F415195

General Info

Members Datasets Scaffolds Average Seq Length
342 180 341 322

Family's Representative Sequence

Representative Sequence 3300026041|Ga0207639_10007353|Ga0207639_100073538
Length 324
Sequence MEKSNFVDQIRIFCRSGHGGAGSKHFMRNKLTAMGGPDGGAHIILKGNSQLWTLLHLRYFKNVLAENGQNGSKNNSSGLTGKDIIIEVPLGTVARDEETNAVVAEILEDGQEIILAKGGRGGLGNSNFKTATNQAPEYAQPGEWKVLELKVLADVGLVGFPNAGKSTLLSSITAAKPKIADYAFTTLVPQLGMVEYRDGKSFCIADLPGIIEGAAEGKGLGHRFLRHIERNSILLFLIPADSKDHKKEFGILHKELEEYNPEMLQKDFVIAISKSDMLDEELKTAIEKELPKNIPHVFISSVTGLGLQELKDLLWKTLNAPVKQ

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2884634485 Algoriphagus kandeliae XY-J91 Isolate Unclassified
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
5 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
6 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
7 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
8 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
25 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
26 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
27 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
28 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
29 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
30 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
31 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
32 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
33 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
34 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
35 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
36 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
37 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
38 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
39 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
40 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
41 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
42 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
43 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
44 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
45 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
46 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
47 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
48 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
49 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
51 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
52 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
53 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
55 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
56 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
57 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
58 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
59 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
60 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
61 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
62 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
63 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
64 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
65 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
66 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
67 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
68 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
69 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
70 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
71 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
72 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
73 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
74 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
75 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
76 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
77 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
78 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
79 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
80 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
117 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
120 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
121 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
122 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
123 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
124 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
125 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
126 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
127 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
128 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
129 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
130 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
131 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
132 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
133 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
134 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
135 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
136 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
137 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
138 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
139 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
140 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
141 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
142 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
143 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
144 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
145 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
146 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
147 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
148 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
149 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
150 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
151 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
152 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
153 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
154 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
155 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
156 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
157 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
158 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
159 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
160 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
161 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
162 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
163 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
164 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
165 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
166 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
167 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
168 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
169 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
170 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
171 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
172 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
173 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
174 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
175 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
176 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
177 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
178 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
179 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
180 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.71
Metatranscriptomes 0
Isolates 0.29

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.97
Nodule 0
Rhizoplane 0.58
Rhizosphere 89.77
Stem 0
Stem Tuber 0
Unclassified 4.68

