F415068

General Info

Members Datasets Scaffolds Average Seq Length
342 171 684 255

Family's Representative Sequence

Representative Sequence 3300005445|Ga0070708_100033307|Ga0070708_1000333076
Length 306
Sequence MLCLELFNTAVGNYVEKQERILVSNSLADASAPCTHSVAGTFVVFAAPKIAGGSGNALKVRLDKLVLQRGMAASRERAQALILAGKVLVDGQKIEKAGTSVDAEADLRVLGEGLKYVSRGGLKLERALEHWHIDVAGKVCLDVGASTGGFTDCLLQQGAARVIAVDTGHGQINFRLRRDPRVRLLEKTNARYLSREQVGEIVDLVVMDVSFISATLILPAVLAASFPESPKERHGRQVVVLVKPQFEVGREQVGKGGIVRDPAAQTAAVEKVRQTLLAHNCIRTDVIESPILGAEGNREFLLYGDL

Samples

Sample ID Description Type Environment
1 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
13 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
14 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
15 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
16 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
17 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
18 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
19 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
20 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
21 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
22 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
23 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
24 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
25 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
26 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
27 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
28 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
29 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
30 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
31 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
32 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
33 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
34 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
35 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
36 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
37 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
38 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
39 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
40 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
41 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
42 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
43 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
44 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
45 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
46 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
47 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
48 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
49 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
50 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
51 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
53 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
54 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
55 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
56 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
57 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
58 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
60 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
61 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
62 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
63 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
65 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
66 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
67 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
68 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
69 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
70 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
71 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
72 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
73 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
74 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
75 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
76 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
77 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
78 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
79 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
80 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
81 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
82 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
83 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
84 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
85 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
86 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
129 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
132 3300030879 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
133 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
134 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
135 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
136 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
137 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
138 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
139 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
140 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
141 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
142 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
143 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
144 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
145 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
146 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
147 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
148 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
149 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
150 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
151 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
152 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
153 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
154 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
155 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
156 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
157 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
158 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
159 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
160 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
161 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
162 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
163 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
164 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
165 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
166 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
167 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
168 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
169 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
170 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
171 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.83
Metatranscriptomes 1.17
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.75
Rhizosphere 97.95
Stem 0
Stem Tuber 0
Unclassified 13.16

