F415154

General Info

Members Datasets Scaffolds Average Seq Length
342 194 684 190

Family's Representative Sequence

Representative Sequence 3300013102|Ga0157371_10035446|Ga0157371_100354462
Length 228
Sequence MLNNLQNKGLMNSLADTCVGTKKRSDIFVPVKHPIMKKLVSTICILSLFTCLHAQTQASLKLKLPVLDKSPMDMAYFPSDYPVLKIQDKASDPLVARIIYSRPQKDGRVLFGELIEYNTVWRLGANEATEIEFFKDVKIGGKKLLKGRYTMYAIPTPAQWTIIFNKDTDIWGAFKYDEKKDVLRVTVPVQKTASVAEIFSMHFNKTSTGADLIMAWDDVSVSLPVSLK

Samples

Sample ID Description Type Environment
1 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
22 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
23 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
24 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
27 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
28 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
29 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
30 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
31 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
32 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
33 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
34 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
35 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
36 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
37 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
38 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
39 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
40 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
41 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
42 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
43 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
44 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
45 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
46 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
47 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
48 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
49 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
50 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
51 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
52 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
53 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
55 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
56 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
57 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
58 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
59 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
60 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
62 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
64 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
65 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
66 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
67 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
68 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
69 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
70 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
71 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
72 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
73 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
74 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
75 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
76 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
77 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
78 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
79 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
80 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
81 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
82 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
124 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
127 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
128 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
129 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
130 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
131 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
132 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
133 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
134 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
