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
51 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
52 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
53 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
54 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
55 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
56 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
57 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
58 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
59 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
60 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
61 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
62 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
63 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
64 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
65 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
66 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
67 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
68 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
69 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
70 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
71 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
72 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
73 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
74 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
75 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
101 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
105 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
106 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
107 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
108 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
109 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
110 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
111 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
112 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
113 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
114 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
115 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
116 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
117 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
118 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
119 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
120 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
121 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
122 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
123 3300033527 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
124 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
125 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
126 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
127 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
128 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
129 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
130 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
131 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
132 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
133 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
134 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
135 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
136 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
137 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
138 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
139 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
140 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
141 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
142 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
143 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
144 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
145 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
146 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
147 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
148 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
149 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
150 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
151 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
152 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
153 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
154 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
155 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
156 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
157 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
158 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
159 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
160 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
161 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
162 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
163 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
164 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
165 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
166 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
167 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
168 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
169 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
170 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
171 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
172 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
173 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
174 3300059627 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 154R_AW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.25
Metatranscriptomes 1.75
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.02
Nodule 0
Rhizoplane 2.63
Rhizosphere 87.43
Stem 0
Stem Tuber 0
Unclassified 0.88

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0265328_10013004 3300031239 Bacteria 3301
2 Ga0070658_10010324 3300005327 Bacteria 7494
3 Ga0070658_10063753 3300005327 Bacteria 3005
4 Ga0070658_10131051 3300005327 Bacteria 2090
5 Ga0070683_100000994 3300005329 Bacteria 21229
6 Ga0070683_100051091 3300005329 Bacteria 3828
7 Ga0070683_100593550 3300005329 Bacteria 1060
8 Ga0070670_100000026 3300005331 Bacteria 187946
9 Ga0070670_100029477 3300005331 Bacteria 4725
10 Ga0068869_100000280 3300005334 Bacteria 27001
11 Ga0068868_100000456 3300005338 Bacteria 27203
12 Ga0070661_100026960 3300005344 Bacteria 4136
13 Ga0070671_100011018 3300005355 Bacteria 7256
14 Ga0070667_100000267 3300005367 Bacteria 59181
15 Ga0070711_100122284 3300005439 Bacteria 1927
16 Ga0070705_100328220 3300005440 Bacteria 1107
17 Ga0070705_100399352 3300005440 Bacteria 1017
18 Ga0070694_100416579 3300005444 Bacteria 1055
19 Ga0070706_100043881 3300005467 Bacteria 4130
20 Ga0070707_100191920 3300005468 Bacteria 1992
21 Ga0070698_100014541 3300005471 Bacteria 8308
22 Ga0070698_100074576 3300005471 Bacteria 3398
23 Ga0070699_100100023 3300005518 Bacteria 2541
24 Ga0070684_100000828 3300005535 Bacteria 21671
25 Ga0070684_100025806 3300005535 Bacteria 4942
26 Ga0070684_100081604 3300005535 Bacteria 2862
27 Ga0070697_100000503 3300005536 Bacteria 29653
28 Ga0068853_100001512 3300005539 Bacteria 16909
29 Ga0070665_100010978 3300005548 Bacteria 9159
30 Ga0070665_100332817 3300005548 Bacteria 1523
31 Ga0070704_100284481 3300005549 Bacteria 1371
32 Ga0070704_100400040 3300005549 Bacteria 1172
33 Ga0068855_100001189 3300005563 Bacteria 32372
34 Ga0068855_100009239 3300005563 Bacteria 11909
35 Ga0068855_100010859 3300005563 Bacteria 10994
36 Ga0068855_100062444 3300005563 Bacteria 4349
37 Ga0070664_100185713 3300005564 Bacteria 1850
38 Ga0068857_100003005 3300005577 Bacteria 13920
39 Ga0068857_100028739 3300005577 Bacteria 4906
40 Ga0068857_100113344 3300005577 Bacteria 2438
41 Ga0068854_100062915 3300005578 Bacteria 2692
42 Ga0068854_100132625 3300005578 Bacteria 1904
43 Ga0068856_100000382 3300005614 Bacteria 48530
44 Ga0068856_100000998 3300005614 Bacteria 30124
45 Ga0068856_100003879 3300005614 Bacteria 15001
