F415196

General Info

Members Datasets Scaffolds Average Seq Length
342 134 684 502

Family's Representative Sequence

Representative Sequence 3300026041|Ga0207639_10064639|Ga0207639_100646392
Length 503
Sequence MKYVLYAFLAGAVSAFAFEPVGFWPLMLIAIALLCEWVDRTQSLGRALLIGWAFGLGQFVVGLNWIATSFTYQSNMPAWLGWIAVVLLSLYLAIYPALAVGIGWRLGRDDRVVLVTVLGGAWAITEWLRGSMFTGFPWNPIAAVMAPTPLITITPLIGTYGLSGLVVLLGGAIWLEYYKKWLPLVVILAVTALLWVLPSSPVPPDPLTIRNVRIVQPNIGQEDKWRPGFDEEAARRLAQLSGGPSDQPRLLLWPEAAVTDPLQDGRTGRKQAAEFQRSQAATLLGPGDLLLTGGIAIGSHDGFHVEGAANSIFVLAPGGRIVGRYDKAHLVPYGEYLPMRPLLSAIGLSRLAPGDIDFTPGPGPRTIDLGGEWGKVGFDLCYEIIFSGHVVDWENRPGFIFNPSNDAWFGSWGPPQHLAQARLRAAEEGLPILRATPTGISAVIDARGNVLNSLQWRKAGVIDAVLPPGANSPPPFARFGNVIPLLLGFLLIAGGIVLGRKRR