135 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
136 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
137 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
138 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
139 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
140 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
141 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
142 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
143 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
144 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
145 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
146 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
147 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
148 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
149 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
150 3300049517 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control Metagenome Rhizosphere
151 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
152 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
153 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
154 3300049650 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought Metagenome Rhizosphere
155 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
156 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
157 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
158 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
159 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
160 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
161 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
162 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
163 3300049666 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A4_B_2_control Metagenome Rhizosphere
164 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
165 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
166 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
167 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
168 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
169 3300049676 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_A_3_control Metagenome Rhizosphere
170 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
171 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
172 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
173 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
174 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
175 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
176 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
177 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
178 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
179 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
180 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
181 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
182 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
183 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
184 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
185 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
186 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
187 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
188 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
189 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
190 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
191 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
192 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
193 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
194 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.58
Nodule 0
Rhizoplane 0.88
Rhizosphere 98.25
Stem 0
Stem Tuber 0
Unclassified 13.45

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157371_10035446 3300013102 Bacteria 3575
2 Ga0065712_10107807 3300005290 Bacteria 1884
3 Ga0065715_10005102 3300005293 Bacteria 9308
4 Ga0070690_100092834 3300005330 Bacteria 1990
5 Ga0070670_100012200 3300005331 Bacteria 7348
6 Ga0070670_100030685 3300005331 Bacteria 4629
7 Ga0070677_10060577 3300005333 Bacteria 1560
8 Ga0070666_10179236 3300005335 Bacteria 1486
9 Ga0070682_100115794 3300005337 Bacteria 1793
10 Ga0068868_100226804 3300005338 Bacteria 1566