46 Ga0068852_100000003 3300005616 Bacteria 246525
47 Ga0068852_100000084 3300005616 Bacteria 65580
48 Ga0068852_100016180 3300005616 Bacteria 5808
49 Ga0068852_100020674 3300005616 Bacteria 5236
50 Ga0068852_100251342 3300005616 Bacteria 1694
51 Ga0068859_100004979 3300005617 Bacteria 13491
52 Ga0068859_100152690 3300005617 Bacteria 2385
53 Ga0068864_100001628 3300005618 Bacteria 18511
54 Ga0068851_10007769 3300005834 Bacteria 4933
55 Ga0068851_10161813 3300005834 Bacteria 1230
56 Ga0068870_10154076 3300005840 Bacteria 1356
57 Ga0068863_100001639 3300005841 Bacteria 22152
58 Ga0068860_100002298 3300005843 Bacteria 20098
59 Ga0068862_100021340 3300005844 Bacteria 5411
60 Ga0070717_10002667 3300006028 Bacteria 12561
61 Ga0075365_10008993 3300006038 Bacteria 5711
62 Ga0075368_10028182 3300006042 Bacteria 2169
63 Ga0075363_100003129 3300006048 Bacteria 6953
64 Ga0075364_10001867 3300006051 Bacteria 11691
65 Ga0075364_10097755 3300006051 Bacteria 1953
66 Ga0075367_10012134 3300006178 Bacteria 4583
67 Ga0075367_10081611 3300006178 Bacteria 1957
68 Ga0075369_10000060 3300006186 Bacteria 28160
69 Ga0075427_10001283 3300006194 Bacteria 3212
70 Ga0097621_100000599 3300006237 Bacteria 25435
71 Ga0097621_100057423 3300006237 Bacteria 3183
72 Ga0075370_10001575 3300006353 Bacteria 10031
73 Ga0068871_100000192 3300006358 Bacteria 41912
74 Ga0068871_100013452 3300006358 Bacteria 6075
75 Ga0075429_100077116 3300006880 Bacteria 2903
76 Ga0097620_100004979 3300006931 Bacteria 13491
77 Ga0097620_100152690 3300006931 Bacteria 2385
78 Ga0105240_10000249 3300009093 Bacteria 107168
79 Ga0105240_10002530 3300009093 Bacteria 29340
80 Ga0105240_10020332 3300009093 Bacteria 8859
81 Ga0105240_10020792 3300009093 Bacteria 8743
82 Ga0105240_10026116 3300009093 Bacteria 7666
83 Ga0105245_10000479 3300009098 Bacteria 36663
84 Ga0105245_10031432 3300009098 Bacteria 4698
85 Ga0105247_10000430 3300009101 Bacteria 35677
86 Ga0105241_10000036 3300009174 Bacteria 115495
87 Ga0105241_10000418 3300009174 Bacteria 32065
88 Ga0105241_10004911 3300009174 Bacteria 9857
89 Ga0105241_10007743 3300009174 Bacteria 7896
90 Ga0105241_10017443 3300009174 Bacteria 5278
91 Ga0105241_10515628 3300009174 Bacteria 1068
92 Ga0105248_10004310 3300009177 Bacteria 15743
93 Ga0105248_10011517 3300009177 Bacteria 9746
94 Ga0105237_10004433 3300009545 Bacteria 16266
95 Ga0105237_10004662 3300009545 Bacteria 15791
96 Ga0105237_10021980 3300009545 Bacteria 6549
97 Ga0105237_10115803 3300009545 Bacteria 2674
98 Ga0105238_10000088 3300009551 Bacteria 103463
99 Ga0105238_10001159 3300009551 Bacteria 26581
100 Ga0105238_10002248 3300009551 Bacteria 19492
101 Ga0105238_10002452 3300009551 Bacteria 18596
102 Ga0105238_10009057 3300009551 Bacteria 9960
103 Ga0105249_10092844 3300009553 Bacteria 2826
104 Ga0105239_10000527 3300010375 Bacteria 55271
105 Ga0105239_10004035 3300010375 Bacteria 17759
106 Ga0105239_10024482 3300010375 Bacteria 6651
107 Ga0105239_10041398 3300010375 Bacteria 5050
108 Ga0105239_11391291 3300010375 Bacteria 810
109 Ga0105246_10000211 3300011119 Bacteria 29505
110 Ga0105246_10042018 3300011119 Bacteria 3094
111 Ga0157373_10078685 3300013100 Bacteria 2325
112 Ga0157373_10117689 3300013100 Bacteria 1868
113 Ga0157370_10000001 3300013104 Bacteria 529517
114 Ga0157370_10002795 3300013104 Bacteria 20852
115 Ga0157369_10000073 3300013105 Bacteria 139083
116 Ga0157369_10002613 3300013105 Bacteria 21537
117 Ga0157369_10003585 3300013105 Bacteria 18439
118 Ga0157369_10006727 3300013105 Bacteria 13267
119 Ga0157369_10016271 3300013105 Bacteria 8373
120 Ga0157369_10019425 3300013105 Bacteria 7601
121 Ga0157369_10165542 3300013105 Bacteria 2332
122 Ga0157374_10001020 3300013296 Bacteria 24310
123 Ga0157374_10013994 3300013296 Bacteria 7012
124 Ga0157374_10014440 3300013296 Bacteria 6911
125 Ga0157374_10802601 3300013296 Bacteria 957
126 Ga0157378_10000703 3300013297 Bacteria 31330
127 Ga0157378_10024581 3300013297 Bacteria 5303
128 Ga0157378_10026534 3300013297 Bacteria 5106
129 Ga0163162_10098130 3300013306 Bacteria 3019