Samples

Sample ID Description Type Environment
1 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
2 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
21 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
22 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
23 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
24 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
25 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
26 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
27 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
28 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
29 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
30 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
31 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
32 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
33 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
34 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
35 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
36 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
37 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
38 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
39 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
40 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
41 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
42 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
43 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
44 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
45 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
46 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
48 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
49 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
51 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
52 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
53 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
54 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
55 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
56 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
57 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
58 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
59 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
60 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
61 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
62 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
63 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
100 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
101 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
102 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
103 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
104 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
105 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
106 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
107 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
108 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
109 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
110 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
111 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
112 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
113 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
114 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
115 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
116 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
117 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
118 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
119 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
120 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
121 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
122 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
123 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
124 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
125 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
126 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
127 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
128 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
129 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
130 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
131 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
132 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
133 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
134 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3.22
Rhizosphere 96.49
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207639_10064639 3300026041 Bacteria 2837
2 JGI24744J21845_10000764 3300002077 Bacteria 6009
3 Ga0070658_10013180 3300005327 Bacteria 6632
4 Ga0070658_10027077 3300005327 Bacteria 4602
5 Ga0070658_10071322 3300005327 Bacteria 2845
6 Ga0070658_10136310 3300005327 Bacteria 2048
7 Ga0070676_10065073 3300005328 Bacteria 2176
8 Ga0070683_100056120 3300005329 Bacteria 3657
9 Ga0070690_100002262 3300005330 Bacteria 10321
10 Ga0070670_100001163 3300005331 Bacteria 20894
11 Ga0070670_100002964 3300005331 Bacteria 14060
12 Ga0070670_100054928 3300005331 Bacteria 3419
13 Ga0070670_100175752 3300005331 Bacteria 1858
14 Ga0070677_10035943 3300005333 Bacteria 1923
15 Ga0070666_10000415 3300005335 Bacteria 26514
16 Ga0070666_10023503 3300005335 Bacteria 4013
17 Ga0070666_10038142 3300005335 Bacteria 3196
18 Ga0070680_100057207 3300005336 Bacteria 3188
19 Ga0070680_100064898 3300005336 Bacteria 2992
20 Ga0070680_100098034 3300005336 Bacteria 2431
21 Ga0068868_100000422 3300005338 Bacteria 28550
22 Ga0068868_100001497 3300005338 Bacteria 16125
23 Ga0070660_100007252 3300005339 Bacteria 7717
24 Ga0070660_100013537 3300005339 Bacteria 5854
25 Ga0070660_100014106 3300005339 Bacteria 5753
26 Ga0070660_100023818 3300005339 Bacteria 4538
27 Ga0070660_100052355 3300005339 Bacteria 3147
28 Ga0070661_100004015 3300005344 Bacteria 10115
29 Ga0070661_100021659 3300005344 Bacteria 4594
30 Ga0070661_100024601 3300005344 Bacteria 4319
31 Ga0070661_100063588 3300005344 Bacteria 2711
32 Ga0070661_100067628 3300005344 Bacteria 2625
33 Ga0070675_100016044 3300005354 Bacteria 5935
34 Ga0070675_100018671 3300005354 Bacteria 5520
35 Ga0070675_100045187 3300005354 Bacteria 3603
36 Ga0070671_100000793 3300005355 Bacteria 22759
37 Ga0070671_100000972 3300005355 Bacteria 20998
38 Ga0070671_100003799 3300005355 Bacteria 11849
39 Ga0070671_100004515 3300005355 Bacteria 11016
40 Ga0070671_100027398 3300005355 Bacteria 4691
41 Ga0070671_100097871 3300005355 Bacteria 2461
42 Ga0070674_100037339 3300005356 Bacteria 3267
43 Ga0070674_100110220 3300005356 Bacteria 2020
44 Ga0070673_100001888 3300005364 Bacteria 12565
45 Ga0070673_100002090 3300005364 Bacteria 12058
46 Ga0070659_100008541 3300005366 Bacteria 7484
47 Ga0070659_100014473 3300005366 Bacteria 5895
48 Ga0070659_100032416 3300005366 Bacteria 4052
49 Ga0070659_100078274 3300005366 Bacteria 2637
50 Ga0070659_100091454 3300005366 Bacteria 2439
51 Ga0070667_100000839 3300005367 Bacteria 28510
52 Ga0070667_100046858 3300005367 Bacteria 3637
53 Ga0070667_100147058 3300005367 Bacteria 2067
54 Ga0070714_100027365 3300005435 Bacteria 4721
55 Ga0070714_100049107 3300005435 Bacteria 3591
56 Ga0070713_100047407 3300005436 Bacteria 3531
57 Ga0070713_100111776 3300005436 Bacteria 2383
58 Ga0070663_100063817 3300005455 Bacteria 2661
59 Ga0070663_100090897 3300005455 Bacteria 2261
60 Ga0070678_100002943 3300005456 Bacteria 9437
61 Ga0070678_100004841 3300005456 Bacteria 7690
62 Ga0070678_100179113 3300005456 Bacteria 1733
63 Ga0070662_100008474 3300005457 Bacteria 6707
64 Ga0070662_100008891 3300005457 Bacteria 6548
65 Ga0070662_100022000 3300005457 Bacteria 4359
66 Ga0070681_10007172 3300005458 Bacteria 10857
67 Ga0070681_10114877 3300005458 Bacteria 2630
68 Ga0068867_100022263 3300005459 Bacteria 4530
69 Ga0068867_100138473 3300005459 Bacteria 1900
70 Ga0070679_100069792 3300005530 Bacteria 3505
71 Ga0070684_100005653 3300005535 Bacteria 9606
72 Ga0070684_100037770 3300005535 Bacteria 4145
73 Ga0068853_100004267 3300005539 Bacteria 11040
74 Ga0068853_100009256 3300005539 Bacteria 7940
75 Ga0068853_100042931 3300005539 Bacteria 3868
76 Ga0070672_100005547 3300005543 Bacteria 8380
77 Ga0070672_100089453 3300005543 Bacteria 2481
78 Ga0070672_100156959 3300005543 Bacteria 1885
79 Ga0070693_100105511 3300005547 Bacteria 1724
80 Ga0070665_100006465 3300005548 Bacteria 11928
81 Ga0070665_100015898 3300005548 Bacteria 7553
82 Ga0070665_100055144 3300005548 Bacteria 3986
83 Ga0068855_100032229 3300005563 Bacteria 6257
84 Ga0068855_100059294 3300005563 Bacteria 4478
85 Ga0070664_100030779 3300005564 Bacteria 4479
86 Ga0070664_100053340 3300005564 Bacteria 3427
87 Ga0070664_100055539 3300005564 Bacteria 3362
88 Ga0070664_100122650 3300005564 Bacteria 2277
89 Ga0068857_100002945 3300005577 Bacteria 14026
90 Ga0068857_100013108 3300005577 Bacteria 7224
91 Ga0068857_100129837 3300005577 Bacteria 2272
92 Ga0068854_100022349 3300005578 Bacteria 4307
93 Ga0068852_100019099 3300005616 Bacteria 5416
94 Ga0068852_100094783 3300005616 Bacteria 2679
95 Ga0068852_100162079 3300005616 Bacteria 2089
96 Ga0068859_100017890 3300005617 Bacteria 7125
97 Ga0068859_100237185 3300005617 Bacteria 1913
98 Ga0068864_100002647 3300005618 Bacteria 14784
99 Ga0068864_100033431 3300005618 Bacteria 4372
100 Ga0068864_100061483 3300005618 Bacteria 3253
101 Ga0068866_10006572 3300005718 Bacteria 4848
102 Ga0068861_100091162 3300005719 Bacteria 2406
103 Ga0068863_100003826 3300005841 Bacteria 14875
104 Ga0068863_100013454 3300005841 Bacteria 7891
105 Ga0068863_100045248 3300005841 Bacteria 4177