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1663676 2162886007 Bacteria 241831
2 JGI25406J46586_10001527 3300003203 Bacteria 10924
3 rootH1_10045052 3300003316 Bacteria 4863
4 rootH2_10006463 3300003320 Bacteria 45674
5 rootH2_10056072 3300003320 Bacteria 3960
6 rootH2_10148925 3300003320 Bacteria 3779
7 rootL2_10060842 3300003322 Bacteria 7201
8 rootL2_10100629 3300003322 Bacteria 1681
9 JGI25160J50197_1003012 3300003354 Bacteria 7679
10 JGI25160J50197_1005456 3300003354 Bacteria 5290
11 Ga0065714_10073881 3300005288 Bacteria 3118
12 Ga0070658_10000626 3300005327 Bacteria 30535
13 Ga0070658_10148931 3300005327 Bacteria 1958
14 Ga0070676_10000167 3300005328 Bacteria 26643
15 Ga0070676_10116625 3300005328 Bacteria 1670
16 Ga0070690_100011489 3300005330 Bacteria 5180
17 Ga0068869_100042923 3300005334 Bacteria 3245
18 Ga0068869_100060371 3300005334 Bacteria 2778
19 Ga0068869_100145461 3300005334 Bacteria 1834
20 Ga0068869_100203872 3300005334 Bacteria 1561
21 Ga0070666_10000064 3300005335 Bacteria 79823
22 Ga0070666_10046785 3300005335 Bacteria 2903
23 Ga0070666_10071267 3300005335 Bacteria 2365
24 Ga0070680_100183931 3300005336 Bacteria 1760
25 Ga0070682_100000041 3300005337 Bacteria 142152
26 Ga0068868_100000280 3300005338 Bacteria 34319
27 Ga0068868_100071839 3300005338 Bacteria 2760
28 Ga0068868_100073261 3300005338 Bacteria 2734
29 Ga0070689_100128758 3300005340 Bacteria 2028
30 Ga0070668_100000267 3300005347 Bacteria 34430
31 Ga0070668_100189505 3300005347 Bacteria 1684
32 Ga0070669_100033600 3300005353 Bacteria 3711
33 Ga0070671_100091215 3300005355 Bacteria 2552
34 Ga0070673_100048435 3300005364 Bacteria 3313
35 Ga0070688_100067129 3300005365 Bacteria 2284
36 Ga0070667_100001041 3300005367 Bacteria 25338
37 Ga0070714_100212909 3300005435 Bacteria 1772
38 Ga0070681_10064250 3300005458 Bacteria 3641
39 Ga0068867_100008995 3300005459 Bacteria 7047
40 Ga0068867_100105862 3300005459 Bacteria 2154
41 Ga0068867_100157568 3300005459 Bacteria 1788
42 Ga0070698_100065707 3300005471 Bacteria 3652
43 Ga0070679_100025584 3300005530 Bacteria 5794
44 Ga0070684_100010994 3300005535 Bacteria 7198
45 Ga0068853_100005441 3300005539 Bacteria 9983
46 Ga0068853_100024232 3300005539 Bacteria 5086
47 Ga0068853_100257738 3300005539 Bacteria 1602
48 Ga0070672_100000310 3300005543 Bacteria 27579
49 Ga0070672_100069121 3300005543 Bacteria 2803
50 Ga0070672_100317566 3300005543 Bacteria 1324
51 Ga0070686_100058576 3300005544 Bacteria 2479
52 Ga0070665_100000845 3300005548 Bacteria 39974
53 Ga0070665_100019827 3300005548 Bacteria 6751
54 Ga0068855_100009549 3300005563 Bacteria 11715
55 Ga0068855_100026762 3300005563 Bacteria 6901
56 Ga0068855_100030104 3300005563 Bacteria 6492
57 Ga0068855_100236281 3300005563 Bacteria 2044
58 Ga0070664_100057516 3300005564 Bacteria 3306
59 Ga0070664_100185490 3300005564 Bacteria 1851
60 Ga0068854_100032661 3300005578 Bacteria 3623
61 Ga0068856_100067002 3300005614 Bacteria 3548
62 Ga0068852_100006842 3300005616 Bacteria 8283
63 Ga0068852_100077982 3300005616 Bacteria 2930
64 Ga0068852_100129118 3300005616 Unclassified 2325
65 Ga0068859_100000003 3300005617 Bacteria 479218
66 Ga0068859_100000872 3300005617 Bacteria 30780
67 Ga0068864_100005189 3300005618 Bacteria 10670
68 Ga0068864_100020807 3300005618 Bacteria 5490
69 Ga0068866_10032012 3300005718 Bacteria 2539
70 Ga0068866_10043881 3300005718 Bacteria 2234
71 Ga0068861_100006132 3300005719 Bacteria 8178
72 Ga0068861_100037225 3300005719 Bacteria 3617
73 Ga0068851_10001250 3300005834 Bacteria 11060
74 Ga0068851_10042627 3300005834 Bacteria 2285
75 Ga0068863_100001446 3300005841 Bacteria 23574
76 Ga0068863_100002398 3300005841 Bacteria 18634
77 Ga0068863_100515293 3300005841 Bacteria 1179
78 Ga0068858_100002672 3300005842 Bacteria 17944
79 Ga0068858_100002928 3300005842 Bacteria 17176
80 Ga0068860_100006378 3300005843 Bacteria 11839
81 Ga0068860_100030292 3300005843 Bacteria 5204
82 Ga0068860_100043752 3300005843 Bacteria 4270
83 Ga0068860_100078567 3300005843 Bacteria 3138
84 Ga0081539_10001794 3300005985 Bacteria 33997
85 Ga0075366_10004746 3300006195 Bacteria 7325
86 Ga0097621_100006034 3300006237 Bacteria 8562
87 Ga0097621_100013337 3300006237 Bacteria 6122
88 Ga0097621_100222283 3300006237 Bacteria 1646
89 Ga0068871_100002911 3300006358 Bacteria 11736
90 Ga0068871_100005277 3300006358 Bacteria 9046
91 Ga0068871_100025501 3300006358 Bacteria 4601
92 Ga0068871_100082942 3300006358 Bacteria 2659
93 Ga0075428_100009481 3300006844 Bacteria 10805
94 Ga0068865_100005619 3300006881 Bacteria 7611
95 Ga0068865_100073467 3300006881 Bacteria 2432
96 Ga0097620_100000003 3300006931 Bacteria 479218
97 Ga0097620_100000872 3300006931 Bacteria 30780
98 Ga0105240_10000011 3300009093 Bacteria 523646
99 Ga0105240_10003002 3300009093 Bacteria 26548
100 Ga0105240_10005046 3300009093 Bacteria 19803
101 Ga0105240_10021850 3300009093 Bacteria 8502
102 Ga0105240_10069171 3300009093 Bacteria 4371
103 Ga0105240_10077291 3300009093 Bacteria 4101
104 Ga0105240_10162782 3300009093 Bacteria 2649
105 Ga0105247_10002345 3300009101 Bacteria 12924
106 Ga0105247_10031004 3300009101 Bacteria 3243
107 Ga0105241_10000543 3300009174 Bacteria 28453
108 Ga0105241_10239249 3300009174 Bacteria 1534
109 Ga0105242_10043154 3300009176 Bacteria 3647
110 Ga0105248_10053027 3300009177 Bacteria 4551
111 Ga0105237_10005614 3300009545 Bacteria 14142
112 Ga0105237_10073493 3300009545 Bacteria 3411
113 Ga0105237_10106263 3300009545 Bacteria 2799