130 Ga0163162_11322526 3300013306 Bacteria 819
131 Ga0157372_10000045 3300013307 Bacteria 151277
132 Ga0157372_10002442 3300013307 Bacteria 20134
133 Ga0157372_10042301 3300013307 Bacteria 5039
134 Ga0157372_10085357 3300013307 Bacteria 3580
135 Ga0157372_10137460 3300013307 Bacteria 2815
136 Ga0157372_10263037 3300013307 Bacteria 2003
137 Ga0157372_10367173 3300013307 Bacteria 1677
138 Ga0157372_10609463 3300013307 Bacteria 1272
139 Ga0157375_10001690 3300013308 Bacteria 18953
140 Ga0157375_10826595 3300013308 Bacteria 1074
141 Ga0163163_10000623 3300014325 Bacteria 30472
142 Ga0163163_10048791 3300014325 Bacteria 4164
143 Ga0157379_10001064 3300014968 Bacteria 22373
144 Ga0157379_10111458 3300014968 Bacteria 2457
145 Ga0157376_10000688 3300014969 Bacteria 21883
146 Ga0157376_10182966 3300014969 Bacteria 1917
147 Ga0182006_1011380 3300015261 Bacteria 3917
148 Ga0206355_1431890 3300020076 Bacteria 1137
149 Ga0206352_10386266 3300020078 Bacteria 918
150 Ga0206350_10697643 3300020080 Bacteria 961
151 Ga0213876_10109716 3300021384 Bacteria 1464
152 Ga0224712_10218689 3300022467 Bacteria 871
153 Ga0207710_10000630 3300025900 Bacteria 20290
154 Ga0207654_10000028 3300025911 Bacteria 125787
155 Ga0207654_10000052 3300025911 Bacteria 84058
156 Ga0207654_10001965 3300025911 Bacteria 10649
157 Ga0207695_10000026 3300025913 Bacteria 624558
158 Ga0207695_10000063 3300025913 Bacteria 349527
159 Ga0207695_10000144 3300025913 Bacteria 211125
160 Ga0207695_10000538 3300025913 Bacteria 79042
161 Ga0207695_10134128 3300025913 Bacteria 2431
162 Ga0207695_10252403 3300025913 Bacteria 1663
163 Ga0207671_10000218 3300025914 Bacteria 85931
164 Ga0207671_10000430 3300025914 Bacteria 57899
165 Ga0207671_10167170 3300025914 Bacteria 1706
166 Ga0207649_10477242 3300025920 Bacteria 945
167 Ga0207681_10157502 3300025923 Bacteria 1708
168 Ga0207694_10000028 3300025924 Bacteria 242395
169 Ga0207694_10000513 3300025924 Bacteria 35098
170 Ga0207694_10015662 3300025924 Bacteria 5718
171 Ga0207694_10020088 3300025924 Bacteria 5052
172 Ga0207650_10001205 3300025925 Bacteria 18979
173 Ga0207687_10019703 3300025927 Bacteria 4472
174 Ga0207687_10347881 3300025927 Bacteria 1207
175 Ga0207644_10013034 3300025931 Bacteria 5533
176 Ga0207644_10041690 3300025931 Bacteria 3249
177 Ga0207711_10005030 3300025941 Bacteria 11216
178 Ga0207711_10017614 3300025941 Bacteria 5933
179 Ga0207689_10007655 3300025942 Bacteria 9460
180 Ga0207689_10057707 3300025942 Bacteria 3193
181 Ga0207689_10065328 3300025942 Bacteria 2993
182 Ga0207661_10012563 3300025944 Bacteria 6158
183 Ga0207661_10174106 3300025944 Bacteria 1875
184 Ga0207661_10448128 3300025944 Bacteria 1175
185 Ga0207679_10052021 3300025945 Bacteria 3002
186 Ga0207667_10001435 3300025949 Bacteria 29868
187 Ga0207667_10019590 3300025949 Bacteria 7547
188 Ga0207667_10025419 3300025949 Bacteria 6480
189 Ga0207667_10053446 3300025949 Bacteria 4250
190 Ga0207667_10091169 3300025949 Bacteria 3149
191 Ga0207667_10200549 3300025949 Bacteria 2047
192 Ga0207712_10094028 3300025961 Bacteria 2213
193 Ga0207640_10049692 3300025981 Bacteria 2717
194 Ga0207640_10215057 3300025981 Bacteria 1467
195 Ga0207658_10000163 3300025986 Bacteria 70810
196 Ga0207677_10000076 3300026023 Bacteria 81764
197 Ga0207677_10270928 3300026023 Bacteria 1389
198 Ga0207639_10000043 3300026041 Bacteria 140295
199 Ga0207639_10026905 3300026041 Bacteria 4183
200 Ga0207639_10088734 3300026041 Bacteria 2469
201 Ga0207639_10343001 3300026041 Bacteria 1332
202 Ga0207702_10002445 3300026078 Bacteria 17595
203 Ga0207702_10004254 3300026078 Bacteria 12777
204 Ga0207702_10093433 3300026078 Bacteria 2638
205 Ga0207702_10139973 3300026078 Bacteria 2188
206 Ga0207641_10000938 3300026088 Bacteria 30095
207 Ga0207676_10001613 3300026095 Bacteria 16605
208 Ga0207674_10004344 3300026116 Bacteria 17090
209 Ga0207674_10004802 3300026116 Bacteria 16181
210 Ga0207674_10126408 3300026116 Bacteria 2522
211 Ga0207698_10000046 3300026142 Bacteria 93146
212 Ga0207698_10000068 3300026142 Bacteria 69581
213 Ga0207698_10000787 3300026142 Bacteria 18478