106 Ga0068863_100181895 3300005841 Bacteria 2018
107 Ga0068858_100002839 3300005842 Bacteria 17420
108 Ga0068858_100021025 3300005842 Bacteria 6096
109 Ga0068858_100044996 3300005842 Bacteria 4090
110 Ga0068862_100010517 3300005844 Bacteria 7644
111 Ga0070717_10015183 3300006028 Bacteria 5942
112 Ga0097621_100029577 3300006237 Bacteria 4328
113 Ga0068871_100010746 3300006358 Bacteria 6695
114 Ga0068871_100110396 3300006358 Bacteria 2313
115 Ga0068865_100071728 3300006881 Bacteria 2458
116 Ga0097620_100017889 3300006931 Bacteria 7125
117 Ga0097620_100237173 3300006931 Bacteria 1913
118 Ga0105240_10045206 3300009093 Bacteria 5588
119 Ga0105240_10285413 3300009093 Bacteria 1895
120 Ga0105245_10164404 3300009098 Bacteria 2108
121 Ga0105248_10001057 3300009177 Bacteria 30519
122 Ga0105248_10005810 3300009177 Bacteria 13563
123 Ga0105248_10010048 3300009177 Bacteria 10423
124 Ga0105248_10018337 3300009177 Bacteria 7729
125 Ga0105248_10051179 3300009177 Bacteria 4635
126 Ga0105238_10012193 3300009551 Bacteria 8664
127 Ga0157373_10005671 3300013100 Bacteria 9353
128 Ga0157373_10012132 3300013100 Bacteria 6334
129 Ga0157373_10063023 3300013100 Bacteria 2626
130 Ga0157371_10026352 3300013102 Bacteria 4227
131 Ga0157371_10027174 3300013102 Bacteria 4152
132 Ga0157369_10011443 3300013105 Bacteria 10076
133 Ga0157369_10046822 3300013105 Bacteria 4699
134 Ga0157369_10119233 3300013105 Bacteria 2800
135 Ga0157374_10010518 3300013296 Bacteria 7963
136 Ga0157378_10004520 3300013297 Bacteria 12204
137 Ga0163162_10136175 3300013306 Bacteria 2567
138 Ga0163162_10313340 3300013306 Bacteria 1702
139 Ga0157372_10008388 3300013307 Bacteria 10979
140 Ga0157372_10053290 3300013307 Bacteria 4508
141 Ga0157375_10002274 3300013308 Bacteria 16621
142 Ga0163163_10015289 3300014325 Bacteria 7092
143 Ga0207680_10001418 3300025903 Bacteria 11355
144 Ga0207680_10002741 3300025903 Bacteria 8243
145 Ga0207647_10006862 3300025904 Bacteria 8258
146 Ga0207705_10005981 3300025909 Bacteria 9052
147 Ga0207705_10025577 3300025909 Bacteria 4211
148 Ga0207707_10008599 3300025912 Bacteria 8851
149 Ga0207657_10001862 3300025919 Bacteria 22804
150 Ga0207657_10006116 3300025919 Bacteria 12512
151 Ga0207657_10007208 3300025919 Bacteria 11416
152 Ga0207657_10018691 3300025919 Bacteria 6604
153 Ga0207657_10036733 3300025919 Bacteria 4382
154 Ga0207657_10046162 3300025919 Bacteria 3817
155 Ga0207657_10060461 3300025919 Bacteria 3251
156 Ga0207649_10001822 3300025920 Bacteria 12167
157 Ga0207649_10116897 3300025920 Bacteria 1792
158 Ga0207652_10063872 3300025921 Bacteria 3185
159 Ga0207681_10075167 3300025923 Bacteria 2369
160 Ga0207650_10007458 3300025925 Bacteria 7455
161 Ga0207650_10029165 3300025925 Bacteria 3963
162 Ga0207650_10061670 3300025925 Bacteria 2800
163 Ga0207650_10097937 3300025925 Bacteria 2252
164 Ga0207659_10115641 3300025926 Bacteria 2047
165 Ga0207700_10009950 3300025928 Bacteria 5971
166 Ga0207644_10000151 3300025931 Bacteria 49728
167 Ga0207644_10000649 3300025931 Bacteria 21990
168 Ga0207644_10001389 3300025931 Bacteria 15624
169 Ga0207644_10030859 3300025931 Bacteria 3730
170 Ga0207644_10093127 3300025931 Bacteria 2249
171 Ga0207690_10002490 3300025932 Bacteria 11130
172 Ga0207690_10016732 3300025932 Bacteria 4468
173 Ga0207690_10018310 3300025932 Bacteria 4294
174 Ga0207690_10020466 3300025932 Bacteria 4089
175 Ga0207690_10047306 3300025932 Bacteria 2853
176 Ga0207706_10004393 3300025933 Bacteria 13254
177 Ga0207706_10005360 3300025933 Bacteria 11954
178 Ga0207706_10008821 3300025933 Bacteria 9280
179 Ga0207706_10017447 3300025933 Bacteria 6467
180 Ga0207706_10055223 3300025933 Bacteria 3503
181 Ga0207669_10009588 3300025937 Bacteria 4623
182 Ga0207704_10006443 3300025938 Bacteria 5479
183 Ga0207691_10001996 3300025940 Bacteria 19962
184 Ga0207691_10066394 3300025940 Bacteria 3264
185 Ga0207691_10072344 3300025940 Bacteria 3110
186 Ga0207691_10100935 3300025940 Bacteria 2575
187 Ga0207691_10191578 3300025940 Bacteria 1783
188 Ga0207711_10000372 3300025941 Bacteria 47656
189 Ga0207711_10026434 3300025941 Bacteria 4870
190 Ga0207711_10037093 3300025941 Bacteria 4138
191 Ga0207661_10008381 3300025944 Bacteria 7383
192 Ga0207679_10005784 3300025945 Bacteria 7762
193 Ga0207679_10041033 3300025945 Bacteria 3317
194 Ga0207679_10049456 3300025945 Bacteria 3067
195 Ga0207679_10062722 3300025945 Bacteria 2771
196 Ga0207667_10007293 3300025949 Bacteria 13323
197 Ga0207651_10003650 3300025960 Bacteria 7592
198 Ga0207651_10007905 3300025960 Bacteria 5697
199 Ga0207651_10009146 3300025960 Bacteria 5397
200 Ga0207640_10001487 3300025981 Bacteria 12633
201 Ga0207640_10128460 3300025981 Bacteria 1828
202 Ga0207658_10041103 3300025986 Bacteria 3346
203 Ga0207677_10001036 3300026023 Bacteria 15297
204 Ga0207677_10003316 3300026023 Bacteria 8519