11 Ga0070689_100000891 3300005340 Bacteria 18608
12 Ga0070689_100030021 3300005340 Bacteria 4122
13 Ga0070689_100093216 3300005340 Bacteria 2377
14 Ga0070691_10026249 3300005341 Bacteria 2714
15 Ga0070691_10415651 3300005341 Unclassified 761
16 Ga0070687_100063413 3300005343 Bacteria 1960
17 Ga0070661_100151632 3300005344 Bacteria 1752
18 Ga0070669_100139856 3300005353 Bacteria 1865
19 Ga0070675_100271373 3300005354 Bacteria 1489
20 Ga0070675_100626064 3300005354 Unclassified 977
21 Ga0070671_100002278 3300005355 Bacteria 14810
22 Ga0070671_100018153 3300005355 Bacteria 5712
23 Ga0070671_100728410 3300005355 Unclassified 861
24 Ga0070671_100807203 3300005355 Bacteria 817
25 Ga0070674_100106445 3300005356 Unclassified 2052
26 Ga0070674_100234578 3300005356 Bacteria 1434
27 Ga0070673_100058718 3300005364 Bacteria 3043
28 Ga0070673_100232627 3300005364 Bacteria 1599
29 Ga0070688_100079505 3300005365 Bacteria 2118
30 Ga0070667_100011788 3300005367 Bacteria 7225
31 Ga0070667_100301301 3300005367 Unclassified 1443
32 Ga0070667_100503591 3300005367 Unclassified 1110
33 Ga0070710_10129372 3300005437 Bacteria 1537
34 Ga0070711_100492939 3300005439 Bacteria 1009
35 Ga0070700_100094809 3300005441 Bacteria 1955
36 Ga0070700_100103389 3300005441 Bacteria 1881
37 Ga0070678_100039723 3300005456 Bacteria 3323
38 Ga0070678_100124964 3300005456 Bacteria 2035
39 Ga0070678_100136287 3300005456 Bacteria 1958
40 Ga0070678_100444036 3300005456 Bacteria 1135
41 Ga0070662_100706000 3300005457 Bacteria 853
42 Ga0068867_100047397 3300005459 Bacteria 3159
43 Ga0070685_10084901 3300005466 Bacteria 1905
44 Ga0070698_100000061 3300005471 Bacteria 78637
45 Ga0070698_100002300 3300005471 Bacteria 21149
46 Ga0070699_100103610 3300005518 Bacteria 2495
47 Ga0068853_100153059 3300005539 Bacteria 2077
48 Ga0068853_100535565 3300005539 Bacteria 1108
49 Ga0070672_100002751 3300005543 Bacteria 11261
50 Ga0070672_101349711 3300005543 Bacteria 637
51 Ga0070686_100063915 3300005544 Bacteria 2386
52 Ga0070686_100486007 3300005544 Bacteria 956
53 Ga0070696_100262645 3300005546 Bacteria 1310
54 Ga0070693_100662424 3300005547 Unclassified 760
55 Ga0068855_100001457 3300005563 Bacteria 29525
56 Ga0068855_100011897 3300005563 Bacteria 10520
57 Ga0070664_100062339 3300005564 Bacteria 3179
58 Ga0068854_100879568 3300005578 Unclassified 786
59 Ga0070702_100279530 3300005615 Bacteria 1145
60 Ga0068852_100240782 3300005616 Unclassified 1729
61 Ga0068852_100324955 3300005616 Bacteria 1495
62 Ga0068852_100840413 3300005616 Bacteria 933
63 Ga0068859_100001675 3300005617 Bacteria 22555
64 Ga0068859_100106011 3300005617 Bacteria 2870
65 Ga0068859_100242576 3300005617 Bacteria 1891
66 Ga0068859_100407290 3300005617 Unclassified 1456
67 Ga0068864_100257732 3300005618 Bacteria 1621
68 Ga0068864_100260773 3300005618 Bacteria 1612
69 Ga0068866_10382427 3300005718 Bacteria 903
70 Ga0068861_100100020 3300005719 Bacteria 2304
71 Ga0068861_100946787 3300005719 Unclassified 819
72 Ga0068851_10027106 3300005834 Unclassified 2822
73 Ga0068851_10088939 3300005834 Bacteria 1624
74 Ga0068870_10014686 3300005840 Bacteria 3703
75 Ga0068863_100013725 3300005841 Bacteria 7811
76 Ga0068863_100057812 3300005841 Unclassified 3670
77 Ga0068863_100128814 3300005841 Bacteria 2415
78 Ga0068858_100212041 3300005842 Unclassified 1833
79 Ga0068858_100289165 3300005842 Bacteria 1562
80 Ga0068860_100580516 3300005843 Bacteria 1125
81 Ga0068860_101263686 3300005843 Bacteria 759
82 Ga0068862_101220175 3300005844 Unclassified 751
83 Ga0081540_1032178 3300005983 Bacteria 2868
84 Ga0070715_10006016 3300006163 Bacteria 4093
85 Ga0075427_10066822 3300006194 Bacteria 636
86 Ga0097621_100005241 3300006237 Bacteria 9119
87 Ga0097621_100039202 3300006237 Unclassified 3804
88 Ga0097621_100529648 3300006237 Bacteria 1070
89 Ga0068871_100000044 3300006358 Bacteria 67105
90 Ga0068871_100010488 3300006358 Bacteria 6765
91 Ga0068871_100061312 3300006358 Unclassified 3071
92 Ga0075428_100024184 3300006844 Bacteria 6719
93 Ga0075428_100088067 3300006844 Bacteria 3386
94 Ga0075430_100003973 3300006846 Bacteria 12467
95 Ga0075431_100004943 3300006847 Bacteria 13124
96 Ga0075429_100143571 3300006880 Bacteria 2089
97 Ga0068865_100030291 3300006881 Bacteria 3599