214 Ga0207698_10010658 3300026142 Bacteria 5925
215 Ga0207698_10058041 3300026142 Bacteria 2997
216 Ga0207698_10260047 3300026142 Bacteria 1594
217 Ga0209813_10022706 3300027866 Bacteria 1777
218 Ga0268266_10024259 3300028379 Bacteria 5161
219 Ga0268265_10013594 3300028380 Bacteria 5535
220 Ga0268264_10007319 3300028381 Bacteria 9229
221 Ga0265338_10010196 3300028800 Bacteria 11075
222 Ga0265338_10011697 3300028800 Bacteria 10105
223 Ga0265338_10238225 3300028800 Bacteria 1349
224 Ga0265330_10000667 3300031235 Bacteria 22010
225 Ga0265332_10008593 3300031238 Bacteria 4587
226 Ga0265320_10061289 3300031240 Bacteria 1794
227 Ga0265325_10000430 3300031241 Bacteria 30088
228 Ga0265325_10045149 3300031241 Bacteria 2291
229 Ga0265325_10108266 3300031241 Bacteria 1353
230 Ga0265340_10014356 3300031247 Bacteria 4140
231 Ga0265339_10000041 3300031249 Bacteria 119820
232 Ga0265339_10009780 3300031249 Bacteria 5993
233 Ga0265331_10036141 3300031250 Bacteria 2427
234 Ga0265331_10094068 3300031250 Bacteria 1384
235 Ga0265331_10184067 3300031250 Bacteria 943
236 Ga0265327_10000096 3300031251 Bacteria 193827
237 Ga0265316_10036916 3300031344 Bacteria 3950
238 Ga0265316_10045715 3300031344 Bacteria 3474
239 Ga0265316_10081704 3300031344 Bacteria 2477
240 Ga0265316_10082441 3300031344 Bacteria 2464
241 Ga0265316_10174066 3300031344 Unclassified 1605
242 Ga0265316_10381006 3300031344 Bacteria 1018
243 Ga0265313_10016780 3300031595 Bacteria 4198
244 Ga0265313_10069736 3300031595 Unclassified 1622
245 Ga0316575_10051246 3300031665 Bacteria 1644
246 Ga0316575_10092038 3300031665 Bacteria 1229
247 Ga0265314_10023884 3300031711 Bacteria 4648
248 Ga0265342_10000320 3300031712 Bacteria 54525
249 Ga0265342_10005792 3300031712 Bacteria 9330
250 Ga0265342_10015604 3300031712 Bacteria 4993
251 Ga0265342_10016802 3300031712 Bacteria 4771
252 Ga0265342_10025348 3300031712 Bacteria 3730
253 Ga0316576_10001570 3300031727 Bacteria 12412
254 Ga0316576_10013609 3300031727 Bacteria 5414
255 Ga0316578_10036602 3300031728 Bacteria 2825
256 Ga0316578_10115704 3300031728 Bacteria 1611
257 Ga0316578_10152816 3300031728 Bacteria 1391
258 Ga0316578_10311040 3300031728 Bacteria 941
259 Ga0316583_10006267 3300032133 Bacteria 4275
260 Ga0316585_10068023 3300032137 Bacteria 1155
261 Ga0316580_10064779 3300032139 Bacteria 1121
262 Ga0316586_1027734 3300033527 Bacteria 960
263 Ga0373957_0007145 3300035120 Bacteria 3560
264 Ga0316574_0000731 3300035398 Bacteria 14070
265 Ga0316574_0005170 3300035398 Bacteria 6940
266 Ga0316574_0024797 3300035398 Bacteria 3593
267 Ga0316574_0031800 3300035398 Bacteria 3203
268 Ga0316574_0037884 3300035398 Bacteria 2959
269 Ga0316574_0065692 3300035398 Bacteria 2284
270 Ga0316574_0076991 3300035398 Bacteria 2114
271 Ga0316574_0082130 3300035398 Bacteria 2047
272 Ga0316574_0195071 3300035398 Bacteria 1302
273 Ga0316574_0394259 3300035398 Bacteria 872
274 Ga0373927_0040665 3300035695 Bacteria 3016
275 Ga0373933_0089841 3300035724 Bacteria 1894
276 Ga0373937_0016595 3300036401 Bacteria 6542
277 Ga0373937_0215804 3300036401 Bacteria 1806
278 Ga0316584_0012552 3300036712 Bacteria 5977
279 Ga0316584_0043557 3300036712 Bacteria 3347
280 Ga0316584_0071759 3300036712 Bacteria 2595
281 Ga0316584_0317287 3300036712 Bacteria 1125
282 Ga0400484_16107 3300038725 Bacteria 2848
283 Ga0400484_32136 3300038725 Bacteria 10445
284 Ga0400490_15531 3300038726 Bacteria 1724
285 Ga0400486_15513 3300038742 Bacteria 89826
286 Ga0400483_049174 3300039062 Bacteria 2566
287 Ga0400483_154948 3300039062 Bacteria 2441
288 Ga0400483_267133 3300039062 Unclassified 4455
289 Ga0436365_0495152 3300039437 Bacteria 15432
290 Ga0451577_0000268 3300042876 Bacteria 101870
291 Ga0451577_0010469 3300042876 Bacteria 8861
292 Ga0451577_0029373 3300042876 Bacteria 4968
293 Ga0453683_0001991 3300044673 Bacteria 16545
294 Ga0466966_0121381 3300044684 Bacteria 1605
295 Ga0466961_0093965 3300044693 Bacteria 1892
296 Ga0466963_0024402 3300044694 Bacteria 3850
297 Ga0453684_0000021 3300044712 Bacteria 873490