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070708_100033307 3300005445 Bacteria 4477
2 Ga0070658_10088830 3300005327 Bacteria 2544
3 Ga0070658_10110266 3300005327 Bacteria 2279
4 Ga0070683_100049748 3300005329 Bacteria 3878
5 Ga0070683_100067771 3300005329 Bacteria 3324
6 Ga0070683_100246790 3300005329 Unclassified 1698
7 Ga0070690_100076699 3300005330 Bacteria 2181
8 Ga0070690_100187806 3300005330 Unclassified 1431
9 Ga0070670_100004602 3300005331 Bacteria 11572
10 Ga0068869_100027568 3300005334 Bacteria 3962
11 Ga0068869_100081173 3300005334 Unclassified 2421
12 Ga0068869_100625537 3300005334 Unclassified 912
13 Ga0070680_100073389 3300005336 Bacteria 2814
14 Ga0068868_100003927 3300005338 Bacteria 10388
15 Ga0068868_100004173 3300005338 Bacteria 10102
16 Ga0068868_100005772 3300005338 Bacteria 8719
17 Ga0070660_100016834 3300005339 Bacteria 5317
18 Ga0070660_100094432 3300005339 Bacteria 2363
19 Ga0070660_100290530 3300005339 Bacteria 1339
20 Ga0070691_10186187 3300005341 Unclassified 1083
21 Ga0070661_100114945 3300005344 Bacteria 2012
22 Ga0070673_100012032 3300005364 Bacteria 5928
23 Ga0070659_100240826 3300005366 Unclassified 1497
24 Ga0070709_10036552 3300005434 Bacteria 2993
25 Ga0070709_10069784 3300005434 Bacteria 2264
26 Ga0070709_10156883 3300005434 Bacteria 1578
27 Ga0070714_100000027 3300005435 Bacteria 141750
28 Ga0070714_100247886 3300005435 Bacteria 1646
29 Ga0070714_100291152 3300005435 Unclassified 1520
30 Ga0070713_100382643 3300005436 Bacteria 1311
31 Ga0070710_10087001 3300005437 Bacteria 1836
32 Ga0070711_100023104 3300005439 Bacteria 4040
33 Ga0070711_100038570 3300005439 Bacteria 3213
34 Ga0070711_100347820 3300005439 Unclassified 1191
35 Ga0070708_100243779 3300005445 Bacteria 1688
36 Ga0070678_100122592 3300005456 Bacteria 2052
37 Ga0070681_10000371 3300005458 Bacteria 36201
38 Ga0070681_10090487 3300005458 Bacteria 3011
39 Ga0070681_10142096 3300005458 Bacteria 2330
40 Ga0070681_10163487 3300005458 Bacteria 2149
41 Ga0070681_10208350 3300005458 Unclassified 1871
42 Ga0068867_100016192 3300005459 Bacteria 5295
43 Ga0068867_100295696 3300005459 Unclassified 1333
44 Ga0070706_100024824 3300005467 Bacteria 5518
45 Ga0070706_100120783 3300005467 Bacteria 2443
46 Ga0070706_100240535 3300005467 Bacteria 1690
47 Ga0070707_100018159 3300005468 Bacteria 6619
48 Ga0070707_100092570 3300005468 Bacteria 2927
49 Ga0070707_100150063 3300005468 Bacteria 2269
50 Ga0070707_100313898 3300005468 Bacteria 1523
51 Ga0070707_100483389 3300005468 Unclassified 1200
52 Ga0070698_100079841 3300005471 Bacteria 3267
53 Ga0070699_100093641 3300005518 Bacteria 2629
54 Ga0070679_100023245 3300005530 Bacteria 6065
55 Ga0070679_100062759 3300005530 Bacteria 3704
56 Ga0070679_100100676 3300005530 Bacteria 2875
57 Ga0070679_100228822 3300005530 Unclassified 1819
58 Ga0070679_100447996 3300005530 Bacteria 1236
59 Ga0070684_100035102 3300005535 Bacteria 4290
60 Ga0070684_100131467 3300005535 Bacteria 2258
61 Ga0070697_100000099 3300005536 Bacteria 71389
62 Ga0070697_100002342 3300005536 Bacteria 14568
63 Ga0070697_100007565 3300005536 Bacteria 8461
64 Ga0070697_100038435 3300005536 Bacteria 3867
65 Ga0070697_100163781 3300005536 Bacteria 1879
66 Ga0070697_100241805 3300005536 Bacteria 1542
67 Ga0070697_100663922 3300005536 Bacteria 918
68 Ga0070672_100176425 3300005543 Unclassified 1779
69 Ga0070695_100205670 3300005545 Bacteria 1410
70 Ga0070696_100106091 3300005546 Bacteria 2019
71 Ga0070693_100137228 3300005547 Unclassified 1535
72 Ga0070693_100170314 3300005547 Unclassified 1394
73 Ga0070693_100242532 3300005547 Bacteria 1191
74 Ga0070665_100002031 3300005548 Bacteria 22775
75 Ga0068855_100003285 3300005563 Bacteria 19803
76 Ga0068855_100033261 3300005563 Bacteria 6155
77 Ga0068855_100076697 3300005563 Bacteria 3878
78 Ga0068855_100102180 3300005563 Bacteria 3299
79 Ga0068855_100591399 3300005563 Bacteria 1198
80 Ga0070664_100001220 3300005564 Bacteria 20532
81 Ga0070664_100090280 3300005564 Bacteria 2652
82 Ga0070664_100241070 3300005564 Bacteria 1623
83 Ga0068857_100002960 3300005577 Bacteria 13986