98 Ga0068865_100079611 3300006881 Bacteria 2348
99 Ga0068865_100230861 3300006881 Bacteria 1452
100 Ga0097620_100001675 3300006931 Bacteria 22555
101 Ga0097620_100106009 3300006931 Bacteria 2870
102 Ga0097620_100242606 3300006931 Bacteria 1891
103 Ga0097620_100407307 3300006931 Unclassified 1456
104 Ga0105240_10001677 3300009093 Bacteria 37580
105 Ga0105240_10004733 3300009093 Bacteria 20543
106 Ga0111539_10161933 3300009094 Bacteria 2617
107 Ga0111539_11187672 3300009094 Bacteria 886
108 Ga0105247_10028860 3300009101 Bacteria 3358
109 Ga0105247_10495727 3300009101 Bacteria 889
110 Ga0105248_10184333 3300009177 Bacteria 2352
111 Ga0105237_10001806 3300009545 Bacteria 27618
112 Ga0105237_10045871 3300009545 Bacteria 4398
113 Ga0105237_10286404 3300009545 Bacteria 1650
114 Ga0105238_10083207 3300009551 Bacteria 3190
115 Ga0105238_10357296 3300009551 Bacteria 1450
116 Ga0105249_10004813 3300009553 Bacteria 11650
117 Ga0105249_10093454 3300009553 Unclassified 2817
118 Ga0105249_10295080 3300009553 Bacteria 1624
119 Ga0105249_11287266 3300009553 Bacteria 802
120 Ga0105239_10000019 3300010375 Bacteria 273836
121 Ga0105239_10048236 3300010375 Bacteria 4670
122 Ga0157373_10156814 3300013100 Bacteria 1601
123 Ga0157371_10126274 3300013102 Bacteria 1819
124 Ga0157371_10230221 3300013102 Bacteria 1332
125 Ga0157370_10033562 3300013104 Bacteria 5004
126 Ga0157370_10129688 3300013104 Unclassified 2352
127 Ga0157370_10639078 3300013104 Bacteria 973
128 Ga0157369_10417018 3300013105 Bacteria 1392
129 Ga0157378_10008204 3300013297 Bacteria 9106
130 Ga0157378_10020983 3300013297 Bacteria 5748
131 Ga0157378_10058496 3300013297 Unclassified 3438
132 Ga0163162_10000154 3300013306 Bacteria 63581
133 Ga0163162_10001235 3300013306 Bacteria 23886
134 Ga0163162_10226361 3300013306 Bacteria 2000
135 Ga0163162_10590529 3300013306 Bacteria 1237
136 Ga0163162_10595848 3300013306 Bacteria 1232
137 Ga0163162_10823379 3300013306 Bacteria 1045
138 Ga0157372_10002803 3300013307 Bacteria 18830
139 Ga0157372_10012535 3300013307 Bacteria 9030
140 Ga0157372_10097674 3300013307 Bacteria 3350
141 Ga0157372_10098508 3300013307 Bacteria 3336
142 Ga0157372_10129300 3300013307 Unclassified 2905
143 Ga0157372_10222801 3300013307 Bacteria 2186
144 Ga0157372_10312132 3300013307 Unclassified 1830
145 Ga0157372_10375563 3300013307 Bacteria 1657
146 Ga0157375_10000212 3300013308 Bacteria 54441
147 Ga0157375_10167717 3300013308 Bacteria 2341
148 Ga0157375_10203829 3300013308 Bacteria 2134
149 Ga0157375_10289101 3300013308 Bacteria 1802
150 Ga0157375_10310739 3300013308 Bacteria 1740
151 Ga0157375_10890773 3300013308 Bacteria 1034
152 Ga0163163_10070101 3300014325 Bacteria 3491
153 Ga0163163_10845648 3300014325 Bacteria 978
154 Ga0163163_11031748 3300014325 Bacteria 886
155 Ga0157380_10012727 3300014326 Bacteria 6110
156 Ga0157380_10203805 3300014326 Bacteria 1757
157 Ga0157380_10729081 3300014326 Bacteria 1000
158 Ga0157377_10022512 3300014745 Bacteria 3328
159 Ga0157379_10010342 3300014968 Bacteria 8127
160 Ga0157379_10668414 3300014968 Bacteria 973
161 Ga0157376_10001232 3300014969 Bacteria 16867
162 Ga0157376_10098057 3300014969 Bacteria 2554
163 Ga0157376_10510124 3300014969 Unclassified 1183
164 Ga0157376_10703008 3300014969 Bacteria 1016
165 Ga0163161_10007451 3300017792 Bacteria 7561
166 Ga0163161_10228643 3300017792 Bacteria 1443
167 Ga0207697_10033524 3300025315 Unclassified 2101
168 Ga0207656_10110777 3300025321 Bacteria 1268
169 Ga0207656_10198436 3300025321 Bacteria 968
170 Ga0207682_10032269 3300025893 Bacteria 2105
171 Ga0207710_10204397 3300025900 Bacteria 976
172 Ga0207680_10171457 3300025903 Bacteria 1462
173 Ga0207680_10246885 3300025903 Unclassified 1232
174 Ga0207680_10623662 3300025903 Bacteria 771
175 Ga0207647_10010009 3300025904 Bacteria 6714
176 Ga0207647_10100598 3300025904 Bacteria 1716
177 Ga0207685_10158954 3300025905 Bacteria 1030
178 Ga0207643_10012671 3300025908 Bacteria 4555
179 Ga0207684_10346608 3300025910 Bacteria 1279
180 Ga0207707_10556905 3300025912 Unclassified 974
181 Ga0207695_10000087 3300025913 Bacteria 276412
182 Ga0207695_10000582 3300025913 Bacteria 74405
183 Ga0207695_10003932 3300025913 Bacteria 20551
184 Ga0207695_10019154 3300025913 Bacteria 7887