298 Ga0453684_0000061 3300044712 Bacteria 489946
299 Ga0453684_0000358 3300044712 Bacteria 188931
300 Ga0453684_0010044 3300044712 Bacteria 16286
301 Ga0453684_0028617 3300044712 Bacteria 7944
302 Ga0453684_0032064 3300044712 Bacteria 7366
303 Ga0453684_0111282 3300044712 Bacteria 3327
304 Ga0451576_0001117 3300045051 Bacteria 48751
305 Ga0451576_0007649 3300045051 Bacteria 12845
306 Ga0466958_0362484 3300045836 Bacteria 934
307 Ga0466967_0016422 3300045976 Bacteria 5838
308 Ga0495580_0365963 3300046472 Bacteria 975
309 Ga0495582_0215878 3300046473 Bacteria 1097
310 Ga0495663_0000491 3300046525 Bacteria 14284
311 Ga0495652_0379276 3300046529 Bacteria 1006
312 Ga0495621_0000013 3300046539 Bacteria 38261
313 Ga0495600_0122450 3300046809 Bacteria 1692
314 Ga0495636_0071337 3300047318 Bacteria 1483
315 Ga0495684_0262998 3300047471 Bacteria 1251
316 Ga0495602_0064196 3300048088 Bacteria 3177
317 Ga0496100_0033215 3300048903 Bacteria 3227
318 Ga0496102_0304245 3300048905 Bacteria 1503
319 Ga0496105_0102209 3300048908 Bacteria 2367
320 Ga0496106_0088668 3300048909 Bacteria 2385
321 Ga0496107_0248723 3300048910 Bacteria 1323
322 Ga0496110_0739947 3300048913 Bacteria 886
323 Ga0496114_0029368 3300048917 Bacteria 4518
324 Ga0496115_0025187 3300048918 Bacteria 4630
325 Ga0496115_0415878 3300048918 Bacteria 1089
326 Ga0496124_0204576 3300048927 Bacteria 1498
327 nmdc:mga03n38_52841_c1 3300050490 Bacteria 1820
328 nmdc:mga03n38_910_c1 3300050490 Bacteria 7964
329 nmdc:mga00v17_146_c1 3300050491 Bacteria 40788
330 nmdc:mga00v17_8794_c1 3300050491 Bacteria 5441
331 nmdc:mga0yw44_57_c1 3300050492 Bacteria 40136
332 nmdc:mga0k408_113089_c1 3300050493 Bacteria 1605
333 nmdc:mga06z11_10898_c1 3300050494 Bacteria 3895
334 nmdc:mga06z11_17438_c1 3300050494 Bacteria 3259
335 nmdc:mga04h51_2958_c2 3300050495 Bacteria 2206
336 nmdc:mga07m45_66_c1 3300050496 Bacteria 40757
337 nmdc:mga09592_22021_c1 3300050508 Bacteria 5258
338 nmdc:mga0sz30_118_c1 3300050516 Bacteria 29758
339 Ga0500650_0000082 3300053098 Bacteria 27565
340 Ga0500595_040396 3300053119 Bacteria 1505
341 Ga0500661_019978 3300055283 Bacteria 1191
342 Ga0587117_028566 3300059627 Bacteria 827
343 Ga0265328_10013004
344 Ga0070658_10010324
345 Ga0070658_10063753
346 Ga0070658_10131051
347 Ga0070683_100000994
348 Ga0070683_100051091
349 Ga0070683_100593550
350 Ga0070670_100000026
351 Ga0070670_100029477
352 Ga0068869_100000280
353 Ga0068868_100000456
354 Ga0070661_100026960
355 Ga0070671_100011018
356 Ga0070667_100000267
357 Ga0070711_100122284
358 Ga0070705_100328220
359 Ga0070705_100399352
360 Ga0070694_100416579
361 Ga0070706_100043881
362 Ga0070707_100191920
363 Ga0070698_100014541
364 Ga0070698_100074576
365 Ga0070699_100100023
366 Ga0070684_100000828
367 Ga0070684_100025806
368 Ga0070684_100081604
369 Ga0070697_100000503
370 Ga0068853_100001512
371 Ga0070665_100010978
372 Ga0070665_100332817
373 Ga0070704_100284481
374 Ga0070704_100400040
375 Ga0068855_100001189
376 Ga0068855_100009239
377 Ga0068855_100010859
378 Ga0068855_100062444
379 Ga0070664_100185713
380 Ga0068857_100003005
381 Ga0068857_100028739
382 Ga0068857_100113344
383 Ga0068854_100062915
384 Ga0068854_100132625
385 Ga0068856_100000382
386 Ga0068856_100000998
387 Ga0068856_100003879
388 Ga0068852_100000003
389 Ga0068852_100000084
390 Ga0068852_100016180
391 Ga0068852_100020674
392 Ga0068852_100251342
393 Ga0068859_100004979
394 Ga0068859_100152690
395 Ga0068864_100001628
396 Ga0068851_10007769
397 Ga0068851_10161813
398 Ga0068870_10154076
399 Ga0068863_100001639
400 Ga0068860_100002298
401 Ga0068862_100021340
402 Ga0070717_10002667
403 Ga0075365_10008993
404 Ga0075368_10028182
405 Ga0075363_100003129
406 Ga0075364_10001867
407 Ga0075364_10097755
408 Ga0075367_10012134
409 Ga0075367_10081611
410 Ga0075369_10000060
411 Ga0075427_10001283
412 Ga0097621_100000599
413 Ga0097621_100057423
414 Ga0075370_10001575
415 Ga0068871_100000192
416 Ga0068871_100013452
417 Ga0075429_100077116
418 Ga0097620_100004979
419 Ga0097620_100152690
420 Ga0105240_10000249
421 Ga0105240_10002530