84 Ga0068854_100003616 3300005578 Bacteria 9673
85 Ga0068854_100061105 3300005578 Bacteria 2728
86 Ga0068856_100000306 3300005614 Bacteria 53683
87 Ga0068856_100002080 3300005614 Bacteria 20768
88 Ga0068856_100104096 3300005614 Bacteria 2832
89 Ga0068856_100110951 3300005614 Bacteria 2740
90 Ga0068852_100164063 3300005616 Bacteria 2077
91 Ga0068852_100639786 3300005616 Bacteria 1070
92 Ga0068859_100002053 3300005617 Bacteria 20573
93 Ga0068864_100001779 3300005618 Bacteria 17693
94 Ga0068864_100043916 3300005618 Bacteria 3828
95 Ga0068864_100392898 3300005618 Bacteria 1317
96 Ga0068861_100448745 3300005719 Unclassified 1155
97 Ga0068851_10177579 3300005834 Bacteria 1178
98 Ga0068863_100030676 3300005841 Bacteria 5133
99 Ga0068858_100003987 3300005842 Bacteria 14569
100 Ga0068858_100022789 3300005842 Bacteria 5840
101 Ga0068858_100061163 3300005842 Bacteria 3481
102 Ga0068860_100006554 3300005843 Bacteria 11688
103 Ga0070717_10001615 3300006028 Bacteria 15611
104 Ga0070717_10009827 3300006028 Bacteria 7205
105 Ga0070717_10012522 3300006028 Bacteria 6469
106 Ga0070717_10021842 3300006028 Bacteria 5049
107 Ga0070717_10073761 3300006028 Bacteria 2852
108 Ga0070717_10101487 3300006028 Bacteria 2444
109 Ga0070717_10200322 3300006028 Bacteria 1748
110 Ga0070715_10027721 3300006163 Bacteria 2265
111 Ga0070716_100000328 3300006173 Bacteria 19205
112 Ga0070716_100068789 3300006173 Bacteria 2073
113 Ga0070716_100231134 3300006173 Bacteria 1248
114 Ga0070712_100000576 3300006175 Bacteria 21379
115 Ga0070712_100010096 3300006175 Bacteria 5951
116 Ga0070712_100032037 3300006175 Bacteria 3547
117 Ga0097621_100001528 3300006237 Bacteria 15851
118 Ga0097621_100051210 3300006237 Bacteria 3359
119 Ga0097621_100107252 3300006237 Bacteria 2357
120 Ga0097621_100142378 3300006237 Bacteria 2050
121 Ga0068871_100001464 3300006358 Bacteria 15819
122 Ga0068871_100307084 3300006358 Unclassified 1394
123 Ga0075430_100022441 3300006846 Bacteria 5370
124 Ga0075433_10000204 3300006852 Bacteria 33250
125 Ga0075434_100000087 3300006871 Bacteria 50514
126 Ga0068865_100054542 3300006881 Bacteria 2778
127 Ga0068865_100337917 3300006881 Bacteria 1216
128 Ga0075436_100036527 3300006914 Bacteria 3391
129 Ga0097620_100002053 3300006931 Bacteria 20573
130 Ga0075435_100000998 3300007076 Bacteria 17932
131 Ga0075435_100265140 3300007076 Bacteria 1464
132 Ga0099795_10154812 3300007788 Bacteria 941
133 Ga0105240_10006657 3300009093 Bacteria 16944
134 Ga0105240_10008751 3300009093 Bacteria 14432
135 Ga0105240_10100530 3300009093 Bacteria 3519
136 Ga0105240_10668577 3300009093 Bacteria 1137
137 Ga0105245_10011279 3300009098 Bacteria 7783
138 Ga0105245_10021193 3300009098 Bacteria 5698
139 Ga0105245_10026933 3300009098 Bacteria 5062
140 Ga0105245_10642582 3300009098 Bacteria 1091
141 Ga0114129_10056218 3300009147 Bacteria 5513
142 Ga0105243_10364263 3300009148 Unclassified 1331
143 Ga0105241_10048186 3300009174 Bacteria 3242
144 Ga0105241_10062508 3300009174 Bacteria 2871
145 Ga0105241_10244461 3300009174 Unclassified 1518
146 Ga0105242_10003412 3300009176 Bacteria 12351
147 Ga0105242_10010532 3300009176 Bacteria 7099
148 Ga0105242_10082964 3300009176 Bacteria 2683
149 Ga0105242_10224964 3300009176 Bacteria 1679
150 Ga0105248_10002552 3300009177 Bacteria 20275
151 Ga0105248_10341981 3300009177 Unclassified 1684
152 Ga0105248_10375035 3300009177 Bacteria 1602
153 Ga0105248_10582189 3300009177 Bacteria 1263
154 Ga0105237_10011778 3300009545 Bacteria 9253
155 Ga0105237_10042841 3300009545 Bacteria 4562
156 Ga0105237_10713111 3300009545 Unclassified 1010
157 Ga0105238_10002146 3300009551 Bacteria 19942
158 Ga0105238_10004048 3300009551 Bacteria 14534
159 Ga0105238_10014076 3300009551 Bacteria 8087
160 Ga0105239_10004738 3300010375 Bacteria 16150
161 Ga0105239_10042307 3300010375 Bacteria 4993
162 Ga0105239_10285687 3300010375 Bacteria 1858
163 Ga0105246_10069077 3300011119 Bacteria 2480
164 Ga0157371_10048784 3300013102 Bacteria 3010
165 Ga0157370_10014253 3300013104 Bacteria 8139
166 Ga0157370_10019850 3300013104 Bacteria 6726
167 Ga0157369_10000263 3300013105 Bacteria 71082