114 Ga0105237_10152972 3300009545 Unclassified 2303
115 Ga0105238_10035260 3300009551 Bacteria 5087
116 Ga0105238_10047287 3300009551 Bacteria 4340
117 Ga0105249_10005321 3300009553 Bacteria 11108
118 Ga0105249_10018347 3300009553 Bacteria 6221
119 Ga0105239_10000488 3300010375 Bacteria 57554
120 Ga0105239_10001268 3300010375 Bacteria 34104
121 Ga0105239_10005650 3300010375 Bacteria 14618
122 Ga0105239_10066603 3300010375 Bacteria 3956
123 Ga0105239_10098587 3300010375 Bacteria 3230
124 Ga0105239_10176169 3300010375 Bacteria 2392
125 Ga0105239_10303194 3300010375 Bacteria 1799
126 Ga0105246_10050439 3300011119 Bacteria 2855
127 Ga0105246_10090751 3300011119 Bacteria 2201
128 Ga0157373_10070764 3300013100 Bacteria 2465
129 Ga0157373_10149794 3300013100 Bacteria 1641
130 Ga0157371_10000654 3300013102 Bacteria 41046
131 Ga0157371_10007130 3300013102 Bacteria 9079
132 Ga0157371_10016206 3300013102 Bacteria 5568
133 Ga0157370_10001484 3300013104 Bacteria 29041
134 Ga0157370_10003750 3300013104 Bacteria 17754
135 Ga0157370_10093872 3300013104 Bacteria 2816
136 Ga0157369_10038639 3300013105 Bacteria 5218
137 Ga0157369_10044130 3300013105 Bacteria 4855
138 Ga0157374_10000168 3300013296 Bacteria 60649
139 Ga0157374_10057151 3300013296 Bacteria 3644
140 Ga0157374_10069208 3300013296 Bacteria 3323
141 Ga0157378_10070483 3300013297 Bacteria 3139
142 Ga0163162_10000359 3300013306 Bacteria 41296
143 Ga0163162_10000725 3300013306 Bacteria 30582
144 Ga0163162_10001104 3300013306 Bacteria 25036
145 Ga0163162_10004389 3300013306 Bacteria 13572
146 Ga0163162_10011167 3300013306 Bacteria 8749
147 Ga0163162_10013259 3300013306 Bacteria 8049
148 Ga0163162_10075172 3300013306 Bacteria 3438
149 Ga0163162_10253849 3300013306 Bacteria 1890
150 Ga0157372_10000747 3300013307 Bacteria 35352
151 Ga0157372_10005321 3300013307 Bacteria 13668
152 Ga0157372_10005908 3300013307 Bacteria 13031
153 Ga0157372_10020633 3300013307 Bacteria 7110
154 Ga0157372_10141826 3300013307 Bacteria 2769
155 Ga0157372_10458903 3300013307 Unclassified 1485
156 Ga0157372_10511532 3300013307 Bacteria 1400
157 Ga0157375_10001148 3300013308 Bacteria 22891
158 Ga0157375_10067619 3300013308 Bacteria 3571
159 Ga0163163_10003161 3300014325 Bacteria 13953
160 Ga0163163_10016566 3300014325 Bacteria 6855
161 Ga0163163_10058914 3300014325 Bacteria 3797
162 Ga0157379_10000810 3300014968 Bacteria 25369
163 Ga0157379_10083500 3300014968 Bacteria 2863
164 Ga0157379_10115788 3300014968 Bacteria 2410
165 Ga0157376_10000827 3300014969 Bacteria 20261
166 Ga0157376_10018546 3300014969 Bacteria 5338
167 Ga0157376_10117332 3300014969 Bacteria 2353
168 Ga0163161_10017470 3300017792 Bacteria 5020
169 Ga0163161_10018033 3300017792 Bacteria 4947
170 Ga0213876_10017067 3300021384 Bacteria 3835
171 Ga0207426_1000040 3300025302 Bacteria 433920
172 Ga0209257_1000007 3300025304 Bacteria 1564415
173 Ga0207656_10005877 3300025321 Bacteria 4374
174 Ga0207710_10000732 3300025900 Bacteria 18146
175 Ga0207688_10179181 3300025901 Bacteria 1263
176 Ga0207680_10000463 3300025903 Bacteria 19165
177 Ga0207680_10001799 3300025903 Bacteria 10121
178 Ga0207680_10010100 3300025903 Bacteria 4712
179 Ga0207647_10001289 3300025904 Bacteria 19277
180 Ga0207647_10006031 3300025904 Bacteria 8835
181 Ga0207647_10043104 3300025904 Bacteria 2825
182 Ga0207645_10003328 3300025907 Bacteria 12257
183 Ga0207645_10200384 3300025907 Bacteria 1313
184 Ga0207705_10006189 3300025909 Bacteria 8901
185 Ga0207654_10006451 3300025911 Bacteria 5906
186 Ga0207695_10000010 3300025913 Bacteria 981919
187 Ga0207695_10001317 3300025913 Bacteria 42084
188 Ga0207695_10002258 3300025913 Bacteria 28855
189 Ga0207695_10005055 3300025913 Bacteria 17689
190 Ga0207695_10044020 3300025913 Bacteria 4752
191 Ga0207695_10044238 3300025913 Bacteria 4737
192 Ga0207695_10270337 3300025913 Bacteria 1595
193 Ga0207695_10336055 3300025913 Bacteria 1399
194 Ga0207671_10001848 3300025914 Bacteria 23634
195 Ga0207671_10003111 3300025914 Bacteria 16871
196 Ga0207662_10023647 3300025918 Bacteria 3532
197 Ga0207652_10000018 3300025921 Bacteria 187527
198 Ga0207681_10157479 3300025923 Bacteria 1708
199 Ga0207650_10342080 3300025925 Bacteria 1229
200 Ga0207659_10179315 3300025926 Bacteria 1677
201 Ga0207644_10151608 3300025931 Bacteria 1794
202 Ga0207686_10116736 3300025934 Bacteria 1809
203 Ga0207669_10204111 3300025937 Bacteria 1437
204 Ga0207669_10321760 3300025937 Bacteria 1184
205 Ga0207691_10000234 3300025940 Bacteria 54055
206 Ga0207691_10023864 3300025940 Bacteria 5756
207 Ga0207691_10134594 3300025940 Bacteria 2181
208 Ga0207689_10012742 3300025942 Bacteria 7183
209 Ga0207689_10028758 3300025942 Bacteria 4648
210 Ga0207689_10068343 3300025942 Bacteria 2920
211 Ga0207661_10092746 3300025944 Bacteria 2518
212 Ga0207679_10018708 3300025945 Bacteria 4646
213 Ga0207679_10106636 3300025945 Bacteria 2203
214 Ga0207667_10001839 3300025949 Bacteria 26648
215 Ga0207667_10009289 3300025949 Bacteria 11600
216 Ga0207667_10208901 3300025949 Bacteria 2001
217 Ga0207712_10009401 3300025961 Bacteria 6186
218 Ga0207712_10121490 3300025961 Bacteria 1977
219 Ga0207668_10002523 3300025972 Bacteria 10687
220 Ga0207658_10002543 3300025986 Bacteria 13258
221 Ga0207677_10048063 3300026023 Bacteria 2870
222 Ga0207677_10152310 3300026023 Bacteria 1786
223 Ga0207703_10007084 3300026035 Bacteria 8922
224 Ga0207703_10049840 3300026035 Bacteria 3386
225 Ga0207639_10005013 3300026041 Bacteria 8918
226 Ga0207639_10007353 3300026041 Bacteria 7506
227 Ga0207639_10133876 3300026041 Bacteria 2055
