F415054

General Info

Members Datasets Scaffolds Average Seq Length
342 189 684 186

Family's Representative Sequence

Representative Sequence 3300005435|Ga0070714_100070361|Ga0070714_1000703614
Length 187
Sequence MELAPSLGSVLPLRPRAATIRVVHGEATDGELILRIGTGDRSAFELLYQRYARPVFGLALRRLGDRGRAEDAVQETFASIWRAARSYKPDRGPGAPWLYAVARNAIVDRGRARSEERAESGWVSWRVHRALEELPERERTVLELAYWSGLSQSEIAEFLHIPLGTVKTRTRSALARLADALDGEELA

Samples

Sample ID Description Type Environment
1 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
6 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
7 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
8 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
9 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
10 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
11 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
12 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
13 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
14 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
15 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
16 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
17 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
18 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
19 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
20 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
21 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
22 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
23 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
24 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
25 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
26 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
27 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
28 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
29 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
30 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
31 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
32 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
33 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
34 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
35 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
36 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
37 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
38 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
39 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
40 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
41 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
42 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
43 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
44 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
45 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
46 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
47 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
48 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
49 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
65 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
66 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
67 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
68 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
69 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
70 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
71 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
72 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
73 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
74 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
75 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
76 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
77 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
78 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
79 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
80 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
81 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
82 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
83 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
84 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
85 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
86 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
87 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
88 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
89 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
90 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
91 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
92 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
93 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
94 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
95 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
96 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
97 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
98 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
99 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
100 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
101 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
102 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
103 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
104 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
105 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
106 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
107 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
108 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
109 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
110 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
111 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
112 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
113 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
114 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
115 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
116 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
117 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
118 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
119 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
120 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
121 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
122 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
123 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
124 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
125 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
126 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
127 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
128 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
129 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
130 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
131 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
132 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
133 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
134 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
135 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
136 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
137 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
138 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
139 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
140 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
141 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
142 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
143 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
144 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
145 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
146 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
147 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
148 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
149 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
150 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
151 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
152 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
153 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
154 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
155 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
156 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
157 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
158 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
159 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
160 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
161 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
162 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
163 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
164 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
165 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
166 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
167 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
168 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
169 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
170 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
171 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
172 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
173 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
174 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
175 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
176 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
177 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
178 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
179 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
180 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
181 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
182 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
183 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
184 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
185 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
186 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
187 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
188 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
189 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.32
Metatranscriptomes 4.68
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3.22
Rhizosphere 95.32
Stem 0
Stem Tuber 0
Unclassified 4.97