168 Ga0157369_10023337 3300013105 Bacteria 6891
169 Ga0157369_10087366 3300013105 Bacteria 3329
170 Ga0157369_10182395 3300013105 Unclassified 2208
171 Ga0157374_10002542 3300013296 Bacteria 15385
172 Ga0157374_10006682 3300013296 Bacteria 9801
173 Ga0157374_10034517 3300013296 Unclassified 4621
174 Ga0157378_10000049 3300013297 Bacteria 103103
175 Ga0157378_10004559 3300013297 Bacteria 12151
176 Ga0157378_10027451 3300013297 Bacteria 5024
177 Ga0157378_10237609 3300013297 Unclassified 1739
178 Ga0163162_10039805 3300013306 Bacteria 4697
179 Ga0157372_10001428 3300013307 Bacteria 25799
180 Ga0157372_10002714 3300013307 Bacteria 19151
181 Ga0157372_10004519 3300013307 Bacteria 14837
182 Ga0157372_10006021 3300013307 Bacteria 12878
183 Ga0157372_10038318 3300013307 Bacteria 5290
184 Ga0157372_10038564 3300013307 Bacteria 5273
185 Ga0157375_10057561 3300013308 Bacteria 3843
186 Ga0163163_10011468 3300014325 Bacteria 8041
187 Ga0157379_10424478 3300014968 Bacteria 1225
188 Ga0157376_10010148 3300014969 Bacteria 6877
189 Ga0213872_10000182 3300021361 Bacteria 56427
190 Ga0213871_10005107 3300021441 Bacteria 2682
191 Ga0228598_1000298 3300024227 Bacteria 9633
192 Ga0207647_10010556 3300025904 Bacteria 6518
193 Ga0207685_10011646 3300025905 Bacteria 2652
194 Ga0207699_10209778 3300025906 Unclassified 1324
195 Ga0207699_10211071 3300025906 Bacteria 1320
196 Ga0207705_10368605 3300025909 Bacteria 1108
197 Ga0207684_10003875 3300025910 Bacteria 14361
198 Ga0207684_10137457 3300025910 Bacteria 2099
199 Ga0207684_10219227 3300025910 Bacteria 1642
200 Ga0207654_10108248 3300025911 Bacteria 1724
201 Ga0207707_10004303 3300025912 Bacteria 12605
202 Ga0207707_10043316 3300025912 Bacteria 3926
203 Ga0207707_10050548 3300025912 Bacteria 3620
204 Ga0207707_10127782 3300025912 Bacteria 2223
205 Ga0207707_10159968 3300025912 Unclassified 1969
206 Ga0207695_10003183 3300025913 Bacteria 23387
207 Ga0207695_10006053 3300025913 Bacteria 15789
208 Ga0207695_10078626 3300025913 Bacteria 3346
209 Ga0207695_10080160 3300025913 Bacteria 3307
210 Ga0207695_10122984 3300025913 Bacteria 2561
211 Ga0207671_10092535 3300025914 Bacteria 2280
212 Ga0207671_10159808 3300025914 Bacteria 1744
213 Ga0207671_10225467 3300025914 Bacteria 1469
214 Ga0207693_10001443 3300025915 Bacteria 21031
215 Ga0207693_10002150 3300025915 Bacteria 17198
216 Ga0207693_10042542 3300025915 Bacteria 3576
217 Ga0207663_10030241 3300025916 Bacteria 3192
218 Ga0207663_10035458 3300025916 Bacteria 2993
219 Ga0207660_10029666 3300025917 Bacteria 3755
220 Ga0207660_10031532 3300025917 Bacteria 3652
221 Ga0207657_10000194 3300025919 Bacteria 63233
222 Ga0207657_10102474 3300025919 Bacteria 2374
223 Ga0207649_10085007 3300025920 Bacteria 2058
224 Ga0207652_10009014 3300025921 Bacteria 8041
225 Ga0207652_10220530 3300025921 Unclassified 1709
226 Ga0207646_10000616 3300025922 Bacteria 46319
227 Ga0207646_10112083 3300025922 Bacteria 2448
228 Ga0207646_10151318 3300025922 Bacteria 2093
229 Ga0207646_10177186 3300025922 Bacteria 1926
230 Ga0207646_10275365 3300025922 Bacteria 1521
231 Ga0207646_10455264 3300025922 Bacteria 1154
232 Ga0207694_10002858 3300025924 Bacteria 13924
233 Ga0207694_10010933 3300025924 Bacteria 6856
234 Ga0207694_10018557 3300025924 Bacteria 5257
235 Ga0207650_10007196 3300025925 Bacteria 7585
236 Ga0207687_10016482 3300025927 Bacteria 4854
237 Ga0207700_10076587 3300025928 Bacteria 2596
238 Ga0207700_10131329 3300025928 Bacteria 2045
239 Ga0207664_10006636 3300025929 Bacteria 7971
240 Ga0207664_10087497 3300025929 Bacteria 2547
241 Ga0207690_10287706 3300025932 Unclassified 1282
242 Ga0207686_10135196 3300025934 Bacteria 1696
243 Ga0207686_10135906 3300025934 Bacteria 1693
244 Ga0207686_10276564 3300025934 Bacteria 1237
245 Ga0207704_10007399 3300025938 Bacteria 5185
246 Ga0207704_10296749 3300025938 Bacteria 1236
247 Ga0207665_10000225 3300025939 Bacteria 38534
248 Ga0207665_10015155 3300025939 Bacteria 5063
249 Ga0207665_10276154 3300025939 Bacteria 1249
250 Ga0207691_10244557 3300025940 Unclassified 1550
251 Ga0207711_10022624 3300025941 Bacteria 5259
252 Ga0207711_10040041 3300025941 Unclassified 3986