205 Ga0207703_10002334 3300026035 Bacteria 16550
206 Ga0207703_10011355 3300026035 Bacteria 6930
207 Ga0207639_10006754 3300026041 Bacteria 7806
208 Ga0207639_10038701 3300026041 Bacteria 3549
209 Ga0207678_10002357 3300026067 Bacteria 17136
210 Ga0207678_10003157 3300026067 Bacteria 14905
211 Ga0207678_10027593 3300026067 Bacteria 4954
212 Ga0207678_10057418 3300026067 Bacteria 3349
213 Ga0207678_10084624 3300026067 Bacteria 2712
214 Ga0207678_10163663 3300026067 Bacteria 1900
215 Ga0207702_10018039 3300026078 Bacteria 5840
216 Ga0207702_10074200 3300026078 Bacteria 2936
217 Ga0207641_10004390 3300026088 Bacteria 12225
218 Ga0207641_10141709 3300026088 Bacteria 2170
219 Ga0207648_10003598 3300026089 Bacteria 16209
220 Ga0207648_10198533 3300026089 Bacteria 1779
221 Ga0207676_10010603 3300026095 Bacteria 6568
222 Ga0207674_10000271 3300026116 Bacteria 65366
223 Ga0207674_10002348 3300026116 Bacteria 23924
224 Ga0207674_10003100 3300026116 Bacteria 20520
225 Ga0207674_10004321 3300026116 Bacteria 17130
226 Ga0207674_10007396 3300026116 Bacteria 12796
227 Ga0207674_10017182 3300026116 Bacteria 7896
228 Ga0207675_100079426 3300026118 Bacteria 3074
229 Ga0207683_10001537 3300026121 Bacteria 20804
230 Ga0207683_10011713 3300026121 Bacteria 7486
231 Ga0207683_10044085 3300026121 Bacteria 3899
232 Ga0207683_10055457 3300026121 Bacteria 3475
233 Ga0207698_10001098 3300026142 Bacteria 15752
234 Ga0207698_10009892 3300026142 Bacteria 6098
235 Ga0207698_10042339 3300026142 Bacteria 3401
236 Ga0207698_10060309 3300026142 Bacteria 2950
237 Ga0207698_10115372 3300026142 Bacteria 2261
238 Ga0207698_10139170 3300026142 Bacteria 2088
239 Ga0207698_10219872 3300026142 Bacteria 1716
240 Ga0268264_10017142 3300028381 Bacteria 5932
241 Ga0307405_10039547 3300031731 Bacteria 2851
242 Ga0307410_10016242 3300031852 Bacteria 4436
243 Ga0307407_10015175 3300031903 Bacteria 3798
244 Ga0307407_10025630 3300031903 Bacteria 3110
245 Ga0307412_10019409 3300031911 Bacteria 4117
246 Ga0307409_100024442 3300031995 Bacteria 4214
247 Ga0307409_100035859 3300031995 Bacteria 3638
248 Ga0307416_100013954 3300032002 Bacteria 5481
249 Ga0307416_100082878 3300032002 Bacteria 2718
250 Ga0307414_10070788 3300032004 Bacteria 2513
251 Ga0307411_10049321 3300032005 Bacteria 2735
252 Ga0373931_0110220 3300035691 Bacteria 1561
253 Ga0373935_0008624 3300035692 Bacteria 6102
254 Ga0395899_0000224 3300037312 Bacteria 76706
255 Ga0395899_0001507 3300037312 Bacteria 19766
256 Ga0395899_0001939 3300037312 Bacteria 17035
257 Ga0395899_0012487 3300037312 Bacteria 6507
258 Ga0395899_0015520 3300037312 Bacteria 5808
259 Ga0395899_0018641 3300037312 Bacteria 5273
260 Ga0395899_0032369 3300037312 Bacteria 3927
261 Ga0395899_0057163 3300037312 Bacteria 2881
262 Ga0395899_0070761 3300037312 Bacteria 2553
263 Ga0395899_0099130 3300037312 Bacteria 2105
264 Ga0395900_0000294 3300037418 Bacteria 75260
265 Ga0395900_0001134 3300037418 Bacteria 33662
266 Ga0395900_0001825 3300037418 Bacteria 24311
267 Ga0395900_0006054 3300037418 Bacteria 12616
268 Ga0395900_0006995 3300037418 Bacteria 11687
269 Ga0395900_0009264 3300037418 Bacteria 10093
270 Ga0395900_0013611 3300037418 Bacteria 8309
271 Ga0395900_0018427 3300037418 Bacteria 7120
272 Ga0395900_0024203 3300037418 Bacteria 6217
273 Ga0395900_0034344 3300037418 Bacteria 5221
274 Ga0395900_0039005 3300037418 Bacteria 4896
275 Ga0395900_0063319 3300037418 Bacteria 3801
276 Ga0395900_0151210 3300037418 Bacteria 2371
277 Ga0395900_0209684 3300037418 Bacteria 1968
278 Ga0395898_0000192 3300037466 Bacteria 156121
279 Ga0395898_0014210 3300037466 Bacteria 8187
280 Ga0395898_0027215 3300037466 Bacteria 5742
281 Ga0395898_0080574 3300037466 Bacteria 3139
282 Ga0395905_0000066 3300037471 Bacteria 183121
283 Ga0395905_0000128 3300037471 Bacteria 124305
284 Ga0395905_0000358 3300037471 Bacteria 64883
285 Ga0395905_0001563 3300037471 Bacteria 27336
286 Ga0395905_0001888 3300037471 Bacteria 24158
287 Ga0395905_0002566 3300037471 Bacteria 20009
288 Ga0395905_0004430 3300037471 Bacteria 14592
289 Ga0395905_0008910 3300037471 Bacteria 9853
290 Ga0395905_0009612 3300037471 Bacteria 9441
291 Ga0395905_0018538 3300037471 Bacteria 6605
292 Ga0395905_0019492 3300037471 Bacteria 6429
293 Ga0395905_0025444 3300037471 Bacteria 5582
294 Ga0395905_0033571 3300037471 Bacteria 4819
295 Ga0395905_0043331 3300037471 Bacteria 4222
296 Ga0395905_0062723 3300037471 Bacteria 3476
297 Ga0395905_0064570 3300037471 Bacteria 3426
298 Ga0395905_0082877 3300037471 Bacteria 3005
299 Ga0395901_0001222 3300038443 Bacteria 27379
300 Ga0395901_0002896 3300038443 Bacteria 17322
301 Ga0395901_0007314 3300038443 Bacteria 11145
302 Ga0395901_0007334 3300038443 Bacteria 11129
303 Ga0395901_0007475 3300038443 Bacteria 11032
304 Ga0395901_0011351 3300038443 Bacteria 9027
305 Ga0395901_0031525 3300038443 Bacteria 5466