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070714_100070361 3300005435 Bacteria 3025
2 Ga0070658_10036296 3300005327 Bacteria 3973
3 Ga0070683_100028045 3300005329 Bacteria 5085
4 Ga0070683_100721593 3300005329 Bacteria 955
5 Ga0070680_100005165 3300005336 Bacteria 9872
6 Ga0070660_100009589 3300005339 Bacteria 6818
7 Ga0070660_100177439 3300005339 Bacteria 1723
8 Ga0070660_100676288 3300005339 Bacteria 865
9 Ga0070661_100010158 3300005344 Bacteria 6538
10 Ga0070659_100085353 3300005366 Bacteria 2525
11 Ga0070709_10128292 3300005434 Bacteria 1728
12 Ga0070714_100393377 3300005435 Bacteria 1309
13 Ga0070714_100491149 3300005435 Bacteria 1170
14 Ga0070714_100899315 3300005435 Bacteria 859
15 Ga0070713_100275880 3300005436 Bacteria 1541
16 Ga0070711_100070125 3300005439 Bacteria 2467
17 Ga0070705_100856222 3300005440 Bacteria 728
18 Ga0070708_100013199 3300005445 Bacteria 6758
19 Ga0070708_100170348 3300005445 Bacteria 2032
20 Ga0070681_10031827 3300005458 Bacteria 5295
21 Ga0070706_100009424 3300005467 Bacteria 9090
22 Ga0070706_101304304 3300005467 Bacteria 666
23 Ga0070707_100088993 3300005468 Bacteria 2987
24 Ga0070698_100025410 3300005471 Bacteria 6173
25 Ga0070699_100011259 3300005518 Bacteria 7727
26 Ga0070679_101108534 3300005530 Bacteria 736
27 Ga0070684_100022323 3300005535 Bacteria 5277
28 Ga0070684_100107788 3300005535 Bacteria 2495
29 Ga0070684_100114833 3300005535 Bacteria 2417
30 Ga0070697_100103868 3300005536 Bacteria 2362
31 Ga0070697_100345785 3300005536 Bacteria 1284
32 Ga0068853_100885406 3300005539 Bacteria 857
33 Ga0070696_100212973 3300005546 Bacteria 1447
34 Ga0068855_100019212 3300005563 Bacteria 8213
35 Ga0068855_100029823 3300005563 Bacteria 6522
36 Ga0068855_100244227 3300005563 Bacteria 2005
37 Ga0068855_100946752 3300005563 Bacteria 907
38 Ga0068857_100589534 3300005577 Bacteria 1050
39 Ga0068854_100459428 3300005578 Bacteria 1065
40 Ga0068856_100421316 3300005614 Bacteria 1355
41 Ga0068852_100065768 3300005616 Bacteria 3165
42 Ga0081455_10087631 3300005937 Bacteria 2532
43 Ga0081455_10088908 3300005937 Bacteria 2508
44 Ga0070717_10229301 3300006028 Unclassified 1635
45 Ga0070717_10645318 3300006028 Bacteria 961
46 Ga0070712_100302472 3300006175 Bacteria 1295
47 Ga0075434_100470666 3300006871 Bacteria 1278
48 Ga0075435_100074406 3300007076 Bacteria 2779
49 Ga0105240_10036261 3300009093 Bacteria 6346
50 Ga0105240_10076431 3300009093 Bacteria 4128
51 Ga0105245_10083348 3300009098 Bacteria 2927
52 Ga0105242_10340812 3300009176 Bacteria 1381
53 Ga0105242_10827800 3300009176 Bacteria 919
54 Ga0157342_1002595 3300012507 Bacteria 1482
55 Ga0157370_10011897 3300013104 Bacteria 9077
56 Ga0157370_10018188 3300013104 Bacteria 7073
57 Ga0157370_10311626 3300013104 Bacteria 1452
58 Ga0157369_10039970 3300013105 Bacteria 5124
59 Ga0157369_10102019 3300013105 Bacteria 3058
60 Ga0157369_10534739 3300013105 Bacteria 1212
61 Ga0157374_11157199 3300013296 Bacteria 794
62 Ga0157372_10637027 3300013307 Bacteria 1242
63 Ga0157375_10073466 3300013308 Bacteria 3439
64 Ga0197907_11071431 3300020069 Bacteria 2097
65 Ga0206356_10072847 3300020070 Bacteria 2784
66 Ga0206356_10650768 3300020070 Bacteria 2248
67 Ga0206356_11455019 3300020070 Bacteria 999
68 Ga0206356_11903022 3300020070 Bacteria 975
69 Ga0206350_10270040 3300020080 Bacteria 1310
70 Ga0206354_10573710 3300020081 Bacteria 2316
71 Ga0206354_10601078 3300020081 Bacteria 3955
72 Ga0206354_11058928 3300020081 Bacteria 1204