185 Ga0207671_10009006 3300025914 Bacteria 8394
186 Ga0207671_10239148 3300025914 Bacteria 1426
187 Ga0207662_10015195 3300025918 Bacteria 4329
188 Ga0207662_10159736 3300025918 Bacteria 1439
189 Ga0207681_10157098 3300025923 Bacteria 1710
190 Ga0207681_10157516 3300025923 Bacteria 1708
191 Ga0207659_10546532 3300025926 Bacteria 984
192 Ga0207659_10678976 3300025926 Bacteria 881
193 Ga0207644_10004140 3300025931 Bacteria 9406
194 Ga0207644_10112798 3300025931 Unclassified 2058
195 Ga0207706_10347463 3300025933 Bacteria 1290
196 Ga0207686_10002888 3300025934 Bacteria 9265
197 Ga0207686_10112026 3300025934 Bacteria 1842
198 Ga0207686_10513299 3300025934 Unclassified 932
199 Ga0207670_10025067 3300025936 Bacteria 3737
200 Ga0207670_10316244 3300025936 Bacteria 1227
201 Ga0207669_10051828 3300025937 Bacteria 2461
202 Ga0207704_10024340 3300025938 Bacteria 3282
203 Ga0207704_10166244 3300025938 Bacteria 1576
204 Ga0207691_10026858 3300025940 Bacteria 5401
205 Ga0207691_10051740 3300025940 Bacteria 3754
206 Ga0207691_10254453 3300025940 Bacteria 1515
207 Ga0207711_10381331 3300025941 Bacteria 1308
208 Ga0207689_10012096 3300025942 Bacteria 7390
209 Ga0207661_10004967 3300025944 Bacteria 9331
210 Ga0207679_10706594 3300025945 Bacteria 915
211 Ga0207667_10001603 3300025949 Bacteria 28431
212 Ga0207667_10017975 3300025949 Bacteria 7945
213 Ga0207667_10912524 3300025949 Bacteria 870
214 Ga0207651_10098238 3300025960 Bacteria 2164
215 Ga0207712_10002618 3300025961 Bacteria 11539
216 Ga0207712_10002937 3300025961 Bacteria 10884
217 Ga0207712_10044762 3300025961 Bacteria 3061
218 Ga0207640_10333513 3300025981 Bacteria 1212
219 Ga0207640_11211665 3300025981 Bacteria 671
220 Ga0207658_10057660 3300025986 Bacteria 2887
221 Ga0207658_10411515 3300025986 Bacteria 1191
222 Ga0207677_10379621 3300026023 Bacteria 1192
223 Ga0207677_10410190 3300026023 Unclassified 1151
224 Ga0207677_10512387 3300026023 Bacteria 1039
225 Ga0207703_10306893 3300026035 Bacteria 1449
226 Ga0207639_10005241 3300026041 Bacteria 8745
227 Ga0207639_10017690 3300026041 Bacteria 5054
228 Ga0207639_10464993 3300026041 Bacteria 1151
229 Ga0207639_10818759 3300026041 Bacteria 868
230 Ga0207708_10082987 3300026075 Bacteria 2464
231 Ga0207708_10413779 3300026075 Bacteria 1117
232 Ga0207708_10661970 3300026075 Bacteria 890
233 Ga0207641_10010642 3300026088 Bacteria 7548
234 Ga0207641_10022121 3300026088 Bacteria 5232
235 Ga0207641_10178303 3300026088 Bacteria 1944
236 Ga0207641_10190339 3300026088 Bacteria 1885
237 Ga0207648_10081492 3300026089 Bacteria 2822
238 Ga0207648_10103278 3300026089 Bacteria 2499
239 Ga0207676_10123473 3300026095 Unclassified 2188
240 Ga0207675_100830094 3300026118 Bacteria 939
241 Ga0207675_100962867 3300026118 Bacteria 871
242 Ga0207683_10032628 3300026121 Bacteria 4524
243 Ga0207683_10033154 3300026121 Bacteria 4485
244 Ga0207683_10330554 3300026121 Bacteria 1397
245 Ga0207683_10742186 3300026121 Bacteria 911
246 Ga0207698_10266053 3300026142 Bacteria 1578
247 Ga0207428_10255050 3300027907 Bacteria 1307
248 Ga0268265_11106508 3300028380 Bacteria 787
249 Ga0268264_10234990 3300028381 Bacteria 1695
250 Ga0268264_10709411 3300028381 Bacteria 1000
251 Ga0268264_11008724 3300028381 Bacteria 839
252 Ga0307516_10003288 3300031730 Bacteria 20916
253 Ga0307413_10046369 3300031824 Bacteria 2584
254 Ga0307410_11125908 3300031852 Unclassified 681
255 Ga0307412_10149620 3300031911 Bacteria 1721
256 Ga0307412_11052082 3300031911 Unclassified 722
257 Ga0307414_10148793 3300032004 Bacteria 1844
258 Ga0307414_10201063 3300032004 Unclassified 1621
259 Ga0307414_10524485 3300032004 Bacteria 1052
260 Ga0307411_10758770 3300032005 Unclassified 850
261 Ga0373955_0198522 3300035172 Bacteria 1194
262 Ga0373937_0113201 3300036401 Bacteria 2525
263 Ga0395905_0011815 3300037471 Bacteria 8429
264 Ga0395905_0123839 3300037471 Unclassified 2431
265 Ga0451789_0504131 3300041443 Bacteria 680
266 Ga0451577_0004197 3300042876 Bacteria 15370
267 Ga0453683_0174626 3300044673 Bacteria 1361
268 Ga0453684_0262116 3300044712 Bacteria 1979
269 Ga0466970_0084875 3300044765 Unclassified 1715
270 Ga0466959_0475638 3300045049 Bacteria 846
271 Ga0495641_0232875 3300046461 Bacteria 827
272 Ga0495668_0000082 3300046616 Bacteria 154982
273 Ga0495634_0336256 3300046642 Unclassified 907