228 Ga0207639_10300080 3300026041 Bacteria 1420
229 Ga0207702_10017623 3300026078 Bacteria 5910
230 Ga0207641_10000026 3300026088 Bacteria 245091
231 Ga0207641_10016086 3300026088 Bacteria 6127
232 Ga0207648_10009688 3300026089 Bacteria 9214
233 Ga0207676_10007131 3300026095 Bacteria 7917
234 Ga0207676_10020492 3300026095 Bacteria 4839
235 Ga0207676_10471534 3300026095 Bacteria 1187
236 Ga0207675_100011583 3300026118 Bacteria 8247
237 Ga0207675_100052232 3300026118 Bacteria 3814
238 Ga0207675_100304270 3300026118 Bacteria 1553
239 Ga0207683_10176395 3300026121 Bacteria 1937
240 Ga0207698_10001999 3300026142 Bacteria 12012
241 Ga0207698_10012100 3300026142 Bacteria 5630
242 Ga0207428_10018807 3300027907 Bacteria 5895
243 Ga0268266_10003269 3300028379 Bacteria 16320
244 Ga0268266_10007513 3300028379 Bacteria 9825
245 Ga0268264_10001142 3300028381 Bacteria 25957
246 Ga0268264_10058733 3300028381 Bacteria 3222
247 Ga0307515_10000001 3300028794 Bacteria 4259510
248 Ga0307515_10000009 3300028794 Bacteria 653206
249 Ga0307515_10000031 3300028794 Bacteria 358648
250 Ga0265338_10082886 3300028800 Bacteria 2684
251 Ga0265324_10017953 3300029957 Bacteria 2568
252 Ga0265324_10052402 3300029957 Bacteria 1401
253 Ga0265327_10000006 3300031251 Bacteria 693716
254 Ga0265327_10000013 3300031251 Bacteria 519549
255 Ga0265327_10000031 3300031251 Bacteria 325718
256 Ga0265327_10020520 3300031251 Unclassified 4022
257 Ga0265327_10097920 3300031251 Bacteria 1420
258 Ga0307509_10041771 3300031507 Bacteria 4973
259 Ga0307514_10077542 3300031649 Bacteria 2471
260 Ga0307416_100122945 3300032002 Bacteria 2318
261 Ga0307414_10011328 3300032004 Bacteria 5225
262 Ga0373935_0167359 3300035692 Unclassified 1502
263 Ga0395899_0003522 3300037312 Bacteria 12406
264 Ga0395899_0013608 3300037312 Bacteria 6220
265 Ga0395899_0024569 3300037312 Bacteria 4555
266 Ga0395900_0059521 3300037418 Unclassified 3932
267 Ga0395900_0182293 3300037418 Bacteria 2133
268 Ga0395898_0028571 3300037466 Bacteria 5588
269 Ga0395901_0008197 3300038443 Bacteria 10559
270 Ga0395901_0194298 3300038443 Bacteria 2128
271 Ga0436365_0070052 3300039437 Bacteria 17912
272 Ga0451855_1263871 3300041511 Bacteria 13743
273 Ga0451577_0033941 3300042876 Bacteria 4601
274 Ga0451577_0143863 3300042876 Bacteria 2144
275 Ga0466969_0000207 3300044656 Bacteria 32129
276 Ga0466972_0005916 3300044658 Bacteria 6137
277 Ga0466972_0023256 3300044658 Bacteria 3082
278 Ga0453683_0000119 3300044673 Bacteria 117129
279 Ga0466964_0117760 3300044706 Bacteria 1193
280 Ga0453684_0000322 3300044712 Bacteria 202241
281 Ga0453684_0003205 3300044712 Bacteria 37500
282 Ga0453684_0026224 3300044712 Bacteria 8430
283 Ga0453684_0046652 3300044712 Bacteria 5760
284 Ga0453684_0066038 3300044712 Bacteria 4609
285 Ga0453684_0083074 3300044712 Bacteria 3988
286 Ga0453684_0422047 3300044712 Bacteria 1490
287 Ga0466968_0006094 3300044735 Bacteria 4530
288 Ga0466970_0002827 3300044765 Bacteria 8383
289 Ga0466959_0000236 3300045049 Bacteria 34631
290 Ga0451576_0000195 3300045051 Bacteria 153276
291 Ga0451576_0023402 3300045051 Bacteria 6687
292 Ga0451576_0093657 3300045051 Bacteria 3123
293 Ga0451576_0130072 3300045051 Bacteria 2624
294 Ga0451576_0161351 3300045051 Bacteria 2340
295 Ga0451576_0231268 3300045051 Bacteria 1931
296 Ga0451576_0347073 3300045051 Bacteria 1554
297 Ga0495638_0073843 3300046460 Bacteria 2081
298 Ga0495648_0001692 3300046524 Bacteria 21327
299 Ga0495642_0051725 3300046528 Bacteria 1691
300 Ga0495665_0089261 3300046531 Unclassified 1620
301 Ga0495636_0000003 3300047318 Bacteria 132818
302 Ga0496105_0135159 3300048908 Bacteria 2032
303 Ga0496109_0180534 3300048912 Bacteria 1982
304 Ga0496124_0048279 3300048927 Bacteria 3639
305 Ga0501034_0194784 3300049571 Bacteria 1987
306 Ga0501034_0234855 3300049571 Bacteria 1781
307 Ga0501034_0316690 3300049571 Bacteria 1493
308 Ga0501036_0137198 3300049572 Bacteria 2064
309 Ga0501039_0047584 3300049575 Bacteria 3315
310 Ga0501039_0099133 3300049575 Bacteria 2274
311 Ga0501046_0023808 3300049580 Bacteria 5031
312 Ga0501046_0251513 3300049580 Bacteria 1301
313 Ga0501047_0170632 3300049581 Bacteria 2044
314 Ga0501047_0340339 3300049581 Bacteria 1338
315 Ga0501067_0010190 3300049583 Bacteria 5200
316 Ga0501068_0040017 3300049584 Bacteria 2813
317 Ga0501070_0034138 3300049586 Bacteria 4255
318 Ga0501073_0047846 3300049589 Bacteria 3004
319 Ga0501074_0009776 3300049590 Bacteria 6965
320 Ga0501207_000869 3300049654 Bacteria 3613
321 Ga0501079_0055075 3300049741 Bacteria 3069
322 Ga0501080_0025360 3300049742 Bacteria 5501
323 Ga0501083_0067062 3300049744 Bacteria 2389
324 Ga0501035_0038913 3300049822 Bacteria 4306
325 Ga0501035_0045247 3300049822 Bacteria 3960
326 Ga0501044_0129897 3300049823 Bacteria 2514
327 Ga0501044_0317073 3300049823 Bacteria 1484
328 nmdc:mga0k408_15262_c1 3300050493 Bacteria 4244
329 Ga0495619_0033844 3300053085 Unclassified 3320
330 Ga0500646_0036619 3300053090 Bacteria 1367
331 Ga0500583_0001832 3300053092 Bacteria 6227
332 Ga0500556_0021973 3300053104 Bacteria 2066
333 Ga0500562_000012 3300053108 Bacteria 168210
334 Ga0500642_0009654 3300053130 Bacteria 3362
335 Ga0500588_0004291 3300053146 Bacteria 3079
336 Ga0500616_0013764 3300053153 Unclassified 4678
337 Ga0500622_0000404 3300053156 Bacteria 41279
338 Ga0500622_0002409 3300053156 Bacteria 13517
339 Ga0500627_0014840 3300053158 Bacteria 2995
340 Ga0501084_0164726 3300054114 Bacteria 1871
341 Ga0500661_005712 3300055283 Bacteria 2319