73 Ga0206354_11238859 3300020081 Bacteria 1219
74 Ga0206353_10139855 3300020082 Bacteria 1852
75 Ga0206353_10159728 3300020082 Bacteria 5234
76 Ga0206353_10983179 3300020082 Bacteria 4245
77 Ga0213871_10020660 3300021441 Bacteria 1634
78 Ga0224712_10043266 3300022467 Bacteria 1711
79 Ga0224712_10076803 3300022467 Bacteria 1369
80 Ga0224712_10105501 3300022467 Bacteria 1201
81 Ga0207699_10110935 3300025906 Bacteria 1758
82 Ga0207705_10008362 3300025909 Bacteria 7554
83 Ga0207705_10288858 3300025909 Bacteria 1256
84 Ga0207705_10400581 3300025909 Bacteria 1061
85 Ga0207705_10427080 3300025909 Bacteria 1026
86 Ga0207684_10011311 3300025910 Bacteria 7814
87 Ga0207695_10170097 3300025913 Bacteria 2105
88 Ga0207695_10211180 3300025913 Bacteria 1851
89 Ga0207663_10153360 3300025916 Bacteria 1618
90 Ga0207657_10002868 3300025919 Bacteria 18530
91 Ga0207657_10081094 3300025919 Bacteria 2726
92 Ga0207646_10004531 3300025922 Bacteria 15050
93 Ga0207646_10146241 3300025922 Bacteria 2130
94 Ga0207646_10281304 3300025922 Bacteria 1503
95 Ga0207687_10290998 3300025927 Bacteria 1313
96 Ga0207664_10337736 3300025929 Bacteria 1331
97 Ga0207664_10436433 3300025929 Unclassified 1168
98 Ga0207690_10090489 3300025932 Bacteria 2160
99 Ga0207686_10479892 3300025934 Bacteria 961
100 Ga0207661_10018237 3300025944 Bacteria 5212
101 Ga0207661_10198909 3300025944 Bacteria 1761
102 Ga0207667_10049080 3300025949 Bacteria 4460
103 Ga0207667_10078269 3300025949 Bacteria 3427
104 Ga0207667_10531483 3300025949 Bacteria 1191
105 Ga0207674_10943619 3300026116 Bacteria 831
106 Ga0207698_10059871 3300026142 Bacteria 2959
107 Ga0265320_10155947 3300031240 Bacteria 1030
108 Ga0265329_10045697 3300031242 Unclassified 1399
109 Ga0265340_10095960 3300031247 Bacteria 1382
110 Ga0265327_10215210 3300031251 Bacteria 866
111 Ga0265313_10015736 3300031595 Bacteria 4386
112 Ga0307416_100084643 3300032002 Bacteria 2696
113 Ga0307416_100112025 3300032002 Bacteria 2407
114 Ga0373951_0012484 3300035091 Bacteria 1911
115 Ga0373936_0063868 3300035113 Bacteria 1508
116 Ga0373945_0020201 3300035116 Bacteria 2278
117 Ga0373957_0160078 3300035120 Bacteria 927
118 Ga0373943_0000138 3300035170 Bacteria 27619
119 Ga0373943_0057330 3300035170 Bacteria 1935
120 Ga0373946_0004165 3300035171 Bacteria 5156
121 Ga0373955_0027565 3300035172 Bacteria 2938
122 Ga0373924_0028207 3300035410 Bacteria 2236
123 Ga0373935_0295146 3300035692 Bacteria 1144
124 Ga0373927_0003815 3300035695 Bacteria 10696
125 Ga0373927_0354085 3300035695 Bacteria 967
126 Ga0373947_0024553 3300035725 Bacteria 3512
127 Ga0373947_0030005 3300035725 Bacteria 3192
128 Ga0373947_0219890 3300035725 Bacteria 1248
129 Ga0373937_0029357 3300036401 Bacteria 4980
130 Ga0373937_0434152 3300036401 Bacteria 1247
131 Ga0373937_0459880 3300036401 Unclassified 1209
132 Ga0373925_0015551 3300037068 Bacteria 5505
133 Ga0373925_0023659 3300037068 Bacteria 4482
134 Ga0395899_0003423 3300037312 Bacteria 12586
135 Ga0395899_0005507 3300037312 Bacteria 9807
136 Ga0395899_0077479 3300037312 Bacteria 2424
137 Ga0395900_0001939 3300037418 Bacteria 23436
138 Ga0395900_0018693 3300037418 Bacteria 7067
139 Ga0395900_0090651 3300037418 Bacteria 3142
140 Ga0395900_0103235 3300037418 Unclassified 2928
141 Ga0395900_0114890 3300037418 Bacteria 2762
142 Ga0395900_0218705 3300037418 Bacteria 1921
143 Ga0395900_0490415 3300037418 Unclassified 1180
144 Ga0395898_0001631 3300037466 Bacteria 30388