253 Ga0207711_10673777 3300025941 Bacteria 965
254 Ga0207661_10009393 3300025944 Bacteria 7013
255 Ga0207661_10094591 3300025944 Bacteria 2496
256 Ga0207679_10024175 3300025945 Unclassified 4163
257 Ga0207679_10054657 3300025945 Unclassified 2941
258 Ga0207667_10000455 3300025949 Bacteria 54886
259 Ga0207667_10001675 3300025949 Bacteria 27904
260 Ga0207667_10024426 3300025949 Bacteria 6635
261 Ga0207667_10052671 3300025949 Unclassified 4284
262 Ga0207651_10007430 3300025960 Bacteria 5839
263 Ga0207640_10045721 3300025981 Bacteria 2813
264 Ga0207677_10003097 3300026023 Bacteria 8772
265 Ga0207677_10010504 3300026023 Bacteria 5242
266 Ga0207677_10034997 3300026023 Bacteria 3257
267 Ga0207703_10001845 3300026035 Bacteria 18883
268 Ga0207703_10013722 3300026035 Bacteria 6315
269 Ga0207703_10057487 3300026035 Bacteria 3172
270 Ga0207639_10373624 3300026041 Unclassified 1279
271 Ga0207702_10006362 3300026078 Bacteria 10195
272 Ga0207702_10008844 3300026078 Bacteria 8487
273 Ga0207702_10031688 3300026078 Bacteria 4407
274 Ga0207702_10085372 3300026078 Bacteria 2751
275 Ga0207702_10421557 3300026078 Bacteria 1291
276 Ga0207641_10026536 3300026088 Unclassified 4782
277 Ga0207648_10024006 3300026089 Bacteria 5450
278 Ga0207648_10268895 3300026089 Unclassified 1522
279 Ga0207676_10000869 3300026095 Bacteria 23427
280 Ga0207676_10037090 3300026095 Bacteria 3712
281 Ga0207675_100103689 3300026118 Unclassified 2680
282 Ga0207683_10214832 3300026121 Bacteria 1751
283 Ga0207698_10139634 3300026142 Bacteria 2085
284 Ga0265356_1004069 3300028017 Bacteria 1804
285 Ga0268266_10022366 3300028379 Bacteria 5389
286 Ga0268264_10109566 3300028381 Unclassified 2416
287 Ga0265762_1027579 3300030760 Unclassified 1066
288 Ga0265765_1002833 3300030879 Bacteria 1706
289 Ga0265760_10001324 3300031090 Bacteria 7256
290 Ga0265760_10003582 3300031090 Bacteria 4505
291 Ga0265314_10007473 3300031711 Bacteria 9474
292 Ga0265342_10101954 3300031712 Bacteria 1633
293 Ga0373926_0004421 3300035083 Bacteria 4611
294 Ga0373923_0003933 3300035111 Bacteria 4851
295 Ga0373936_0000856 3300035113 Bacteria 10848
296 Ga0373936_0034611 3300035113 Bacteria 2008
297 Ga0373953_0034522 3300035117 Bacteria 1983
298 Ga0373956_0035976 3300035119 Bacteria 2185
299 Ga0373943_0000085 3300035170 Bacteria 33641
300 Ga0373943_0090166 3300035170 Unclassified 1587
301 Ga0373946_0001570 3300035171 Bacteria 7957
302 Ga0373955_0068077 3300035172 Bacteria 1983
303 Ga0373931_0018483 3300035691 Unclassified 3468
304 Ga0373935_0002799 3300035692 Bacteria 10040
305 Ga0373927_0001082 3300035695 Bacteria 20747
306 Ga0373927_0009002 3300035695 Bacteria 6702
307 Ga0373947_0001814 3300035725 Bacteria 13066
308 Ga0373937_0176018 3300036401 Bacteria 2008
309 Ga0373937_0208917 3300036401 Bacteria 1836
310 Ga0373937_0682874 3300036401 Bacteria 973
311 Ga0373925_0005717 3300037068 Bacteria 9244
312 Ga0373925_0020317 3300037068 Bacteria 4833
313 Ga0373925_0176320 3300037068 Unclassified 1690
314 Ga0395901_0512140 3300038443 Bacteria 1220
315 Ga0436360_0010486 3300039438 Bacteria 1752
316 Ga0436360_0918724 3300039438 Bacteria 8558
317 Ga0436361_0126076 3300039447 Bacteria 97470
318 Ga0436363_0251327 3300039450 Unclassified 1311
319 Ga0466966_0058213 3300044684 Bacteria 2443
320 Ga0451576_0100097 3300045051 Bacteria 3015
321 Ga0495603_0137124 3300046455 Bacteria 1424
322 Ga0495651_0174577 3300046462 Bacteria 1527
323 Ga0495580_0011160 3300046472 Bacteria 6960
324 Ga0495580_0015272 3300046472 Bacteria 5800
325 Ga0495580_0019453 3300046472 Bacteria 5045
326 Ga0495580_0142769 3300046472 Bacteria 1659
327 Ga0495630_0002739 3300046517 Bacteria 12229
328 Ga0495652_0414306 3300046529 Bacteria 951
329 Ga0495665_0049930 3300046531 Bacteria 2218
330 Ga0495624_0048962 3300046690 Bacteria 2681
331 Ga0495674_0045081 3300047319 Bacteria 3916
332 Ga0495602_0341392 3300048088 Bacteria 1083
333 Ga0496102_0025826 3300048905 Bacteria 5232
334 Ga0496102_0031398 3300048905 Unclassified 4765
335 Ga0496102_0350257 3300048905 Unclassified 1390
336 Ga0496104_0017058 3300048907 Bacteria 6608
337 Ga0496104_0234186 3300048907 Bacteria 1748