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005618 Ga0068864_100020807 Ga0068864_1000208073 288
2 3300009553 Ga0105249_10005321 Ga0105249_1000532111 288
3 3300013306 Ga0163162_10011167 Ga0163162_1001116712 288
4 3300014325 Ga0163163_10058914 Ga0163163_100589142 288
5 3300014969 Ga0157376_10117332 Ga0157376_101173321 288
6 3300026095 Ga0207676_10471534 Ga0207676_104715341 288
7 3300046528 Ga0495642_0051725 Ga0495642_0051725_90_995 288
8 3300047318 Ga0495636_0000003 Ga0495636_0000003_66444_67349 288
9 3300005338 Ga0068868_100073261 Ga0068868_1000732613 294
10 3300005340 Ga0070689_100128758 Ga0070689_1001287583 294
11 3300005364 Ga0070673_100048435 Ga0070673_1000484355 294
12 3300005459 Ga0068867_100157568 Ga0068867_1001575681 294
13 3300005544 Ga0070686_100058576 Ga0070686_1000585763 294
14 3300005564 Ga0070664_100057516 Ga0070664_1000575162 294
15 3300005841 Ga0068863_100515293 Ga0068863_1005152931 294
16 3300013297 Ga0157378_10070483 Ga0157378_100704833 294
17 3300025901 Ga0207688_10179181 Ga0207688_101791812 294
18 3300025907 Ga0207645_10200384 Ga0207645_102003842 294
19 3300025918 Ga0207662_10023647 Ga0207662_100236473 294
20 3300025937 Ga0207669_10321760 Ga0207669_103217601 294
21 3300025945 Ga0207679_10018708 Ga0207679_100187084 294
22 3300026023 Ga0207677_10152310 Ga0207677_101523102 294
23 3300003316 rootH1_10045052 rootH1_100450523 295
24 3300003322 rootL2_10060842 rootL2_100608428 295
25 3300005718 Ga0068866_10032012 Ga0068866_100320123 295
26 3300009093 Ga0105240_10003002 Ga0105240_100030028 295
27 3300009174 Ga0105241_10239249 Ga0105241_102392492 295
28 3300009545 Ga0105237_10106263 Ga0105237_101062634 295
29 3300009551 Ga0105238_10035260 Ga0105238_100352604 295
30 3300010375 Ga0105239_10000488 Ga0105239_1000048832 295
31 3300025903 Ga0207680_10010100 Ga0207680_100101003 295
32 3300025913 Ga0207695_10001317 Ga0207695_1000131717 295
33 3300025937 Ga0207669_10204111 Ga0207669_102041111 295
34 3300026118 Ga0207675_100304270 Ga0207675_1003042702 295
35 3300032002 Ga0307416_100122945 Ga0307416_1001229452 295
36 3300050493 nmdc:mga0k408_15262_c1 nmdc:mga0k408_15262_c1_1989_2930 295
37 3300053090 Ga0500646_0036619 Ga0500646_0036619_189_1112 295
38 3300029957 Ga0265324_10017953 Ga0265324_100179533 296
39 3300049823 Ga0501044_0129897 Ga0501044_0129897_366_1367 296
40 3300006844 Ga0075428_100009481 Ga0075428_10000948110 299
41 3300027907 Ga0207428_10018807 Ga0207428_100188073 299
42 3300044712 Ga0453684_0422047 Ga0453684_0422047_229_1221 300
43 3300045051 Ga0451576_0161351 Ga0451576_0161351_510_1499 300
44 3300045051 Ga0451576_0347073 Ga0451576_0347073_513_1502 300
45 3300048927 Ga0496124_0048279 Ga0496124_0048279_1113_2105 300
46 3300003322 rootL2_10100629 rootL2_101006292 301
47 3300049654 Ga0501207_000869 Ga0501207_000869_85_1074 302
48 3300053158 Ga0500627_0014840 Ga0500627_0014840_383_1387 302
49 3300013306 Ga0163162_10013259 Ga0163162_100132595 303
50 3300031251 Ga0265327_10000031 Ga0265327_10000031159 303
51 3300049572 Ga0501036_0137198 Ga0501036_0137198_1059_2054 303
52 3300049580 Ga0501046_0251513 Ga0501046_0251513_246_1241 303
53 3300005843 Ga0068860_100078567 Ga0068860_1000785672 304
54 3300049575 Ga0501039_0099133 Ga0501039_0099133_578_1573 304
55 3300049822 Ga0501035_0045247 Ga0501035_0045247_331_1326 304
56 3300049823 Ga0501044_0317073 Ga0501044_0317073_464_1459 304
57 3300028794 Ga0307515_10000031 Ga0307515_1000003113 305
58 3300013307 Ga0157372_10511532 Ga0157372_105115322 306
59 3300042876 Ga0451577_0033941 Ga0451577_0033941_10_1002 308
60 3300044712 Ga0453684_0003205 Ga0453684_0003205_11176_12168 308
61 3300045051 Ga0451576_0023402 Ga0451576_0023402_1080_2072 308
62 3300013296 Ga0157374_10057151 Ga0157374_100571512 309
63 3300013306 Ga0163162_10000359 Ga0163162_100003595 309
64 3300044712 Ga0453684_0046652 Ga0453684_0046652_3033_4022 309
65 3300045051 Ga0451576_0130072 Ga0451576_0130072_753_1742 309
66 3300044712 Ga0453684_0066038 Ga0453684_0066038_12_992 310
67 3300044712 Ga0453684_0083074 Ga0453684_0083074_2997_3977 310
68 3300044712 Ga0453684_0026224 Ga0453684_0026224_3555_4547 311
69 3300044673 Ga0453683_0000119 Ga0453683_0000119_114034_115056 312
70 3300044712 Ga0453684_0000322 Ga0453684_0000322_133714_134736 312
71 3300045051 Ga0451576_0000195 Ga0451576_0000195_18541_19563 312
72 3300049571 Ga0501034_0194784 Ga0501034_0194784_122_1123 312
73 3300005334 Ga0068869_100042923 Ga0068869_1000429232 313
74 3300005335 Ga0070666_10000064 Ga0070666_1000006458 313
75 3300005347 Ga0070668_100189505 Ga0070668_1001895052 313
76 3300005355 Ga0070671_100091215 Ga0070671_1000912152 313
77 3300005365 Ga0070688_100067129 Ga0070688_1000671291 313
78 3300005543 Ga0070672_100069121 Ga0070672_1000691212 313
79 3300005617 Ga0068859_100000003 Ga0068859_100000003142 313
80 3300005618 Ga0068864_100005189 Ga0068864_10000518913 313
81 3300005834 Ga0068851_10042627 Ga0068851_100426272 313
82 3300005841 Ga0068863_100001446 Ga0068863_1000014468 313
83 3300005842 Ga0068858_100002928 Ga0068858_1000029282 313
84 3300005843 Ga0068860_100006378 Ga0068860_10000637813 313
85 3300006358 Ga0068871_100082942 Ga0068871_1000829422 313
86 3300006931 Ga0097620_100000003 Ga0097620_100000003142 313
87 3300009101 Ga0105247_10002345 Ga0105247_100023454 313
88 3300009545 Ga0105237_10005614 Ga0105237_1000561412 313
89 3300009553 Ga0105249_10018347 Ga0105249_100183474 313
90 3300013306 Ga0163162_10004389 Ga0163162_1000438911 313
91 3300013308 Ga0157375_10067619 Ga0157375_100676195 313
92 3300014325 Ga0163163_10016566 Ga0163163_100165662 313
93 3300014968 Ga0157379_10115788 Ga0157379_101157882 313
94 3300025903 Ga0207680_10000463 Ga0207680_100004632 313
95 3300025914 Ga0207671_10001848 Ga0207671_100018485 313
96 3300025931 Ga0207644_10151608 Ga0207644_101516081 313
97 3300025940 Ga0207691_10134594 Ga0207691_101345941 313
98 3300025942 Ga0207689_10012742 Ga0207689_100127425 313
99 3300025961 Ga0207712_10121490 Ga0207712_101214903 313
100 3300026035 Ga0207703_10007084 Ga0207703_1000708413 313
101 3300026088 Ga0207641_10000026 Ga0207641_10000026128 313
102 3300026095 Ga0207676_10020492 Ga0207676_100204922 313
103 3300026142 Ga0207698_10001999 Ga0207698_1000199911 313
104 3300028381 Ga0268264_10001142 Ga0268264_1000114220 313
105 3300046531 Ga0495665_0089261 Ga0495665_0089261_136_1140 313
106 3300053085 Ga0495619_0033844 Ga0495619_0033844_1236_2240 313
107 3300009176 Ga0105242_10043154 Ga0105242_100431542 314
108 3300011119 Ga0105246_10090751 Ga0105246_100907513 314
109 3300035692 Ga0373935_0167359 Ga0373935_0167359_185_1189 314
110 3300005563 Ga0068855_100009549 Ga0068855_1000095495 316
111 3300013102 Ga0157371_10000654 Ga0157371_1000065418 316
112 3300013104 Ga0157370_10003750 Ga0157370_100037507 316
113 3300013307 Ga0157372_10005321 Ga0157372_100053218 316
114 3300037312 Ga0395899_0024569 Ga0395899_0024569_519_1505 316