145 Ga0395898_0006255 3300037466 Bacteria 12739
146 Ga0395898_0007682 3300037466 Bacteria 11449
147 Ga0395898_0093351 3300037466 Bacteria 2892
148 Ga0395898_0124366 3300037466 Bacteria 2471
149 Ga0395898_0593247 3300037466 Unclassified 1050
150 Ga0395905_0004368 3300037471 Bacteria 14716
151 Ga0395905_0083146 3300037471 Bacteria 3000
152 Ga0395905_0092691 3300037471 Bacteria 2833
153 Ga0395905_0233570 3300037471 Unclassified 1719
154 Ga0395905_0270999 3300037471 Bacteria 1583
155 Ga0395905_0272192 3300037471 Bacteria 1579
156 Ga0436364_0537611 3300037853 Unclassified 885
157 Ga0395901_0000370 3300038443 Bacteria 54012
158 Ga0395901_0015385 3300038443 Bacteria 7788
159 Ga0395901_0043745 3300038443 Unclassified 4644
160 Ga0395901_0131542 3300038443 Unclassified 2629
161 Ga0395901_0930443 3300038443 Bacteria 849
162 Ga0436365_0154975 3300039437 Bacteria 2983
163 Ga0436365_1101754 3300039437 Bacteria 1893
164 Ga0436360_0921741 3300039438 Bacteria 2787
165 Ga0436363_0193642 3300039450 Bacteria 1410
166 Ga0436363_1183800 3300039450 Bacteria 1051
167 Ga0466966_0342520 3300044684 Bacteria 898
168 Ga0466961_0081436 3300044693 Bacteria 2048
169 Ga0466961_0150215 3300044693 Bacteria 1455
170 Ga0466963_0015359 3300044694 Bacteria 4739
171 Ga0466963_0021400 3300044694 Bacteria 4080
172 Ga0466963_0024233 3300044694 Bacteria 3862
173 Ga0466963_0061748 3300044694 Bacteria 2506
174 Ga0466963_0132547 3300044694 Bacteria 1722
175 Ga0466963_0164730 3300044694 Bacteria 1544
176 Ga0466964_0021039 3300044706 Bacteria 2519
177 Ga0466964_0091408 3300044706 Bacteria 1325
178 Ga0466964_0158314 3300044706 Bacteria 1056
179 Ga0466971_0022180 3300044719 Bacteria 2828
180 Ga0466968_0251718 3300044735 Bacteria 839
181 Ga0466957_0020994 3300044842 Bacteria 3844
182 Ga0466960_0288046 3300044901 Bacteria 922
183 Ga0466959_0001052 3300045049 Bacteria 16546
184 Ga0466959_0102365 3300045049 Bacteria 2050
185 Ga0466959_0113982 3300045049 Bacteria 1927
186 Ga0466959_0164410 3300045049 Bacteria 1559
187 Ga0466958_0012656 3300045836 Bacteria 4783
188 Ga0466958_0055153 3300045836 Bacteria 2411
189 Ga0466958_0080384 3300045836 Bacteria 2005
190 Ga0466967_0003283 3300045976 Bacteria 10492
191 Ga0466967_0010400 3300045976 Bacteria 6979
192 Ga0466967_0018200 3300045976 Bacteria 5605
193 Ga0466967_0019997 3300045976 Bacteria 5399
194 Ga0466967_0086734 3300045976 Bacteria 2836
195 Ga0466967_0370908 3300045976 Bacteria 1388
196 Ga0466967_0451523 3300045976 Bacteria 1256
197 Ga0466967_0500585 3300045976 Bacteria 1192
198 Ga0466967_0707754 3300045976 Viruses 998
199 Ga0466967_1334691 3300045976 Bacteria 714
200 Ga0495592_0094128 3300046454 Bacteria 2145
201 Ga0495629_0001540 3300046459 Bacteria 18100
202 Ga0495629_0059623 3300046459 Bacteria 2668
203 Ga0495629_0145514 3300046459 Bacteria 1648
204 Ga0495641_0000345 3300046461 Bacteria 38081
205 Ga0495641_0137928 3300046461 Bacteria 1089
206 Ga0495651_0033458 3300046462 Bacteria 4009
207 Ga0495651_0070043 3300046462 Bacteria 2669
208 Ga0495653_0050997 3300046463 Bacteria 3179
209 Ga0495653_0085086 3300046463 Bacteria 2327
210 Ga0495582_0000583 3300046473 Bacteria 20199
211 Ga0495582_0266750 3300046473 Bacteria 982
212 Ga0495639_0005645 3300046475 Bacteria 5383
213 Ga0495662_0068492 3300046476 Bacteria 1718
214 Ga0495662_0335444 3300046476 Bacteria 743
215 Ga0495664_0166673 3300046477 Bacteria 1337
216 Ga0495585_0079236 3300046492 Bacteria 1782
217 Ga0495594_0016275 3300046499 Bacteria 3917
218 Ga0495608_0007115 3300046511 Bacteria 7914