422 Ga0105240_10020332
423 Ga0105240_10020792
424 Ga0105240_10026116
425 Ga0105245_10000479
426 Ga0105245_10031432
427 Ga0105247_10000430
428 Ga0105241_10000036
429 Ga0105241_10000418
430 Ga0105241_10004911
431 Ga0105241_10007743
432 Ga0105241_10017443
433 Ga0105241_10515628
434 Ga0105248_10004310
435 Ga0105248_10011517
436 Ga0105237_10004433
437 Ga0105237_10004662
438 Ga0105237_10021980
439 Ga0105237_10115803
440 Ga0105238_10000088
441 Ga0105238_10001159
442 Ga0105238_10002248
443 Ga0105238_10002452
444 Ga0105238_10009057
445 Ga0105249_10092844
446 Ga0105239_10000527
447 Ga0105239_10004035
448 Ga0105239_10024482
449 Ga0105239_10041398
450 Ga0105239_11391291
451 Ga0105246_10000211
452 Ga0105246_10042018
453 Ga0157373_10078685
454 Ga0157373_10117689
455 Ga0157370_10000001
456 Ga0157370_10002795
457 Ga0157369_10000073
458 Ga0157369_10002613
459 Ga0157369_10003585
460 Ga0157369_10006727
461 Ga0157369_10016271
462 Ga0157369_10019425
463 Ga0157369_10165542
464 Ga0157374_10001020
465 Ga0157374_10013994
466 Ga0157374_10014440
467 Ga0157374_10802601
468 Ga0157378_10000703
469 Ga0157378_10024581
470 Ga0157378_10026534
471 Ga0163162_10098130
472 Ga0163162_11322526
473 Ga0157372_10000045
474 Ga0157372_10002442
475 Ga0157372_10042301
476 Ga0157372_10085357
477 Ga0157372_10137460
478 Ga0157372_10263037
479 Ga0157372_10367173
480 Ga0157372_10609463
481 Ga0157375_10001690
482 Ga0157375_10826595
483 Ga0163163_10000623
484 Ga0163163_10048791
485 Ga0157379_10001064
486 Ga0157379_10111458
487 Ga0157376_10000688
488 Ga0157376_10182966
489 Ga0182006_1011380
490 Ga0206355_1431890
491 Ga0206352_10386266
492 Ga0206350_10697643
493 Ga0213876_10109716
494 Ga0224712_10218689
495 Ga0207710_10000630
496 Ga0207654_10000028
497 Ga0207654_10000052
498 Ga0207654_10001965
499 Ga0207695_10000026
500 Ga0207695_10000063
501 Ga0207695_10000144
502 Ga0207695_10000538
503 Ga0207695_10134128
504 Ga0207695_10252403
505 Ga0207671_10000218
506 Ga0207671_10000430
507 Ga0207671_10167170
508 Ga0207649_10477242
509 Ga0207681_10157502
510 Ga0207694_10000028
511 Ga0207694_10000513
512 Ga0207694_10015662
513 Ga0207694_10020088
514 Ga0207650_10001205
515 Ga0207687_10019703
516 Ga0207687_10347881
517 Ga0207644_10013034
518 Ga0207644_10041690
519 Ga0207711_10005030
520 Ga0207711_10017614
521 Ga0207689_10007655
522 Ga0207689_10057707
523 Ga0207689_10065328
524 Ga0207661_10012563
525 Ga0207661_10174106
526 Ga0207661_10448128
527 Ga0207679_10052021
528 Ga0207667_10001435
529 Ga0207667_10019590
530 Ga0207667_10025419
531 Ga0207667_10053446
532 Ga0207667_10091169
533 Ga0207667_10200549
534 Ga0207712_10094028
535 Ga0207640_10049692
536 Ga0207640_10215057
537 Ga0207658_10000163
538 Ga0207677_10000076
539 Ga0207677_10270928
540 Ga0207639_10000043
541 Ga0207639_10026905
542 Ga0207639_10088734
543 Ga0207639_10343001
544 Ga0207702_10002445
545 Ga0207702_10004254
546 Ga0207702_10093433
547 Ga0207702_10139973
548 Ga0207641_10000938
549 Ga0207676_10001613
550 Ga0207674_10004344
551 Ga0207674_10004802
552 Ga0207674_10126408
553 Ga0207698_10000046
554 Ga0207698_10000068
555 Ga0207698_10000787
556 Ga0207698_10010658
557 Ga0207698_10058041
558 Ga0207698_10260047
559 Ga0209813_10022706
560 Ga0268266_10024259
561 Ga0268265_10013594
562 Ga0268264_10007319
563 Ga0265338_10010196
564 Ga0265338_10011697
565 Ga0265338_10238225
566 Ga0265330_10000667
567 Ga0265332_10008593
568 Ga0265320_10061289
569 Ga0265325_10000430
570 Ga0265325_10045149
571 Ga0265325_10108266
572 Ga0265340_10014356
573 Ga0265339_10000041
574 Ga0265339_10009780
575 Ga0265331_10036141
576 Ga0265331_10094068
577 Ga0265331_10184067
578 Ga0265327_10000096
579 Ga0265316_10036916
580 Ga0265316_10045715
581 Ga0265316_10081704
582 Ga0265316_10082441
583 Ga0265316_10174066
584 Ga0265316_10381006
585 Ga0265313_10016780
586 Ga0265313_10069736
587 Ga0316575_10051246
588 Ga0316575_10092038
589 Ga0265314_10023884
590 Ga0265342_10000320
591 Ga0265342_10005792
592 Ga0265342_10015604
593 Ga0265342_10016802
594 Ga0265342_10025348
595 Ga0316576_10001570
596 Ga0316576_10013609
597 Ga0316578_10036602