115 3300037418 Ga0395900_0059521 Ga0395900_0059521_578_1564 316
116 3300037466 Ga0395898_0028571 Ga0395898_0028571_1155_2141 316
117 3300038443 Ga0395901_0008197 Ga0395901_0008197_6126_7112 316
118 3300003354 JGI25160J50197_1005456 JGI25160J50197_10054563 317
119 3300005327 Ga0070658_10148931 Ga0070658_101489312 317
120 3300005336 Ga0070680_100183931 Ga0070680_1001839312 317
121 3300005458 Ga0070681_10064250 Ga0070681_100642502 317
122 3300005530 Ga0070679_100025584 Ga0070679_1000255841 317
123 3300013102 Ga0157371_10007130 Ga0157371_100071308 317
124 3300013105 Ga0157369_10038639 Ga0157369_100386392 317
125 3300013307 Ga0157372_10020633 Ga0157372_100206336 317
126 3300025304 Ga0209257_1000007 Ga0209257_1000007373 317
127 3300025921 Ga0207652_10000018 Ga0207652_1000001894 317
128 3300026078 Ga0207702_10017623 Ga0207702_100176237 317
129 3300031507 Ga0307509_10041771 Ga0307509_100417714 317
130 3300037312 Ga0395899_0003522 Ga0395899_0003522_6389_7378 317
131 3300053104 Ga0500556_0021973 Ga0500556_0021973_713_1702 317
132 3300053108 Ga0500562_000012 Ga0500562_000012_59027_60019 317
133 3300053153 Ga0500616_0013764 Ga0500616_0013764_1810_2799 317
134 3300053156 Ga0500622_0000404 Ga0500622_0000404_23693_24685 317
135 3300055283 Ga0500661_005712 Ga0500661_005712_993_1985 317
136 3300021384 Ga0213876_10017067 Ga0213876_100170674 318
137 3300031251 Ga0265327_10020520 Ga0265327_100205206 318
138 3300032004 Ga0307414_10011328 Ga0307414_100113286 318
139 3300039437 Ga0436365_0070052 Ga0436365_0070052_16018_17016 318
140 3300044658 Ga0466972_0005916 Ga0466972_0005916_1968_2960 318
141 3300044765 Ga0466970_0002827 Ga0466970_0002827_529_1521 318
142 3300045051 Ga0451576_0093657 Ga0451576_0093657_1631_2623 318
143 3300049822 Ga0501035_0038913 Ga0501035_0038913_2030_3025 318
144 3300005330 Ga0070690_100011489 Ga0070690_1000114894 319
145 3300005435 Ga0070714_100212909 Ga0070714_1002129092 319
146 3300005539 Ga0068853_100257738 Ga0068853_1002577382 319
147 3300009093 Ga0105240_10000011 Ga0105240_1000001119 319
148 3300010375 Ga0105239_10001268 Ga0105239_1000126824 319
149 3300013102 Ga0157371_10016206 Ga0157371_100162063 319
150 3300013307 Ga0157372_10141826 Ga0157372_101418262 319
151 3300025904 Ga0207647_10043104 Ga0207647_100431042 319
152 3300025913 Ga0207695_10000010 Ga0207695_10000010407 319
153 3300026041 Ga0207639_10007353 Ga0207639_100073538 319
154 3300028794 Ga0307515_10000009 Ga0307515_1000000972 319
155 3300031649 Ga0307514_10077542 Ga0307514_100775422 319
156 3300037312 Ga0395899_0013608 Ga0395899_0013608_1575_2570 319
157 3300037418 Ga0395900_0182293 Ga0395900_0182293_717_1712 319
158 3300038443 Ga0395901_0194298 Ga0395901_0194298_17_1012 319
159 3300049571 Ga0501034_0316690 Ga0501034_0316690_161_1156 319
160 3300053146 Ga0500588_0004291 Ga0500588_0004291_931_1932 319
161 3300003203 JGI25406J46586_10001527 JGI25406J46586_100015277 320
162 3300003320 rootH2_10056072 rootH2_100560722 320
163 3300003320 rootH2_10148925 rootH2_101489253 320
164 3300005334 Ga0068869_100203872 Ga0068869_1002038721 320
165 3300005543 Ga0070672_100317566 Ga0070672_1003175662 320
166 3300005548 Ga0070665_100000845 Ga0070665_10000084539 320
167 3300005985 Ga0081539_10001794 Ga0081539_1000179422 320
168 3300006237 Ga0097621_100222283 Ga0097621_1002222832 320
169 3300009093 Ga0105240_10077291 Ga0105240_100772914 320
170 3300009545 Ga0105237_10073493 Ga0105237_100734933 320
171 3300010375 Ga0105239_10066603 Ga0105239_100666032 320
172 3300013105 Ga0157369_10044130 Ga0157369_100441301 320
173 3300013306 Ga0163162_10075172 Ga0163162_100751721 320
174 3300017792 Ga0163161_10017470 Ga0163161_100174702 320
175 3300025904 Ga0207647_10001289 Ga0207647_1000128914 320
176 3300025913 Ga0207695_10005055 Ga0207695_100050552 320
177 3300025940 Ga0207691_10023864 Ga0207691_100238642 320
178 3300025942 Ga0207689_10068343 Ga0207689_100683432 320
179 3300028379 Ga0268266_10003269 Ga0268266_100032697 320
180 3300028800 Ga0265338_10082886 Ga0265338_100828863 320
181 3300029957 Ga0265324_10052402 Ga0265324_100524022 320
182 3300031251 Ga0265327_10000006 Ga0265327_10000006401 320
183 3300031251 Ga0265327_10097920 Ga0265327_100979201 320
184 3300041511 Ga0451855_1263871 Ga0451855_1263871_10825_11835 320
185 3300003320 rootH2_10006463 rootH2_1000646311 321
186 3300003354 JGI25160J50197_1003012 JGI25160J50197_10030128 321
187 3300005327 Ga0070658_10000626 Ga0070658_1000062623 321
188 3300005328 Ga0070676_10000167 Ga0070676_1000016713 321
189 3300005328 Ga0070676_10116625 Ga0070676_101166253 321
190 3300005334 Ga0068869_100060371 Ga0068869_1000603714 321
191 3300005334 Ga0068869_100145461 Ga0068869_1001454612 321
192 3300005335 Ga0070666_10046785 Ga0070666_100467853 321
193 3300005335 Ga0070666_10071267 Ga0070666_100712672 321
194 3300005338 Ga0068868_100000280 Ga0068868_10000028028 321
195 3300005338 Ga0068868_100071839 Ga0068868_1000718392 321
196 3300005347 Ga0070668_100000267 Ga0070668_1000002673 321
197 3300005353 Ga0070669_100033600 Ga0070669_1000336003 321
198 3300005367 Ga0070667_100001041 Ga0070667_10000104119 321
199 3300005459 Ga0068867_100008995 Ga0068867_1000089954 321
200 3300005459 Ga0068867_100105862 Ga0068867_1001058621 321
201 3300005471 Ga0070698_100065707 Ga0070698_1000657071 321
202 3300005535 Ga0070684_100010994 Ga0070684_1000109945 321
203 3300005539 Ga0068853_100005441 Ga0068853_1000054416 321
204 3300005539 Ga0068853_100024232 Ga0068853_1000242325 321
205 3300005543 Ga0070672_100000310 Ga0070672_10000031018 321
206 3300005548 Ga0070665_100019827 Ga0070665_1000198273 321
207 3300005563 Ga0068855_100026762 Ga0068855_1000267622 321
208 3300005563 Ga0068855_100030104 Ga0068855_1000301046 321
209 3300005563 Ga0068855_100236281 Ga0068855_1002362812 321
210 3300005564 Ga0070664_100185490 Ga0070664_1001854901 321
211 3300005578 Ga0068854_100032661 Ga0068854_1000326616 321
212 3300005614 Ga0068856_100067002 Ga0068856_1000670025 321
213 3300005616 Ga0068852_100006842 Ga0068852_1000068427 321
214 3300005616 Ga0068852_100077982 Ga0068852_1000779823 321
215 3300005616 Ga0068852_100129118 Ga0068852_1001291183 321
216 3300005718 Ga0068866_10043881 Ga0068866_100438813 321
217 3300005719 Ga0068861_100006132 Ga0068861_1000061323 321
218 3300005719 Ga0068861_100037225 Ga0068861_1000372252 321
219 3300005834 Ga0068851_10001250 Ga0068851_100012508 321
220 3300005841 Ga0068863_100002398 Ga0068863_1000023988 321
221 3300005842 Ga0068858_100002672 Ga0068858_10000267212 321
222 3300005843 Ga0068860_100030292 Ga0068860_1000302924 321
223 3300005843 Ga0068860_100043752 Ga0068860_1000437522 321
224 3300006195 Ga0075366_10004746 Ga0075366_100047465 321
225 3300006237 Ga0097621_100006034 Ga0097621_1000060344 321
226 3300006237 Ga0097621_100013337 Ga0097621_1000133375 321
227 3300006358 Ga0068871_100002911 Ga0068871_10000291110 321
228 3300006358 Ga0068871_100005277 Ga0068871_1000052775 321