338 Ga0496115_0212753 3300048918 Bacteria 1597
339 nmdc:mga05p37_441241_c1 3300050507 Bacteria 1509
340 nmdc:mga0n895_128_c1 3300050512 Bacteria 45048
341 nmdc:mga0rr50_106_c1 3300050513 Bacteria 46345
342 nmdc:mga0a205_1541_c1 3300050515 Bacteria 19716
343 Ga0070708_100033307
344 Ga0070658_10088830
345 Ga0070658_10110266
346 Ga0070683_100049748
347 Ga0070683_100067771
348 Ga0070683_100246790
349 Ga0070690_100076699
350 Ga0070690_100187806
351 Ga0070670_100004602
352 Ga0068869_100027568
353 Ga0068869_100081173
354 Ga0068869_100625537
355 Ga0070680_100073389
356 Ga0068868_100003927
357 Ga0068868_100004173
358 Ga0068868_100005772
359 Ga0070660_100016834
360 Ga0070660_100094432
361 Ga0070660_100290530
362 Ga0070691_10186187
363 Ga0070661_100114945
364 Ga0070673_100012032
365 Ga0070659_100240826
366 Ga0070709_10036552
367 Ga0070709_10069784
368 Ga0070709_10156883
369 Ga0070714_100000027
370 Ga0070714_100247886
371 Ga0070714_100291152
372 Ga0070713_100382643
373 Ga0070710_10087001
374 Ga0070711_100023104
375 Ga0070711_100038570
376 Ga0070711_100347820
377 Ga0070708_100243779
378 Ga0070678_100122592
379 Ga0070681_10000371
380 Ga0070681_10090487
381 Ga0070681_10142096
382 Ga0070681_10163487
383 Ga0070681_10208350
384 Ga0068867_100016192
385 Ga0068867_100295696
386 Ga0070706_100024824
387 Ga0070706_100120783
388 Ga0070706_100240535
389 Ga0070707_100018159
390 Ga0070707_100092570
391 Ga0070707_100150063
392 Ga0070707_100313898
393 Ga0070707_100483389
394 Ga0070698_100079841
395 Ga0070699_100093641
396 Ga0070679_100023245
397 Ga0070679_100062759
398 Ga0070679_100100676
399 Ga0070679_100228822
400 Ga0070679_100447996
401 Ga0070684_100035102
402 Ga0070684_100131467
403 Ga0070697_100000099
404 Ga0070697_100002342
405 Ga0070697_100007565
406 Ga0070697_100038435
407 Ga0070697_100163781
408 Ga0070697_100241805
409 Ga0070697_100663922
410 Ga0070672_100176425
411 Ga0070695_100205670
412 Ga0070696_100106091
413 Ga0070693_100137228
414 Ga0070693_100170314
415 Ga0070693_100242532
416 Ga0070665_100002031
417 Ga0068855_100003285
418 Ga0068855_100033261
419 Ga0068855_100076697
420 Ga0068855_100102180
421 Ga0068855_100591399
422 Ga0070664_100001220
423 Ga0070664_100090280
424 Ga0070664_100241070
425 Ga0068857_100002960
426 Ga0068854_100003616
427 Ga0068854_100061105
428 Ga0068856_100000306
429 Ga0068856_100002080
430 Ga0068856_100104096
431 Ga0068856_100110951
432 Ga0068852_100164063
433 Ga0068852_100639786
434 Ga0068859_100002053
435 Ga0068864_100001779
436 Ga0068864_100043916
437 Ga0068864_100392898
438 Ga0068861_100448745
439 Ga0068851_10177579
440 Ga0068863_100030676
441 Ga0068858_100003987
442 Ga0068858_100022789
443 Ga0068858_100061163
444 Ga0068860_100006554
445 Ga0070717_10001615
446 Ga0070717_10009827
447 Ga0070717_10012522
448 Ga0070717_10021842
449 Ga0070717_10073761
450 Ga0070717_10101487
451 Ga0070717_10200322
452 Ga0070715_10027721
453 Ga0070716_100000328
454 Ga0070716_100068789
455 Ga0070716_100231134
456 Ga0070712_100000576
457 Ga0070712_100010096
458 Ga0070712_100032037
459 Ga0097621_100001528
460 Ga0097621_100051210
461 Ga0097621_100107252
462 Ga0097621_100142378
463 Ga0068871_100001464
464 Ga0068871_100307084
465 Ga0075430_100022441
466 Ga0075433_10000204
467 Ga0075434_100000087
468 Ga0068865_100054542
469 Ga0068865_100337917
470 Ga0075436_100036527
471 Ga0097620_100002053
472 Ga0075435_100000998
473 Ga0075435_100265140
474 Ga0099795_10154812
475 Ga0105240_10006657
476 Ga0105240_10008751
477 Ga0105240_10100530
478 Ga0105240_10668577
479 Ga0105245_10011279
480 Ga0105245_10021193
481 Ga0105245_10026933
482 Ga0105245_10642582
483 Ga0114129_10056218
484 Ga0105243_10364263
485 Ga0105241_10048186
486 Ga0105241_10062508
487 Ga0105241_10244461
488 Ga0105242_10003412
489 Ga0105242_10010532
490 Ga0105242_10082964
491 Ga0105242_10224964
492 Ga0105248_10002552
493 Ga0105248_10341981
494 Ga0105248_10375035
495 Ga0105248_10582189
496 Ga0105237_10011778
497 Ga0105237_10042841
498 Ga0105237_10713111
499 Ga0105238_10002146
500 Ga0105238_10004048
501 Ga0105238_10014076
502 Ga0105239_10004738
503 Ga0105239_10042307
504 Ga0105239_10285687