306 Ga0395901_0186680 3300038443 Bacteria 2174
307 Ga0436365_0451685 3300039437 Bacteria 11482
308 Ga0439458_0003327 3300042157 Bacteria 3782
309 Ga0466969_0040353 3300044656 Bacteria 2338
310 Ga0466965_0055435 3300044683 Bacteria 1973
311 Ga0466966_0006529 3300044684 Bacteria 7718
312 Ga0466966_0066091 3300044684 Bacteria 2273
313 Ga0466966_0069536 3300044684 Bacteria 2208
314 Ga0466966_0134637 3300044684 Bacteria 1512
315 Ga0466963_0040702 3300044694 Bacteria 3046
316 Ga0466957_0006974 3300044842 Bacteria 6386
317 Ga0466958_0004049 3300045836 Bacteria 7684
318 Ga0466967_0002033 3300045976 Bacteria 12337
319 Ga0466967_0013379 3300045976 Bacteria 6337
320 Ga0466967_0022711 3300045976 Bacteria 5126
321 Ga0466967_0032864 3300045976 Bacteria 4386
322 Ga0466967_0228187 3300045976 Bacteria 1772
323 Ga0495621_0001404 3300046539 Bacteria 6237
324 Ga0495633_0023856 3300046558 Bacteria 3027
325 Ga0495669_0001085 3300046684 Bacteria 11270
326 Ga0495669_0001756 3300046684 Bacteria 8850
327 Ga0495669_0003643 3300046684 Bacteria 6343
328 Ga0495670_0000431 3300046691 Bacteria 20088
329 Ga0495677_0001724 3300047445 Bacteria 8775
330 Ga0495677_0035389 3300047445 Bacteria 1822
331 Ga0496107_0018516 3300048910 Bacteria 4905
332 Ga0496108_0002625 3300048911 Bacteria 14400
333 Ga0496108_0033736 3300048911 Bacteria 4251
334 Ga0496109_0016123 3300048912 Bacteria 6530
335 Ga0496112_0013940 3300048915 Bacteria 7436
336 Ga0496112_0027102 3300048915 Bacteria 5523
337 Ga0496112_0070191 3300048915 Bacteria 3462
338 Ga0496112_0131328 3300048915 Bacteria 2475
339 Ga0496113_0015615 3300048916 Bacteria 5227
340 Ga0496113_0024836 3300048916 Bacteria 4265
341 Ga0496114_0055976 3300048917 Bacteria 3290
342 Ga0466962_0033125 3300061719 Bacteria 2472
343 Ga0207639_10064639
344 JGI24744J21845_10000764
345 Ga0070658_10013180
346 Ga0070658_10027077
347 Ga0070658_10071322
348 Ga0070658_10136310
349 Ga0070676_10065073
350 Ga0070683_100056120
351 Ga0070690_100002262
352 Ga0070670_100001163
353 Ga0070670_100002964
354 Ga0070670_100054928
355 Ga0070670_100175752
356 Ga0070677_10035943
357 Ga0070666_10000415
358 Ga0070666_10023503
359 Ga0070666_10038142
360 Ga0070680_100057207
361 Ga0070680_100064898
362 Ga0070680_100098034
363 Ga0068868_100000422
364 Ga0068868_100001497
365 Ga0070660_100007252
366 Ga0070660_100013537
367 Ga0070660_100014106
368 Ga0070660_100023818
369 Ga0070660_100052355
370 Ga0070661_100004015
371 Ga0070661_100021659
372 Ga0070661_100024601
373 Ga0070661_100063588
374 Ga0070661_100067628
375 Ga0070675_100016044
376 Ga0070675_100018671
377 Ga0070675_100045187
378 Ga0070671_100000793
379 Ga0070671_100000972
380 Ga0070671_100003799
381 Ga0070671_100004515
382 Ga0070671_100027398
383 Ga0070671_100097871
384 Ga0070674_100037339
385 Ga0070674_100110220
386 Ga0070673_100001888
387 Ga0070673_100002090
388 Ga0070659_100008541
389 Ga0070659_100014473
390 Ga0070659_100032416
391 Ga0070659_100078274
392 Ga0070659_100091454
393 Ga0070667_100000839
394 Ga0070667_100046858
395 Ga0070667_100147058
396 Ga0070714_100027365
397 Ga0070714_100049107
398 Ga0070713_100047407
399 Ga0070713_100111776
400 Ga0070663_100063817
401 Ga0070663_100090897
402 Ga0070678_100002943
403 Ga0070678_100004841
404 Ga0070678_100179113
405 Ga0070662_100008474
406 Ga0070662_100008891
407 Ga0070662_100022000
408 Ga0070681_10007172
409 Ga0070681_10114877
410 Ga0068867_100022263
411 Ga0068867_100138473
412 Ga0070679_100069792
413 Ga0070684_100005653
414 Ga0070684_100037770
415 Ga0068853_100004267
416 Ga0068853_100009256
417 Ga0068853_100042931
418 Ga0070672_100005547
419 Ga0070672_100089453
420 Ga0070672_100156959
421 Ga0070693_100105511
422 Ga0070665_100006465
423 Ga0070665_100015898
424 Ga0070665_100055144
425 Ga0068855_100032229
426 Ga0068855_100059294
427 Ga0070664_100030779
428 Ga0070664_100053340
429 Ga0070664_100055539
430 Ga0070664_100122650
431 Ga0068857_100002945
432 Ga0068857_100013108
433 Ga0068857_100129837
434 Ga0068854_100022349
435 Ga0068852_100019099
436 Ga0068852_100094783
437 Ga0068852_100162079
438 Ga0068859_100017890
439 Ga0068859_100237185
440 Ga0068864_100002647
441 Ga0068864_100033431
442 Ga0068864_100061483
443 Ga0068866_10006572
444 Ga0068861_100091162
445 Ga0068863_100003826
446 Ga0068863_100013454
447 Ga0068863_100045248
448 Ga0068863_100181895
449 Ga0068858_100002839
450 Ga0068858_100021025
451 Ga0068858_100044996
452 Ga0068862_100010517
453 Ga0070717_10015183
454 Ga0097621_100029577
455 Ga0068871_100010746
456 Ga0068871_100110396
457 Ga0068865_100071728
458 Ga0097620_100017889
459 Ga0097620_100237173
460 Ga0105240_10045206
461 Ga0105240_10285413
462 Ga0105245_10164404
463 Ga0105248_10001057
464 Ga0105248_10005810
465 Ga0105248_10010048
466 Ga0105248_10018337
467 Ga0105248_10051179
468 Ga0105238_10012193
469 Ga0157373_10005671
470 Ga0157373_10012132
471 Ga0157373_10063023