229 3300006358 Ga0068871_100025501 Ga0068871_1000255017 321
230 3300006881 Ga0068865_100005619 Ga0068865_1000056195 321
231 3300006881 Ga0068865_100073467 Ga0068865_1000734671 321
232 3300009093 Ga0105240_10005046 Ga0105240_100050462 321
233 3300009093 Ga0105240_10021850 Ga0105240_100218502 321
234 3300009093 Ga0105240_10069171 Ga0105240_100691712 321
235 3300009093 Ga0105240_10162782 Ga0105240_101627822 321
236 3300009101 Ga0105247_10031004 Ga0105247_100310042 321
237 3300009174 Ga0105241_10000543 Ga0105241_1000054311 321
238 3300009177 Ga0105248_10053027 Ga0105248_100530272 321
239 3300009545 Ga0105237_10152972 Ga0105237_101529723 321
240 3300009551 Ga0105238_10047287 Ga0105238_100472873 321
241 3300010375 Ga0105239_10005650 Ga0105239_1000565018 321
242 3300010375 Ga0105239_10098587 Ga0105239_100985872 321
243 3300010375 Ga0105239_10176169 Ga0105239_101761693 321
244 3300010375 Ga0105239_10303194 Ga0105239_103031942 321
245 3300011119 Ga0105246_10050439 Ga0105246_100504393 321
246 3300013100 Ga0157373_10070764 Ga0157373_100707641 321
247 3300013104 Ga0157370_10001484 Ga0157370_100014847 321
248 3300013104 Ga0157370_10093872 Ga0157370_100938724 321
249 3300013296 Ga0157374_10000168 Ga0157374_1000016851 321
250 3300013296 Ga0157374_10069208 Ga0157374_100692083 321
251 3300013306 Ga0163162_10000725 Ga0163162_1000072512 321
252 3300013306 Ga0163162_10001104 Ga0163162_1000110419 321
253 3300013307 Ga0157372_10000747 Ga0157372_100007475 321
254 3300013307 Ga0157372_10005908 Ga0157372_100059085 321
255 3300013307 Ga0157372_10458903 Ga0157372_104589032 321
256 3300013308 Ga0157375_10001148 Ga0157375_1000114815 321
257 3300014325 Ga0163163_10003161 Ga0163163_1000316112 321
258 3300014968 Ga0157379_10000810 Ga0157379_100008106 321
259 3300014968 Ga0157379_10083500 Ga0157379_100835002 321
260 3300014969 Ga0157376_10000827 Ga0157376_1000082716 321
261 3300014969 Ga0157376_10018546 Ga0157376_100185463 321
262 3300017792 Ga0163161_10018033 Ga0163161_100180333 321
263 3300025302 Ga0207426_1000040 Ga0207426_100004059 321
264 3300025321 Ga0207656_10005877 Ga0207656_100058772 321
265 3300025900 Ga0207710_10000732 Ga0207710_1000073218 321
266 3300025903 Ga0207680_10001799 Ga0207680_100017992 321
267 3300025904 Ga0207647_10006031 Ga0207647_100060312 321
268 3300025907 Ga0207645_10003328 Ga0207645_100033287 321
269 3300025909 Ga0207705_10006189 Ga0207705_100061893 321
270 3300025911 Ga0207654_10006451 Ga0207654_100064512 321
271 3300025913 Ga0207695_10002258 Ga0207695_1000225819 321
272 3300025913 Ga0207695_10044020 Ga0207695_100440208 321
273 3300025913 Ga0207695_10044238 Ga0207695_100442382 321
274 3300025913 Ga0207695_10270337 Ga0207695_102703372 321
275 3300025913 Ga0207695_10336055 Ga0207695_103360551 321
276 3300025914 Ga0207671_10003111 Ga0207671_1000311119 321
277 3300025923 Ga0207681_10157479 Ga0207681_101574792 321
278 3300025926 Ga0207659_10179315 Ga0207659_101793152 321
279 3300025934 Ga0207686_10116736 Ga0207686_101167362 321
280 3300025940 Ga0207691_10000234 Ga0207691_1000023432 321
281 3300025942 Ga0207689_10028758 Ga0207689_100287584 321
282 3300025944 Ga0207661_10092746 Ga0207661_100927462 321
283 3300025945 Ga0207679_10106636 Ga0207679_101066362 321
284 3300025949 Ga0207667_10001839 Ga0207667_100018398 321
285 3300025949 Ga0207667_10009289 Ga0207667_100092893 321
286 3300025949 Ga0207667_10208901 Ga0207667_102089012 321
287 3300025961 Ga0207712_10009401 Ga0207712_100094014 321
288 3300025972 Ga0207668_10002523 Ga0207668_100025233 321
289 3300025986 Ga0207658_10002543 Ga0207658_100025437 321
290 3300026023 Ga0207677_10048063 Ga0207677_100480633 321
291 3300026035 Ga0207703_10049840 Ga0207703_100498402 321
292 3300026041 Ga0207639_10005013 Ga0207639_100050133 321
293 3300026041 Ga0207639_10133876 Ga0207639_101338761 321
294 3300026041 Ga0207639_10300080 Ga0207639_103000801 321
295 3300026088 Ga0207641_10016086 Ga0207641_100160863 321
296 3300026089 Ga0207648_10009688 Ga0207648_100096882 321
297 3300026095 Ga0207676_10007131 Ga0207676_100071315 321
298 3300026118 Ga0207675_100011583 Ga0207675_1000115833 321
299 3300026118 Ga0207675_100052232 Ga0207675_1000522322 321
300 3300026121 Ga0207683_10176395 Ga0207683_101763952 321
301 3300026142 Ga0207698_10012100 Ga0207698_100121003 321
302 3300028379 Ga0268266_10007513 Ga0268266_100075133 321
303 3300028381 Ga0268264_10058733 Ga0268264_100587332 321
304 3300042876 Ga0451577_0143863 Ga0451577_0143863_977_1987 321
305 3300044656 Ga0466969_0000207 Ga0466969_0000207_3515_4528 321
306 3300044658 Ga0466972_0023256 Ga0466972_0023256_422_1423 321
307 3300044706 Ga0466964_0117760 Ga0466964_0117760_29_1042 321
308 3300044735 Ga0466968_0006094 Ga0466968_0006094_1751_2752 321
309 3300045049 Ga0466959_0000236 Ga0466959_0000236_20618_21631 321
310 3300045051 Ga0451576_0231268 Ga0451576_0231268_461_1585 321
311 3300046460 Ga0495638_0073843 Ga0495638_0073843_908_1915 321
312 3300046524 Ga0495648_0001692 Ga0495648_0001692_1976_2983 321
313 3300048908 Ga0496105_0135159 Ga0496105_0135159_683_1690 321
314 3300048912 Ga0496109_0180534 Ga0496109_0180534_269_1276 321
315 3300049571 Ga0501034_0234855 Ga0501034_0234855_65_1093 321
316 3300049575 Ga0501039_0047584 Ga0501039_0047584_437_1438 321
317 3300049580 Ga0501046_0023808 Ga0501046_0023808_890_1891 321
318 3300049581 Ga0501047_0170632 Ga0501047_0170632_725_1726 321
319 3300049581 Ga0501047_0340339 Ga0501047_0340339_101_1102 321
320 3300049583 Ga0501067_0010190 Ga0501067_0010190_1827_2855 321
321 3300049584 Ga0501068_0040017 Ga0501068_0040017_1336_2337 321
322 3300049586 Ga0501070_0034138 Ga0501070_0034138_1583_2584 321
323 3300049589 Ga0501073_0047846 Ga0501073_0047846_1028_2056 321
324 3300049590 Ga0501074_0009776 Ga0501074_0009776_3928_4929 321
325 3300049741 Ga0501079_0055075 Ga0501079_0055075_569_1597 321
326 3300049742 Ga0501080_0025360 Ga0501080_0025360_3831_4832 321
327 3300049744 Ga0501083_0067062 Ga0501083_0067062_477_1505 321
328 3300053092 Ga0500583_0001832 Ga0500583_0001832_3179_4186 321
329 3300053130 Ga0500642_0009654 Ga0500642_0009654_880_1887 321
330 3300053156 Ga0500622_0002409 Ga0500622_0002409_8920_9927 321
331 3300054114 Ga0501084_0164726 Ga0501084_0164726_824_1825 321
332 3300005337 Ga0070682_100000041 Ga0070682_10000004171 322
333 3300005288 Ga0065714_10073881 Ga0065714_100738812 324
334 3300005617 Ga0068859_100000872 Ga0068859_10000087219 324
335 3300006931 Ga0097620_100000872 Ga0097620_10000087219 324
336 3300013306 Ga0163162_10253849 Ga0163162_102538492 324
337 3300025925 Ga0207650_10342080 Ga0207650_103420802 324
338 3300028794 Ga0307515_10000001 Ga0307515_100000012490 324
339 3300031251 Ga0265327_10000013 Ga0265327_10000013349 324
340 3300013100 Ga0157373_10149794 Ga0157373_101497942 327
341 iso_pu_bacteria 2884634485 2884636180 327
342 2162886007 SwRhRL2b_contig_1663676 SwRhRL2b_0150.00001730 329