274 Ga0495611_0000215 3300046648 Bacteria 40810
275 Ga0495647_0338426 3300046681 Bacteria 683
276 Ga0495674_0089258 3300047319 Bacteria 2635
277 Ga0495672_0056539 3300047320 Bacteria 2282
278 Ga0495672_0101831 3300047320 Bacteria 1556
279 Ga0496100_0185663 3300048903 Bacteria 1506
280 Ga0496110_0435026 3300048913 Bacteria 1196
281 Ga0501294_001574 3300049517 Bacteria 2273
282 Ga0501296_004714 3300049519 Bacteria 1498
283 Ga0501297_010129 3300049520 Bacteria 1063
284 Ga0501198_000227 3300049649 Bacteria 7267
285 Ga0501198_007416 3300049649 Bacteria 1578
286 Ga0501199_007407 3300049650 Unclassified 1135
287 Ga0501201_000227 3300049651 Bacteria 5035
288 Ga0501201_004375 3300049651 Bacteria 1309
289 Ga0501202_000308 3300049652 Bacteria 6748
290 Ga0501202_000757 3300049652 Bacteria 4846
291 Ga0501206_030200 3300049653 Bacteria 803
292 Ga0501207_001793 3300049654 Bacteria 2722
293 Ga0501207_011289 3300049654 Unclassified 1329
294 Ga0501209_018612 3300049656 Bacteria 1608
295 Ga0501217_003831 3300049661 Bacteria 3059
296 Ga0501217_005874 3300049661 Bacteria 2582
297 Ga0501217_021640 3300049661 Bacteria 1519
298 Ga0501222_000419 3300049662 Bacteria 6413
299 Ga0501224_000820 3300049664 Bacteria 3943
300 Ga0501228_013970 3300049666 Bacteria 843
301 Ga0501233_013242 3300049668 Bacteria 1669
302 Ga0501235_006618 3300049669 Bacteria 2522
303 Ga0501235_008770 3300049669 Bacteria 2206
304 Ga0501235_039911 3300049669 Unclassified 1072
305 Ga0501239_016805 3300049672 Bacteria 867
306 Ga0501239_019755 3300049672 Unclassified 818
307 Ga0501242_000299 3300049674 Bacteria 4058
308 Ga0501242_001271 3300049674 Bacteria 2495
309 Ga0501243_012590 3300049675 Bacteria 1337
310 Ga0501246_009819 3300049676 Bacteria 866
311 Ga0501247_004708 3300049677 Bacteria 1502
312 Ga0501250_000129 3300049680 Bacteria 4127
313 Ga0501251_002617 3300049681 Bacteria 1755
314 Ga0501252_014830 3300049682 Bacteria 967
315 Ga0501253_000617 3300049683 Bacteria 3158
316 Ga0501257_005639 3300049686 Bacteria 2763
317 Ga0501257_045686 3300049686 Bacteria 1083
318 Ga0501259_000396 3300049688 Bacteria 6886
319 Ga0501259_000667 3300049688 Bacteria 5507
320 Ga0501259_019170 3300049688 Bacteria 1202
321 Ga0501221_010944 3300049704 Bacteria 1623
322 Ga0501225_0109516 3300049705 Unclassified 813
323 Ga0501234_006361 3300049707 Bacteria 1847
324 Ga0501234_021940 3300049707 Unclassified 1019
325 Ga0501245_000544 3300049708 Bacteria 4590
326 Ga0501245_001026 3300049708 Bacteria 3588
327 Ga0501262_010762 3300049759 Bacteria 1149
328 Ga0501263_001494 3300049760 Bacteria 2214
329 Ga0501266_000148 3300049763 Bacteria 8914
330 Ga0501268_002653 3300049765 Bacteria 2375
331 Ga0501268_012852 3300049765 Bacteria 1345
332 Ga0501279_011662 3300049775 Bacteria 1191
333 Ga0501280_034943 3300049776 Bacteria 797
334 Ga0501212_007226 3300049851 Unclassified 1517
335 nmdc:mga05p37_113746_c1 3300050507 Bacteria 3327
336 nmdc:mga09592_109921_c1 3300050508 Unclassified 2365
337 nmdc:mga0qj67_63396_c1 3300050509 Bacteria 2939
338 nmdc:mga06r32_203389_c1 3300050510 Bacteria 1968
339 nmdc:mga08y16_75357_c1 3300050511 Bacteria 3517
340 nmdc:mga08y16_781798_c1 3300050511 Bacteria 949
341 Ga0500628_080458 3300053129 Bacteria 833
342 Ga0500588_0019911 3300053146 Bacteria 1792
343 Ga0157371_10035446
344 Ga0065712_10107807
345 Ga0065715_10005102
346 Ga0070690_100092834
347 Ga0070670_100012200
348 Ga0070670_100030685
349 Ga0070677_10060577
350 Ga0070666_10179236
351 Ga0070682_100115794
352 Ga0068868_100226804
353 Ga0070689_100000891
354 Ga0070689_100030021
355 Ga0070689_100093216
356 Ga0070691_10026249
357 Ga0070691_10415651
358 Ga0070687_100063413
359 Ga0070661_100151632
360 Ga0070669_100139856
361 Ga0070675_100271373
362 Ga0070675_100626064
363 Ga0070671_100002278
364 Ga0070671_100018153
365 Ga0070671_100728410
366 Ga0070671_100807203
367 Ga0070674_100106445
368 Ga0070674_100234578
369 Ga0070673_100058718
370 Ga0070673_100232627
371 Ga0070688_100079505
372 Ga0070667_100011788
373 Ga0070667_100301301
374 Ga0070667_100503591
375 Ga0070710_10129372
376 Ga0070711_100492939
377 Ga0070700_100094809
378 Ga0070700_100103389
379 Ga0070678_100039723
380 Ga0070678_100124964
381 Ga0070678_100136287
382 Ga0070678_100444036
383 Ga0070662_100706000