472 Ga0157371_10026352
473 Ga0157371_10027174
474 Ga0157369_10011443
475 Ga0157369_10046822
476 Ga0157369_10119233
477 Ga0157374_10010518
478 Ga0157378_10004520
479 Ga0163162_10136175
480 Ga0163162_10313340
481 Ga0157372_10008388
482 Ga0157372_10053290
483 Ga0157375_10002274
484 Ga0163163_10015289
485 Ga0207680_10001418
486 Ga0207680_10002741
487 Ga0207647_10006862
488 Ga0207705_10005981
489 Ga0207705_10025577
490 Ga0207707_10008599
491 Ga0207657_10001862
492 Ga0207657_10006116
493 Ga0207657_10007208
494 Ga0207657_10018691
495 Ga0207657_10036733
496 Ga0207657_10046162
497 Ga0207657_10060461
498 Ga0207649_10001822
499 Ga0207649_10116897
500 Ga0207652_10063872
501 Ga0207681_10075167
502 Ga0207650_10007458
503 Ga0207650_10029165
504 Ga0207650_10061670
505 Ga0207650_10097937
506 Ga0207659_10115641
507 Ga0207700_10009950
508 Ga0207644_10000151
509 Ga0207644_10000649
510 Ga0207644_10001389
511 Ga0207644_10030859
512 Ga0207644_10093127
513 Ga0207690_10002490
514 Ga0207690_10016732
515 Ga0207690_10018310
516 Ga0207690_10020466
517 Ga0207690_10047306
518 Ga0207706_10004393
519 Ga0207706_10005360
520 Ga0207706_10008821
521 Ga0207706_10017447
522 Ga0207706_10055223
523 Ga0207669_10009588
524 Ga0207704_10006443
525 Ga0207691_10001996
526 Ga0207691_10066394
527 Ga0207691_10072344
528 Ga0207691_10100935
529 Ga0207691_10191578
530 Ga0207711_10000372
531 Ga0207711_10026434
532 Ga0207711_10037093
533 Ga0207661_10008381
534 Ga0207679_10005784
535 Ga0207679_10041033
536 Ga0207679_10049456
537 Ga0207679_10062722
538 Ga0207667_10007293
539 Ga0207651_10003650
540 Ga0207651_10007905
541 Ga0207651_10009146
542 Ga0207640_10001487
543 Ga0207640_10128460
544 Ga0207658_10041103
545 Ga0207677_10001036
546 Ga0207677_10003316
547 Ga0207703_10002334
548 Ga0207703_10011355
549 Ga0207639_10006754
550 Ga0207639_10038701
551 Ga0207678_10002357
552 Ga0207678_10003157
553 Ga0207678_10027593
554 Ga0207678_10057418
555 Ga0207678_10084624
556 Ga0207678_10163663
557 Ga0207702_10018039
558 Ga0207702_10074200
559 Ga0207641_10004390
560 Ga0207641_10141709
561 Ga0207648_10003598
562 Ga0207648_10198533
563 Ga0207676_10010603
564 Ga0207674_10000271
565 Ga0207674_10002348
566 Ga0207674_10003100
567 Ga0207674_10004321
568 Ga0207674_10007396
569 Ga0207674_10017182
570 Ga0207675_100079426
571 Ga0207683_10001537
572 Ga0207683_10011713
573 Ga0207683_10044085
574 Ga0207683_10055457
575 Ga0207698_10001098
576 Ga0207698_10009892
577 Ga0207698_10042339
578 Ga0207698_10060309
579 Ga0207698_10115372
580 Ga0207698_10139170
581 Ga0207698_10219872
582 Ga0268264_10017142
583 Ga0307405_10039547
584 Ga0307410_10016242
585 Ga0307407_10015175
586 Ga0307407_10025630
587 Ga0307412_10019409
588 Ga0307409_100024442
589 Ga0307409_100035859
590 Ga0307416_100013954
591 Ga0307416_100082878
592 Ga0307414_10070788
593 Ga0307411_10049321
594 Ga0373931_0110220
595 Ga0373935_0008624
596 Ga0395899_0000224
597 Ga0395899_0001507
598 Ga0395899_0001939
599 Ga0395899_0012487
600 Ga0395899_0015520
601 Ga0395899_0018641
602 Ga0395899_0032369
603 Ga0395899_0057163
604 Ga0395899_0070761
605 Ga0395899_0099130
606 Ga0395900_0000294
607 Ga0395900_0001134
608 Ga0395900_0001825
609 Ga0395900_0006054
610 Ga0395900_0006995
611 Ga0395900_0009264
612 Ga0395900_0013611
613 Ga0395900_0018427
614 Ga0395900_0024203
615 Ga0395900_0034344
616 Ga0395900_0039005
617 Ga0395900_0063319
618 Ga0395900_0151210
619 Ga0395900_0209684
620 Ga0395898_0000192
621 Ga0395898_0014210
622 Ga0395898_0027215
623 Ga0395898_0080574
624 Ga0395905_0000066
625 Ga0395905_0000128
626 Ga0395905_0000358
627 Ga0395905_0001563
628 Ga0395905_0001888
629 Ga0395905_0002566
630 Ga0395905_0004430
631 Ga0395905_0008910
632 Ga0395905_0009612
633 Ga0395905_0018538
634 Ga0395905_0019492
635 Ga0395905_0025444
636 Ga0395905_0033571
637 Ga0395905_0043331
638 Ga0395905_0062723
639 Ga0395905_0064570
640 Ga0395905_0082877
641 Ga0395901_0001222
642 Ga0395901_0002896
643 Ga0395901_0007314
644 Ga0395901_0007334
645 Ga0395901_0007475
646 Ga0395901_0011351
647 Ga0395901_0031525
648 Ga0395901_0186680
649 Ga0436365_0451685
650 Ga0439458_0003327
651 Ga0466969_0040353
652 Ga0466965_0055435
653 Ga0466966_0006529
654 Ga0466966_0066091
655 Ga0466966_0069536
656 Ga0466966_0134637
657 Ga0466963_0040702
658 Ga0466957_0006974
659 Ga0466958_0004049
660 Ga0466967_0002033
661 Ga0466967_0013379
662 Ga0466967_0022711
663 Ga0466967_0032864
664 Ga0466967_0228187
665 Ga0495621_0001404
666 Ga0495633_0023856
667 Ga0495669_0001085
668 Ga0495669_0001756
669 Ga0495669_0003643
670 Ga0495670_0000431
671 Ga0495677_0001724
672 Ga0495677_0035389
673 Ga0496107_0018516
674 Ga0496108_0002625
675 Ga0496108_0033736
676 Ga0496109_0016123
677 Ga0496112_0013940
678 Ga0496112_0027102
679 Ga0496112_0070191
680 Ga0496112_0131328
681 Ga0496113_0015615
682 Ga0496113_0024836
683 Ga0496114_0055976
684 Ga0466962_0033125