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01018

GTP1_OBG

GTP1/OBG

7

151

0.97

PF01926

MMR_HSR1

50S ribosome-binding GTPase

154

274

0.89

PF02421

FeoB_N

Ferrous iron transport protein B

153

314

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
7of7-assembly1.cif.gz_x structure of a human mitochondrial ribosome large subunit assembly intermediate in complex with mterf4-nsun4 and gtpbp5 (dataset1). 0.8218 9 155
7of7-assembly1.cif.gz_x structure of a human mitochondrial ribosome large subunit assembly intermediate in complex with mterf4-nsun4 and gtpbp5 (dataset1). 0.8118 9 155
3gee-assembly1.cif.gz_A-2 crystal structure of mnme from chlorobium tepidum in complex with gdp and folinic acid 0.7327 161 329
3gei-assembly2.cif.gz_B crystal structure of mnme from chlorobium tepidum in complex with gcp 0.732 161 326
3gei-assembly1.cif.gz_A-2 crystal structure of mnme from chlorobium tepidum in complex with gcp 0.7207 161 329
ID Description Score Start End Superfamily
af_P9WMT1_2_158_2.70.210.12 Mainly Beta;Distorted Sandwich;Spo0b-associated Gtp-binding Protein; Chain: A,;GTP1/OBG domain 0.8785 4 157 2.70.210.12
af_Q4CQ87_40_200_2.70.210.12 Mainly Beta;Distorted Sandwich;Spo0b-associated Gtp-binding Protein; Chain: A,;GTP1/OBG domain 0.8721 6 157 2.70.210.12
5m04A02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8709 158 326 3.40.50.300
1lnzB02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8657 158 324 3.40.50.300
1lnzB01 Mainly Beta;Distorted Sandwich;Spo0b-associated Gtp-binding Protein; Chain: A,;GTP1/OBG domain 0.8641 6 157 2.70.210.12
ID Description Score Start End GO Terms
AF-A0A355UF75-F1-model_v4 GTPase ObgE 0.9044 230 329 GO:0003924
GO:0005525
AF-A0A800H9P2-F1-model_v4 GTPase ObgE 0.8986 6 159 GO:0003924
GO:0005525
GO:0042254
AF-A0A7C4NJ91-F1-model_v4 GTPase ObgE 0.8973 12 126 GO:0003924
GO:0005525
GO:0042254
AF-A0A257W944-F1-model_v4 GTPase ObgE 0.897 4 102 GO:0003924
GO:0005525
GO:0042254
AF-A0A2E0DSC6-F1-model_v4 GTPase ObgE 0.8956 6 155 GO:0003924
GO:0005525
GO:0042254

Feature Viewer

pLDDT pTM Quality
74.08 0.63 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map