505 Ga0105246_10069077
506 Ga0157371_10048784
507 Ga0157370_10014253
508 Ga0157370_10019850
509 Ga0157369_10000263
510 Ga0157369_10023337
511 Ga0157369_10087366
512 Ga0157369_10182395
513 Ga0157374_10002542
514 Ga0157374_10006682
515 Ga0157374_10034517
516 Ga0157378_10000049
517 Ga0157378_10004559
518 Ga0157378_10027451
519 Ga0157378_10237609
520 Ga0163162_10039805
521 Ga0157372_10001428
522 Ga0157372_10002714
523 Ga0157372_10004519
524 Ga0157372_10006021
525 Ga0157372_10038318
526 Ga0157372_10038564
527 Ga0157375_10057561
528 Ga0163163_10011468
529 Ga0157379_10424478
530 Ga0157376_10010148
531 Ga0213872_10000182
532 Ga0213871_10005107
533 Ga0228598_1000298
534 Ga0207647_10010556
535 Ga0207685_10011646
536 Ga0207699_10209778
537 Ga0207699_10211071
538 Ga0207705_10368605
539 Ga0207684_10003875
540 Ga0207684_10137457
541 Ga0207684_10219227
542 Ga0207654_10108248
543 Ga0207707_10004303
544 Ga0207707_10043316
545 Ga0207707_10050548
546 Ga0207707_10127782
547 Ga0207707_10159968
548 Ga0207695_10003183
549 Ga0207695_10006053
550 Ga0207695_10078626
551 Ga0207695_10080160
552 Ga0207695_10122984
553 Ga0207671_10092535
554 Ga0207671_10159808
555 Ga0207671_10225467
556 Ga0207693_10001443
557 Ga0207693_10002150
558 Ga0207693_10042542
559 Ga0207663_10030241
560 Ga0207663_10035458
561 Ga0207660_10029666
562 Ga0207660_10031532
563 Ga0207657_10000194
564 Ga0207657_10102474
565 Ga0207649_10085007
566 Ga0207652_10009014
567 Ga0207652_10220530
568 Ga0207646_10000616
569 Ga0207646_10112083
570 Ga0207646_10151318
571 Ga0207646_10177186
572 Ga0207646_10275365
573 Ga0207646_10455264
574 Ga0207694_10002858
575 Ga0207694_10010933
576 Ga0207694_10018557
577 Ga0207650_10007196
578 Ga0207687_10016482
579 Ga0207700_10076587
580 Ga0207700_10131329
581 Ga0207664_10006636
582 Ga0207664_10087497
583 Ga0207690_10287706
584 Ga0207686_10135196
585 Ga0207686_10135906
586 Ga0207686_10276564
587 Ga0207704_10007399
588 Ga0207704_10296749
589 Ga0207665_10000225
590 Ga0207665_10015155
591 Ga0207665_10276154
592 Ga0207691_10244557
593 Ga0207711_10022624
594 Ga0207711_10040041
595 Ga0207711_10673777
596 Ga0207661_10009393
597 Ga0207661_10094591
598 Ga0207679_10024175
599 Ga0207679_10054657
600 Ga0207667_10000455
601 Ga0207667_10001675
602 Ga0207667_10024426
603 Ga0207667_10052671
604 Ga0207651_10007430
605 Ga0207640_10045721
606 Ga0207677_10003097
607 Ga0207677_10010504
608 Ga0207677_10034997
609 Ga0207703_10001845
610 Ga0207703_10013722
611 Ga0207703_10057487
612 Ga0207639_10373624
613 Ga0207702_10006362
614 Ga0207702_10008844
615 Ga0207702_10031688
616 Ga0207702_10085372
617 Ga0207702_10421557
618 Ga0207641_10026536
619 Ga0207648_10024006
620 Ga0207648_10268895
621 Ga0207676_10000869
622 Ga0207676_10037090
623 Ga0207675_100103689
624 Ga0207683_10214832
625 Ga0207698_10139634
626 Ga0265356_1004069
627 Ga0268266_10022366
628 Ga0268264_10109566
629 Ga0265762_1027579
630 Ga0265765_1002833
631 Ga0265760_10001324
632 Ga0265760_10003582
633 Ga0265314_10007473
634 Ga0265342_10101954
635 Ga0373926_0004421
636 Ga0373923_0003933
637 Ga0373936_0000856
638 Ga0373936_0034611
639 Ga0373953_0034522
640 Ga0373956_0035976
641 Ga0373943_0000085
642 Ga0373943_0090166
643 Ga0373946_0001570
644 Ga0373955_0068077
645 Ga0373931_0018483
646 Ga0373935_0002799
647 Ga0373927_0001082
648 Ga0373927_0009002
649 Ga0373947_0001814
650 Ga0373937_0176018
651 Ga0373937_0208917
652 Ga0373937_0682874
653 Ga0373925_0005717
654 Ga0373925_0020317
655 Ga0373925_0176320
656 Ga0395901_0512140
657 Ga0436360_0010486
658 Ga0436360_0918724
659 Ga0436361_0126076
660 Ga0436363_0251327
661 Ga0466966_0058213
662 Ga0451576_0100097
663 Ga0495603_0137124
664 Ga0495651_0174577
665 Ga0495580_0011160
666 Ga0495580_0015272
667 Ga0495580_0019453
668 Ga0495580_0142769
669 Ga0495630_0002739
670 Ga0495652_0414306
671 Ga0495665_0049930
672 Ga0495624_0048962
673 Ga0495674_0045081
674 Ga0495602_0341392
675 Ga0496102_0025826
676 Ga0496102_0031398
677 Ga0496102_0350257
678 Ga0496104_0017058
679 Ga0496104_0234186
680 Ga0496115_0212753
681 nmdc:mga05p37_441241_c1
682 nmdc:mga0n895_128_c1
683 nmdc:mga0rr50_106_c1
684 nmdc:mga0a205_1541_c1