219 Ga0495618_0269222 3300046514 Bacteria 1065
220 Ga0495628_0052140 3300046516 Bacteria 3232
221 Ga0495628_0632513 3300046516 Bacteria 761
222 Ga0495630_0004171 3300046517 Bacteria 10119
223 Ga0495630_0024046 3300046517 Bacteria 4505
224 Ga0495630_0074113 3300046517 Bacteria 2563
225 Ga0495630_0240871 3300046517 Bacteria 1382
226 Ga0495652_0071384 3300046529 Bacteria 2898
227 Ga0495665_0001821 3300046531 Bacteria 11503
228 Ga0495640_0346393 3300046533 Bacteria 917
229 Ga0495586_0010543 3300046535 Bacteria 4916
230 Ga0495586_0402208 3300046535 Bacteria 788
231 Ga0495587_0047085 3300046536 Bacteria 2557
232 Ga0495645_0012467 3300046543 Bacteria 5989
233 Ga0495645_0022952 3300046543 Bacteria 4516
234 Ga0495667_0007330 3300046559 Bacteria 7481
235 Ga0495667_0013481 3300046559 Bacteria 5532
236 Ga0495635_0007892 3300046663 Bacteria 7435
237 Ga0495635_0152121 3300046663 Bacteria 1575
238 Ga0495635_0358886 3300046663 Bacteria 971
239 Ga0495657_0254025 3300046675 Bacteria 1057
240 Ga0495599_0010008 3300046678 Bacteria 5805
241 Ga0495623_0061397 3300046679 Bacteria 2357
242 Ga0495647_0004161 3300046681 Bacteria 4686
243 Ga0495647_0218705 3300046681 Bacteria 840
244 Ga0495658_0001781 3300046683 Bacteria 11120
245 Ga0495658_0048401 3300046683 Bacteria 2397
246 Ga0495613_0087564 3300046689 Bacteria 2257
247 Ga0495613_0200234 3300046689 Bacteria 1408
248 Ga0495613_0260021 3300046689 Bacteria 1209
249 Ga0495613_0266987 3300046689 Bacteria 1191
250 Ga0495613_0393051 3300046689 Bacteria 947
251 Ga0495613_0471603 3300046689 Bacteria 848
252 Ga0495624_0012668 3300046690 Bacteria 5759
253 Ga0495624_0076811 3300046690 Bacteria 2072
254 Ga0495670_0305697 3300046691 Bacteria 853
255 Ga0495600_0177714 3300046809 Bacteria 1372
256 Ga0495581_0000640 3300047315 Bacteria 18312
257 Ga0495581_0113156 3300047315 Bacteria 1578
258 Ga0495604_0011032 3300047317 Bacteria 7172
259 Ga0495674_0027751 3300047319 Bacteria 5169
260 Ga0495674_0133510 3300047319 Bacteria 2090
261 Ga0495674_0312645 3300047319 Bacteria 1281
262 Ga0495676_0004984 3300047321 Bacteria 12176
263 Ga0495676_0043425 3300047321 Bacteria 3679
264 Ga0495676_0067647 3300047321 Bacteria 2763
265 Ga0495680_0003420 3300047322 Bacteria 15660
266 Ga0495680_0009501 3300047322 Bacteria 8739
267 Ga0495680_0156971 3300047322 Bacteria 1654
268 Ga0495675_0055337 3300047444 Bacteria 2516
269 Ga0495675_0526068 3300047444 Bacteria 677
270 Ga0495684_0009129 3300047471 Bacteria 7658
271 Ga0495593_0277614 3300047673 Unclassified 838
272 Ga0495593_0293246 3300047673 Bacteria 813
273 Ga0495602_0021120 3300048088 Bacteria 6416
274 Ga0495614_0148182 3300048089 Bacteria 1046
275 Ga0495614_0154553 3300048089 Bacteria 1024
276 Ga0496100_0084300 3300048903 Unclassified 2154
277 Ga0496101_0005607 3300048904 Bacteria 8009
278 Ga0496104_0115043 3300048907 Bacteria 2581
279 Ga0496104_0821922 3300048907 Bacteria 835
280 Ga0496104_0850591 3300048907 Unclassified 818
281 Ga0496109_0088811 3300048912 Bacteria 2857
282 Ga0496114_0003727 3300048917 Bacteria 11741
283 Ga0496114_0038881 3300048917 Bacteria 3937
284 Ga0496115_0000517 3300048918 Bacteria 30033
285 Ga0496115_0018648 3300048918 Bacteria 5333
286 Ga0496115_0074936 3300048918 Bacteria 2748
287 Ga0501032_0041691 3300049569 Bacteria 3116
288 Ga0501033_0003478 3300049570 Bacteria 12916
289 Ga0501036_0046268 3300049572 Bacteria 3684
290 Ga0501037_0048627 3300049573 Bacteria 3106
291 Ga0501038_0007188 3300049574 Bacteria 10293