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF20154

LNT_N

Apolipoprotein N-acyltransferase N-terminal domain

10

172

0.93

PF00795

CN_hydrolase

Carbon-nitrogen hydrolase

211

470

0.75

Structural Annotation

Top 5 Hits

ID Description Score Start End
6nwr-assembly1.cif.gz_A thioester acyl-intermediate of apolipoprotein n-acyltransferase (lnt) 0.8417 2 498
8aq3-assembly1.cif.gz_A in surfo structure of the membrane integral lipoprotein n-acyltransferase lnt from e. coli in complex with pe 0.8383 3 499
5n6h-assembly2.cif.gz_B structure of the membrane integral lipoprotein n-acyltransferase lnt from e. coli 0.8383 3 499
5n6m-assembly1.cif.gz_A structure of the membrane integral lipoprotein n-acyltransferase lnt from p. aeruginosa 0.8383 1 503
5n6h-assembly1.cif.gz_A structure of the membrane integral lipoprotein n-acyltransferase lnt from e. coli 0.838 2 499
ID Description Score Start End Superfamily
af_O53493_232_506_3.60.110.10 Alpha Beta;4-Layer Sandwich;Nitrilase/N-carbamoyl-D-aminoacid amidohydrolase;Carbon-nitrogen hydrolase 0.7654 204 478 3.60.110.10
af_O53493_232_506_3.60.110.10 Alpha Beta;4-Layer Sandwich;Nitrilase/N-carbamoyl-D-aminoacid amidohydrolase;Carbon-nitrogen hydrolase 0.7553 204 478 3.60.110.10
af_P23930_215_482_3.60.110.10 Alpha Beta;4-Layer Sandwich;Nitrilase/N-carbamoyl-D-aminoacid amidohydrolase;Carbon-nitrogen hydrolase 0.7523 203 474 3.60.110.10
af_P23930_215_482_3.60.110.10 Alpha Beta;4-Layer Sandwich;Nitrilase/N-carbamoyl-D-aminoacid amidohydrolase;Carbon-nitrogen hydrolase 0.7497 203 474 3.60.110.10
af_O59829_1_271_3.60.110.10 Alpha Beta;4-Layer Sandwich;Nitrilase/N-carbamoyl-D-aminoacid amidohydrolase;Carbon-nitrogen hydrolase 0.6642 208 466 3.60.110.10
ID Description Score Start End GO Terms
AF-A0A520HPN2-F1-model_v4 Apolipoprotein N-acyltransferase 0.9413 4 147 GO:0016020
GO:0016410
GO:0042158
AF-A0A4R6FAW3-F1-model_v4 Apolipoprotein N-acyltransferase (ALP N-acyltransferase) (EC 2.3.1.269) 0.941 4 503 GO:0005886
GO:0016410
GO:0042158
AF-A0A2A2SEU7-F1-model_v4 Apolipoprotein N-acyltransferase (ALP N-acyltransferase) (EC 2.3.1.269) 0.9371 1 503 GO:0005886
GO:0016410
GO:0042158
AF-A0A2A2SEU7-F1-model_v4 Apolipoprotein N-acyltransferase (ALP N-acyltransferase) (EC 2.3.1.269) 0.9353 1 503 GO:0005886
GO:0016410
GO:0042158
AF-A0A4R6FAW3-F1-model_v4 Apolipoprotein N-acyltransferase (ALP N-acyltransferase) (EC 2.3.1.269) 0.9337 4 503 GO:0005886
GO:0016410
GO:0042158

Map