384 Ga0068867_100047397
385 Ga0070685_10084901
386 Ga0070698_100000061
387 Ga0070698_100002300
388 Ga0070699_100103610
389 Ga0068853_100153059
390 Ga0068853_100535565
391 Ga0070672_100002751
392 Ga0070672_101349711
393 Ga0070686_100063915
394 Ga0070686_100486007
395 Ga0070696_100262645
396 Ga0070693_100662424
397 Ga0068855_100001457
398 Ga0068855_100011897
399 Ga0070664_100062339
400 Ga0068854_100879568
401 Ga0070702_100279530
402 Ga0068852_100240782
403 Ga0068852_100324955
404 Ga0068852_100840413
405 Ga0068859_100001675
406 Ga0068859_100106011
407 Ga0068859_100242576
408 Ga0068859_100407290
409 Ga0068864_100257732
410 Ga0068864_100260773
411 Ga0068866_10382427
412 Ga0068861_100100020
413 Ga0068861_100946787
414 Ga0068851_10027106
415 Ga0068851_10088939
416 Ga0068870_10014686
417 Ga0068863_100013725
418 Ga0068863_100057812
419 Ga0068863_100128814
420 Ga0068858_100212041
421 Ga0068858_100289165
422 Ga0068860_100580516
423 Ga0068860_101263686
424 Ga0068862_101220175
425 Ga0081540_1032178
426 Ga0070715_10006016
427 Ga0075427_10066822
428 Ga0097621_100005241
429 Ga0097621_100039202
430 Ga0097621_100529648
431 Ga0068871_100000044
432 Ga0068871_100010488
433 Ga0068871_100061312
434 Ga0075428_100024184
435 Ga0075428_100088067
436 Ga0075430_100003973
437 Ga0075431_100004943
438 Ga0075429_100143571
439 Ga0068865_100030291
440 Ga0068865_100079611
441 Ga0068865_100230861
442 Ga0097620_100001675
443 Ga0097620_100106009
444 Ga0097620_100242606
445 Ga0097620_100407307
446 Ga0105240_10001677
447 Ga0105240_10004733
448 Ga0111539_10161933
449 Ga0111539_11187672
450 Ga0105247_10028860
451 Ga0105247_10495727
452 Ga0105248_10184333
453 Ga0105237_10001806
454 Ga0105237_10045871
455 Ga0105237_10286404
456 Ga0105238_10083207
457 Ga0105238_10357296
458 Ga0105249_10004813
459 Ga0105249_10093454
460 Ga0105249_10295080
461 Ga0105249_11287266
462 Ga0105239_10000019
463 Ga0105239_10048236
464 Ga0157373_10156814
465 Ga0157371_10126274
466 Ga0157371_10230221
467 Ga0157370_10033562
468 Ga0157370_10129688
469 Ga0157370_10639078
470 Ga0157369_10417018
471 Ga0157378_10008204
472 Ga0157378_10020983
473 Ga0157378_10058496
474 Ga0163162_10000154
475 Ga0163162_10001235
476 Ga0163162_10226361
477 Ga0163162_10590529
478 Ga0163162_10595848
479 Ga0163162_10823379
480 Ga0157372_10002803
481 Ga0157372_10012535
482 Ga0157372_10097674
483 Ga0157372_10098508
484 Ga0157372_10129300
485 Ga0157372_10222801
486 Ga0157372_10312132
487 Ga0157372_10375563
488 Ga0157375_10000212
489 Ga0157375_10167717
490 Ga0157375_10203829
491 Ga0157375_10289101
492 Ga0157375_10310739
493 Ga0157375_10890773
494 Ga0163163_10070101
495 Ga0163163_10845648
496 Ga0163163_11031748
497 Ga0157380_10012727
498 Ga0157380_10203805
499 Ga0157380_10729081
500 Ga0157377_10022512
501 Ga0157379_10010342
502 Ga0157379_10668414
503 Ga0157376_10001232
504 Ga0157376_10098057
505 Ga0157376_10510124
506 Ga0157376_10703008
507 Ga0163161_10007451
508 Ga0163161_10228643
509 Ga0207697_10033524
510 Ga0207656_10110777
511 Ga0207656_10198436
512 Ga0207682_10032269
513 Ga0207710_10204397
514 Ga0207680_10171457
515 Ga0207680_10246885
516 Ga0207680_10623662
517 Ga0207647_10010009
518 Ga0207647_10100598
519 Ga0207685_10158954
520 Ga0207643_10012671
521 Ga0207684_10346608
522 Ga0207707_10556905
523 Ga0207695_10000087
524 Ga0207695_10000582
525 Ga0207695_10003932
526 Ga0207695_10019154
527 Ga0207671_10009006
528 Ga0207671_10239148
529 Ga0207662_10015195
530 Ga0207662_10159736
531 Ga0207681_10157098
532 Ga0207681_10157516
533 Ga0207659_10546532
534 Ga0207659_10678976
535 Ga0207644_10004140
536 Ga0207644_10112798
537 Ga0207706_10347463
538 Ga0207686_10002888
539 Ga0207686_10112026
540 Ga0207686_10513299
541 Ga0207670_10025067
542 Ga0207670_10316244
543 Ga0207669_10051828
544 Ga0207704_10024340
545 Ga0207704_10166244
546 Ga0207691_10026858
547 Ga0207691_10051740
548 Ga0207691_10254453
549 Ga0207711_10381331
550 Ga0207689_10012096
551 Ga0207661_10004967
552 Ga0207679_10706594
553 Ga0207667_10001603
554 Ga0207667_10017975
555 Ga0207667_10912524
556 Ga0207651_10098238
557 Ga0207712_10002618
558 Ga0207712_10002937
559 Ga0207712_10044762
560 Ga0207640_10333513
561 Ga0207640_11211665
562 Ga0207658_10057660
563 Ga0207658_10411515
564 Ga0207677_10379621
565 Ga0207677_10410190