292 Ga0501039_0006217 3300049575 Bacteria 9069
293 Ga0501040_0006556 3300049576 Bacteria 7557
294 Ga0501041_0044463 3300049577 Bacteria 2699
295 Ga0501043_0018915 3300049579 Bacteria 5405
296 Ga0501046_0006991 3300049580 Bacteria 9938
297 Ga0501048_0004133 3300049582 Bacteria 11066
298 Ga0501067_0018030 3300049583 Bacteria 3908
299 Ga0501068_0014707 3300049584 Bacteria 4477
300 Ga0501069_0005135 3300049585 Bacteria 6797
301 Ga0501069_0026844 3300049585 Bacteria 3154
302 Ga0501070_0020705 3300049586 Bacteria 5518
303 Ga0501070_0044711 3300049586 Bacteria 3683
304 Ga0501071_0046542 3300049587 Bacteria 3115
305 Ga0501071_0522723 3300049587 Bacteria 911
306 Ga0501072_0025169 3300049588 Bacteria 4634
307 Ga0501072_0184260 3300049588 Bacteria 1666
308 Ga0501072_0277198 3300049588 Bacteria 1334
309 Ga0501073_0021069 3300049589 Bacteria 4701
310 Ga0501073_0728818 3300049589 Bacteria 684
311 Ga0501074_0165369 3300049590 Bacteria 1579
312 Ga0501075_0021220 3300049591 Bacteria 4733
313 Ga0501076_1259056 3300049592 Bacteria 608
314 Ga0501077_0003506 3300049593 Bacteria 9416
315 Ga0501077_0075376 3300049593 Bacteria 2136
316 Ga0501079_0038158 3300049741 Bacteria 3705
317 Ga0501079_0043846 3300049741 Bacteria 3452
318 Ga0501079_0775831 3300049741 Unclassified 755
319 Ga0501080_0002220 3300049742 Bacteria 16878
320 Ga0501081_0044577 3300049743 Bacteria 3044
321 Ga0501081_0079834 3300049743 Bacteria 2289
322 Ga0501083_0004986 3300049744 Bacteria 9412
323 Ga0501035_0039793 3300049822 Bacteria 4253
324 Ga0501044_0095038 3300049823 Bacteria 3004
325 Ga0501045_0120446 3300049824 Bacteria 1948
326 nmdc:mga0n895_577705_c1 3300050512 Unclassified 1128
327 nmdc:mga08x19_540185_c1 3300050514 Unclassified 824
328 Ga0495612_0060076 3300053078 Bacteria 1573
329 Ga0495612_0068327 3300053078 Bacteria 1479
330 Ga0495655_0009518 3300053083 Bacteria 1887
331 Ga0495595_0016033 3300053084 Bacteria 3200
332 Ga0495595_0058393 3300053084 Bacteria 1801
333 Ga0495619_0001634 3300053085 Bacteria 14778
334 Ga0495619_0018201 3300053085 Bacteria 4456
335 Ga0495619_0124245 3300053085 Bacteria 1770
336 Ga0501084_0089574 3300054114 Bacteria 2582
337 Ga0501084_0238144 3300054114 Bacteria 1536
338 Ga0501082_0022132 3300060353 Bacteria 5478
339 Ga0466962_0038782 3300061719 Bacteria 2282
340 Ga0530510_0026118 3300061734 Bacteria 4177
341 Ga0530510_0054415 3300061734 Bacteria 2892
342 Ga0530510_0162487 3300061734 Bacteria 1652
343 Ga0070714_100070361
344 Ga0070658_10036296
345 Ga0070683_100028045
346 Ga0070683_100721593
347 Ga0070680_100005165
348 Ga0070660_100009589
349 Ga0070660_100177439
350 Ga0070660_100676288
351 Ga0070661_100010158
352 Ga0070659_100085353
353 Ga0070709_10128292
354 Ga0070714_100393377
355 Ga0070714_100491149
356 Ga0070714_100899315
357 Ga0070713_100275880
358 Ga0070711_100070125
359 Ga0070705_100856222
360 Ga0070708_100013199
361 Ga0070708_100170348
362 Ga0070681_10031827
363 Ga0070706_100009424
364 Ga0070706_101304304
365 Ga0070707_100088993
366 Ga0070698_100025410
367 Ga0070699_100011259
368 Ga0070679_101108534
369 Ga0070684_100022323
370 Ga0070684_100107788
371 Ga0070684_100114833
372 Ga0070697_100103868
373 Ga0070697_100345785
374 Ga0068853_100885406
375 Ga0070696_100212973
376 Ga0068855_100019212
377 Ga0068855_100029823
378 Ga0068855_100244227
379 Ga0068855_100946752
380 Ga0068857_100589534
381 Ga0068854_100459428
382 Ga0068856_100421316
383 Ga0068852_100065768
384 Ga0081455_10087631
385 Ga0081455_10088908