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01728

FtsJ

FtsJ-like methyltransferase

116

306

0.97

PF01479

S4

S4 domain

60

107

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
3opn-assembly1.cif.gz_A the crystal structure of a putative hemolysin from lactococcus lactis 0.9616 47 232
5eov-assembly1.cif.gz_A c-terminal domain of the 16s/23s rrna (cytidine-2'-o)-methyltransferase tlya. 0.9615 52 232
7p7q-assembly1.cif.gz_e e. faecalis 70s ribosome bound by poxta-eq2, high-resolution combined volume 0.8735 2 49
7s0s-assembly1.cif.gz_B m. tuberculosis ribosomal rna methyltransferase tlya bound to m. smegmatis 50s ribosomal subunit 0.872 2 232
4v5z-assembly1.cif.gz_Ad structure of a mammalian 80s ribosome obtained by docking homology models of the rna and proteins into an 8.7 a cryo-em map 0.8661 2 49
ID Description Score Start End Superfamily
5eovA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9615 52 232 3.40.50.150
af_C0P590_106_292_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9614 57 232 3.40.50.150
3opnA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9593 47 232 3.40.50.150
af_Q9XPI8_145_195_3.10.290.10 Alpha Beta;Roll;Structural Genomics Hypothetical 15.5 Kd Protein In mrcA-pckA Intergenic Region; Chain A;RNA-binding S4 domain 0.9143 2 43 3.10.290.10
af_P56799_3_142_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.8966 2 47 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A7V9HDR5-F1-model_v4 TlyA family RNA methyltransferase 0.9835 80 233 GO:0008168
GO:0032259
AF-A0A3E0KKI0-F1-model_v4 TlyA family rRNA (Cytidine-2'-O)-methyltransferase 0.9817 52 232 GO:0008168
GO:0032259
AF-A0A4V3M298-F1-model_v4 deleted 0.9798 50 133
AF-A0A5P9VIV6-F1-model_v4 TlyA 0.9778 65 232 GO:0008168
GO:0032259
AF-A0A1Q7SI60-F1-model_v4 Ribosomal RNA methyltransferase FtsJ domain-containing protein 0.9773 68 232 GO:0008168
GO:0032259

Map