598 Ga0316578_10115704
599 Ga0316578_10152816
600 Ga0316578_10311040
601 Ga0316583_10006267
602 Ga0316585_10068023
603 Ga0316580_10064779
604 Ga0316586_1027734
605 Ga0373957_0007145
606 Ga0316574_0000731
607 Ga0316574_0005170
608 Ga0316574_0024797
609 Ga0316574_0031800
610 Ga0316574_0037884
611 Ga0316574_0065692
612 Ga0316574_0076991
613 Ga0316574_0082130
614 Ga0316574_0195071
615 Ga0316574_0394259
616 Ga0373927_0040665
617 Ga0373933_0089841
618 Ga0373937_0016595
619 Ga0373937_0215804
620 Ga0316584_0012552
621 Ga0316584_0043557
622 Ga0316584_0071759
623 Ga0316584_0317287
624 Ga0400484_16107
625 Ga0400484_32136
626 Ga0400490_15531
627 Ga0400486_15513
628 Ga0400483_049174
629 Ga0400483_154948
630 Ga0400483_267133
631 Ga0436365_0495152
632 Ga0451577_0000268
633 Ga0451577_0010469
634 Ga0451577_0029373
635 Ga0453683_0001991
636 Ga0466966_0121381
637 Ga0466961_0093965
638 Ga0466963_0024402
639 Ga0453684_0000021
640 Ga0453684_0000061
641 Ga0453684_0000358
642 Ga0453684_0010044
643 Ga0453684_0028617
644 Ga0453684_0032064
645 Ga0453684_0111282
646 Ga0451576_0001117
647 Ga0451576_0007649
648 Ga0466958_0362484
649 Ga0466967_0016422
650 Ga0495580_0365963
651 Ga0495582_0215878
652 Ga0495663_0000491
653 Ga0495652_0379276
654 Ga0495621_0000013
655 Ga0495600_0122450
656 Ga0495636_0071337
657 Ga0495684_0262998
658 Ga0495602_0064196
659 Ga0496100_0033215
660 Ga0496102_0304245
661 Ga0496105_0102209
662 Ga0496106_0088668
663 Ga0496107_0248723
664 Ga0496110_0739947
665 Ga0496114_0029368
666 Ga0496115_0025187
667 Ga0496115_0415878
668 Ga0496124_0204576
669 nmdc:mga03n38_52841_c1
670 nmdc:mga03n38_910_c1
671 nmdc:mga00v17_146_c1
672 nmdc:mga00v17_8794_c1
673 nmdc:mga0yw44_57_c1
674 nmdc:mga0k408_113089_c1
675 nmdc:mga06z11_10898_c1
676 nmdc:mga06z11_17438_c1
677 nmdc:mga04h51_2958_c2
678 nmdc:mga07m45_66_c1
679 nmdc:mga09592_22021_c1
680 nmdc:mga0sz30_118_c1
681 Ga0500650_0000082
682 Ga0500595_040396
683 Ga0500661_019978
684 Ga0587117_028566

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01709

Transcrip_reg

TACO1/YebC second and third domain

115

270

0.98

PF20772

TACO1_YebC_N

TACO1/YebC protein N-terminal domain

39

109

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
4go7-assembly1.cif.gz_X-2 the regulatory subunit of aspartate kinase in complex with threonine from mycobacterium tuberculosis 0.7202 134 199
6u2d-assembly2.cif.gz_C pmtcd peptide exporter basket domain 0.7169 137 200
6u2d-assembly2.cif.gz_C pmtcd peptide exporter basket domain 0.7002 137 200
2nxn-assembly1.cif.gz_A t. thermophilus ribosomal protein l11 methyltransferase (prma) in complex with ribosomal protein l11 0.6999 138 177
1jqg-assembly1.cif.gz_A crystal structure of the carboxypeptidase a from helicoverpa armigera 0.6963 137 199
ID Description Score Start End Superfamily
1mw7A01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Integrase, N-terminal zinc-binding domain 0.9899 24 74 1.10.10.200
1lfpA02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;YebC, transcriptional regulation domain 0.9696 83 241 3.30.70.980
1lfpA01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Integrase, N-terminal zinc-binding domain 0.9267 19 79 1.10.10.200
1mw7A03 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;YebC, transcriptional regulation domain 0.9138 136 203 3.30.70.980
4f3qA03 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;YebC, transcriptional regulation domain 0.9095 130 205 3.30.70.980
ID Description Score Start End GO Terms
AF-A0A1F4Q977-F1-model_v4 TACO1/YebC-like second and third domain-containing protein 0.9819 81 249 GO:0005829
AF-A0A3C0AG11-F1-model_v4 YebC/PmpR family DNA-binding transcriptional regulator 0.9731 77 247 GO:0003677
GO:0005829
AF-A0A3M1HJ34-F1-model_v4 YebC/PmpR family DNA-binding transcriptional regulator 0.971 107 249 GO:0003677
GO:0005829
AF-A0A1F4Q977-F1-model_v4 TACO1/YebC-like second and third domain-containing protein 0.9706 81 249 GO:0005829
AF-X0UMV9-F1-model_v4 TACO1/YebC-like second and third domain-containing protein 0.9702 88 248 GO:0005829

Map