386 Ga0070717_10229301
387 Ga0070717_10645318
388 Ga0070712_100302472
389 Ga0075434_100470666
390 Ga0075435_100074406
391 Ga0105240_10036261
392 Ga0105240_10076431
393 Ga0105245_10083348
394 Ga0105242_10340812
395 Ga0105242_10827800
396 Ga0157342_1002595
397 Ga0157370_10011897
398 Ga0157370_10018188
399 Ga0157370_10311626
400 Ga0157369_10039970
401 Ga0157369_10102019
402 Ga0157369_10534739
403 Ga0157374_11157199
404 Ga0157372_10637027
405 Ga0157375_10073466
406 Ga0197907_11071431
407 Ga0206356_10072847
408 Ga0206356_10650768
409 Ga0206356_11455019
410 Ga0206356_11903022
411 Ga0206350_10270040
412 Ga0206354_10573710
413 Ga0206354_10601078
414 Ga0206354_11058928
415 Ga0206354_11238859
416 Ga0206353_10139855
417 Ga0206353_10159728
418 Ga0206353_10983179
419 Ga0213871_10020660
420 Ga0224712_10043266
421 Ga0224712_10076803
422 Ga0224712_10105501
423 Ga0207699_10110935
424 Ga0207705_10008362
425 Ga0207705_10288858
426 Ga0207705_10400581
427 Ga0207705_10427080
428 Ga0207684_10011311
429 Ga0207695_10170097
430 Ga0207695_10211180
431 Ga0207663_10153360
432 Ga0207657_10002868
433 Ga0207657_10081094
434 Ga0207646_10004531
435 Ga0207646_10146241
436 Ga0207646_10281304
437 Ga0207687_10290998
438 Ga0207664_10337736
439 Ga0207664_10436433
440 Ga0207690_10090489
441 Ga0207686_10479892
442 Ga0207661_10018237
443 Ga0207661_10198909
444 Ga0207667_10049080
445 Ga0207667_10078269
446 Ga0207667_10531483
447 Ga0207674_10943619
448 Ga0207698_10059871
449 Ga0265320_10155947
450 Ga0265329_10045697
451 Ga0265340_10095960
452 Ga0265327_10215210
453 Ga0265313_10015736
454 Ga0307416_100084643
455 Ga0307416_100112025
456 Ga0373951_0012484
457 Ga0373936_0063868
458 Ga0373945_0020201
459 Ga0373957_0160078
460 Ga0373943_0000138
461 Ga0373943_0057330
462 Ga0373946_0004165
463 Ga0373955_0027565
464 Ga0373924_0028207
465 Ga0373935_0295146
466 Ga0373927_0003815
467 Ga0373927_0354085
468 Ga0373947_0024553
469 Ga0373947_0030005
470 Ga0373947_0219890
471 Ga0373937_0029357
472 Ga0373937_0434152
473 Ga0373937_0459880
474 Ga0373925_0015551
475 Ga0373925_0023659
476 Ga0395899_0003423
477 Ga0395899_0005507
478 Ga0395899_0077479
479 Ga0395900_0001939
480 Ga0395900_0018693
481 Ga0395900_0090651
482 Ga0395900_0103235
483 Ga0395900_0114890
484 Ga0395900_0218705
485 Ga0395900_0490415
486 Ga0395898_0001631
487 Ga0395898_0006255
488 Ga0395898_0007682
489 Ga0395898_0093351
490 Ga0395898_0124366
491 Ga0395898_0593247
492 Ga0395905_0004368
493 Ga0395905_0083146
494 Ga0395905_0092691
495 Ga0395905_0233570
496 Ga0395905_0270999
497 Ga0395905_0272192
498 Ga0436364_0537611
499 Ga0395901_0000370
500 Ga0395901_0015385
501 Ga0395901_0043745
502 Ga0395901_0131542
503 Ga0395901_0930443
504 Ga0436365_0154975
505 Ga0436365_1101754
506 Ga0436360_0921741
507 Ga0436363_0193642
508 Ga0436363_1183800
509 Ga0466966_0342520
510 Ga0466961_0081436
511 Ga0466961_0150215
512 Ga0466963_0015359
513 Ga0466963_0021400
514 Ga0466963_0024233
515 Ga0466963_0061748
516 Ga0466963_0132547
517 Ga0466963_0164730
518 Ga0466964_0021039
519 Ga0466964_0091408
520 Ga0466964_0158314
521 Ga0466971_0022180
522 Ga0466968_0251718
523 Ga0466957_0020994
524 Ga0466960_0288046
525 Ga0466959_0001052
526 Ga0466959_0102365
527 Ga0466959_0113982
528 Ga0466959_0164410
529 Ga0466958_0012656
530 Ga0466958_0055153
531 Ga0466958_0080384
532 Ga0466967_0003283
533 Ga0466967_0010400
534 Ga0466967_0018200
535 Ga0466967_0019997
536 Ga0466967_0086734
537 Ga0466967_0370908
538 Ga0466967_0451523