566 Ga0207677_10512387
567 Ga0207703_10306893
568 Ga0207639_10005241
569 Ga0207639_10017690
570 Ga0207639_10464993
571 Ga0207639_10818759
572 Ga0207708_10082987
573 Ga0207708_10413779
574 Ga0207708_10661970
575 Ga0207641_10010642
576 Ga0207641_10022121
577 Ga0207641_10178303
578 Ga0207641_10190339
579 Ga0207648_10081492
580 Ga0207648_10103278
581 Ga0207676_10123473
582 Ga0207675_100830094
583 Ga0207675_100962867
584 Ga0207683_10032628
585 Ga0207683_10033154
586 Ga0207683_10330554
587 Ga0207683_10742186
588 Ga0207698_10266053
589 Ga0207428_10255050
590 Ga0268265_11106508
591 Ga0268264_10234990
592 Ga0268264_10709411
593 Ga0268264_11008724
594 Ga0307516_10003288
595 Ga0307413_10046369
596 Ga0307410_11125908
597 Ga0307412_10149620
598 Ga0307412_11052082
599 Ga0307414_10148793
600 Ga0307414_10201063
601 Ga0307414_10524485
602 Ga0307411_10758770
603 Ga0373955_0198522
604 Ga0373937_0113201
605 Ga0395905_0011815
606 Ga0395905_0123839
607 Ga0451789_0504131
608 Ga0451577_0004197
609 Ga0453683_0174626
610 Ga0453684_0262116
611 Ga0466970_0084875
612 Ga0466959_0475638
613 Ga0495641_0232875
614 Ga0495668_0000082
615 Ga0495634_0336256
616 Ga0495611_0000215
617 Ga0495647_0338426
618 Ga0495674_0089258
619 Ga0495672_0056539
620 Ga0495672_0101831
621 Ga0496100_0185663
622 Ga0496110_0435026
623 Ga0501294_001574
624 Ga0501296_004714
625 Ga0501297_010129
626 Ga0501198_000227
627 Ga0501198_007416
628 Ga0501199_007407
629 Ga0501201_000227
630 Ga0501201_004375
631 Ga0501202_000308
632 Ga0501202_000757
633 Ga0501206_030200
634 Ga0501207_001793
635 Ga0501207_011289
636 Ga0501209_018612
637 Ga0501217_003831
638 Ga0501217_005874
639 Ga0501217_021640
640 Ga0501222_000419
641 Ga0501224_000820
642 Ga0501228_013970
643 Ga0501233_013242
644 Ga0501235_006618
645 Ga0501235_008770
646 Ga0501235_039911
647 Ga0501239_016805
648 Ga0501239_019755
649 Ga0501242_000299
650 Ga0501242_001271
651 Ga0501243_012590
652 Ga0501246_009819
653 Ga0501247_004708
654 Ga0501250_000129
655 Ga0501251_002617
656 Ga0501252_014830
657 Ga0501253_000617
658 Ga0501257_005639
659 Ga0501257_045686
660 Ga0501259_000396
661 Ga0501259_000667
662 Ga0501259_019170
663 Ga0501221_010944
664 Ga0501225_0109516
665 Ga0501234_006361
666 Ga0501234_021940
667 Ga0501245_000544
668 Ga0501245_001026
669 Ga0501262_010762
670 Ga0501263_001494
671 Ga0501266_000148
672 Ga0501268_002653
673 Ga0501268_012852
674 Ga0501279_011662
675 Ga0501280_034943
676 Ga0501212_007226
677 nmdc:mga05p37_113746_c1
678 nmdc:mga09592_109921_c1
679 nmdc:mga0qj67_63396_c1
680 nmdc:mga06r32_203389_c1
681 nmdc:mga08y16_75357_c1
682 nmdc:mga08y16_781798_c1
683 Ga0500628_080458
684 Ga0500588_0019911

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF11138

DUF2911

Protein of unknown function (DUF2911)

84

225

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
2weu-assembly2.cif.gz_A error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.729 149 186
2weu-assembly1.cif.gz_D error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.7283 149 186
2wet-assembly2.cif.gz_B error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.7154 149 186
6frl-assembly1.cif.gz_B brvh, a flavin-dependent halogenase from brevundimonas sp. bal3 0.6797 149 186
2vx8-assembly5.cif.gz_D vamp7 longin domain hrb peptide complex 0.6082 153 186
ID Description Score Start End Superfamily
af_K7L4D0_610_722_2.30.29.30 Mainly Beta;Roll;PH-domain like;Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 0.8282 149 186 2.30.29.30
5uaoD00 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.7354 160 186 3.50.50.60
af_Q54DY3_5_86_3.30.450.30 Alpha Beta;2-Layer Sandwich;Beta-Lactamase;Dynein light chain 2a, cytoplasmic 0.7143 161 184 3.30.450.30
af_P53318_26_290_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.702 147 186 3.50.50.60
af_Q9Y2Z9_35_331_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.6987 147 186 3.50.50.60
ID Description Score Start End GO Terms
AF-A0A519IW15-F1-model_v4 deleted 0.9665 65 187
AF-A0A520ARS2-F1-model_v4 DUF2911 domain-containing protein 0.9618 51 187
AF-A0A3M1PE90-F1-model_v4 DUF2911 domain-containing protein 0.9525 56 186
AF-A0A7W1C1U5-F1-model_v4 DUF2911 domain-containing protein 0.9516 56 186
AF-A0A7Y2EKU2-F1-model_v4 DUF2911 domain-containing protein 0.9505 56 186

Map