539 Ga0466967_0500585
540 Ga0466967_0707754
541 Ga0466967_1334691
542 Ga0495592_0094128
543 Ga0495629_0001540
544 Ga0495629_0059623
545 Ga0495629_0145514
546 Ga0495641_0000345
547 Ga0495641_0137928
548 Ga0495651_0033458
549 Ga0495651_0070043
550 Ga0495653_0050997
551 Ga0495653_0085086
552 Ga0495582_0000583
553 Ga0495582_0266750
554 Ga0495639_0005645
555 Ga0495662_0068492
556 Ga0495662_0335444
557 Ga0495664_0166673
558 Ga0495585_0079236
559 Ga0495594_0016275
560 Ga0495608_0007115
561 Ga0495618_0269222
562 Ga0495628_0052140
563 Ga0495628_0632513
564 Ga0495630_0004171
565 Ga0495630_0024046
566 Ga0495630_0074113
567 Ga0495630_0240871
568 Ga0495652_0071384
569 Ga0495665_0001821
570 Ga0495640_0346393
571 Ga0495586_0010543
572 Ga0495586_0402208
573 Ga0495587_0047085
574 Ga0495645_0012467
575 Ga0495645_0022952
576 Ga0495667_0007330
577 Ga0495667_0013481
578 Ga0495635_0007892
579 Ga0495635_0152121
580 Ga0495635_0358886
581 Ga0495657_0254025
582 Ga0495599_0010008
583 Ga0495623_0061397
584 Ga0495647_0004161
585 Ga0495647_0218705
586 Ga0495658_0001781
587 Ga0495658_0048401
588 Ga0495613_0087564
589 Ga0495613_0200234
590 Ga0495613_0260021
591 Ga0495613_0266987
592 Ga0495613_0393051
593 Ga0495613_0471603
594 Ga0495624_0012668
595 Ga0495624_0076811
596 Ga0495670_0305697
597 Ga0495600_0177714
598 Ga0495581_0000640
599 Ga0495581_0113156
600 Ga0495604_0011032
601 Ga0495674_0027751
602 Ga0495674_0133510
603 Ga0495674_0312645
604 Ga0495676_0004984
605 Ga0495676_0043425
606 Ga0495676_0067647
607 Ga0495680_0003420
608 Ga0495680_0009501
609 Ga0495680_0156971
610 Ga0495675_0055337
611 Ga0495675_0526068
612 Ga0495684_0009129
613 Ga0495593_0277614
614 Ga0495593_0293246
615 Ga0495602_0021120
616 Ga0495614_0148182
617 Ga0495614_0154553
618 Ga0496100_0084300
619 Ga0496101_0005607
620 Ga0496104_0115043
621 Ga0496104_0821922
622 Ga0496104_0850591
623 Ga0496109_0088811
624 Ga0496114_0003727
625 Ga0496114_0038881
626 Ga0496115_0000517
627 Ga0496115_0018648
628 Ga0496115_0074936
629 Ga0501032_0041691
630 Ga0501033_0003478
631 Ga0501036_0046268
632 Ga0501037_0048627
633 Ga0501038_0007188
634 Ga0501039_0006217
635 Ga0501040_0006556
636 Ga0501041_0044463
637 Ga0501043_0018915
638 Ga0501046_0006991
639 Ga0501048_0004133
640 Ga0501067_0018030
641 Ga0501068_0014707
642 Ga0501069_0005135
643 Ga0501069_0026844
644 Ga0501070_0020705
645 Ga0501070_0044711
646 Ga0501071_0046542
647 Ga0501071_0522723
648 Ga0501072_0025169
649 Ga0501072_0184260
650 Ga0501072_0277198
651 Ga0501073_0021069
652 Ga0501073_0728818
653 Ga0501074_0165369
654 Ga0501075_0021220
655 Ga0501076_1259056
656 Ga0501077_0003506
657 Ga0501077_0075376
658 Ga0501079_0038158
659 Ga0501079_0043846
660 Ga0501079_0775831
661 Ga0501080_0002220
662 Ga0501081_0044577
663 Ga0501081_0079834
664 Ga0501083_0004986
665 Ga0501035_0039793
666 Ga0501044_0095038
667 Ga0501045_0120446
668 nmdc:mga0n895_577705_c1
669 nmdc:mga08x19_540185_c1
670 Ga0495612_0060076
671 Ga0495612_0068327
672 Ga0495655_0009518
673 Ga0495595_0016033
674 Ga0495595_0058393
675 Ga0495619_0001634
676 Ga0495619_0018201
677 Ga0495619_0124245
678 Ga0501084_0089574
679 Ga0501084_0238144
680 Ga0501082_0022132
681 Ga0466962_0038782
682 Ga0530510_0026118
683 Ga0530510_0054415
684 Ga0530510_0162487

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04545

Sigma70_r4

Sigma-70, region 4

130

179

0.98

PF04542

Sigma70_r2

Sigma-70 region 2

47

116

0.97

PF08281

Sigma70_r4_2

Sigma-70, region 4

124

177

0.96

Map