F415010

General Info

Members Datasets Scaffolds Average Seq Length
342 215 342 139

Family's Representative Sequence

Representative Sequence 3300005289|Ga0065704_10375361|Ga0065704_103753612
Length 164
Sequence LPAWGRKGVACILAVQFGKMNAREPTTMKSYREELWFETKTRCAYLNITEQIEAAVKKSGVQEGLVLVNAMHITASVYINDDEPGLLKDYDRFLDALVPQNATYRHNETGEDNGDAHIKRQLMGREVVVAITEGRLDFGPWEQIFYGEFDGLRRKRVLVKVIGS

Samples

Sample ID Description Type Environment
1 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
2 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
18 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
19 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
20 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
21 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
22 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
23 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
24 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
25 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
26 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
27 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
28 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
29 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
30 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
31 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
32 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
33 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
34 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
35 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
36 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
37 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
38 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
39 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
40 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
41 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
42 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
43 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
44 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
45 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
46 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
47 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
48 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
49 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
50 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
51 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
52 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
54 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
55 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
56 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
57 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
58 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
59 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
61 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
62 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
64 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
65 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
67 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
68 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
69 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
70 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
71 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
72 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
73 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
74 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
75 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
76 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
77 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
78 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
79 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
80 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
81 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
82 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
83 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
84 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
85 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
86 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
121 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
122 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
123 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
124 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
125 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
126 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
127 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
128 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
129 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
130 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
131 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
132 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
133 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
134 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
135 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
136 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
137 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
138 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
139 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
140 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
141 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
142 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
143 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
144 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
145 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
146 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
147 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
148 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
149 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
150 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
151 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
152 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
153 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
154 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
155 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
156 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
157 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
158 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
159 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
160 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
161 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
162 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
163 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
164 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
165 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
166 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
167 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
168 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
169 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
170 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
171 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
172 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
173 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
174 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
175 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
176 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
177 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
178 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
179 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
180 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
181 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
182 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
183 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
184 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
185 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
186 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
187 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
188 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
189 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
190 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
191 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
192 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
193 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
194 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
195 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
196 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
197 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
198 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
199 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
200 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
201 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
202 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
203 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
204 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
205 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
206 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
207 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
208 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
209 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
210 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
211 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
212 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
213 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
214 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
215 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.88
Nodule 0
Rhizoplane 0.29
Rhizosphere 97.95
Stem 0
Stem Tuber 0
Unclassified 0.88

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24743J22301_10004610 3300001991 Bacteria 2256
2 JGI24033J26618_1000013 3300002155 Bacteria 29954
3 rootH2_10004745 3300003320 Bacteria 53021
4 rootL2_10257196 3300003322 Bacteria 3068
5 Ga0065704_10375361 3300005289 Bacteria 780
6 Ga0070690_100000107 3300005330 Bacteria 43179
7 Ga0070670_101055949 3300005331 Bacteria 740
8 Ga0070680_100998050 3300005336 Bacteria 723
9 Ga0068868_100543555 3300005338 Bacteria 1023
10 Ga0070660_100249881 3300005339 Bacteria 1446
11 Ga0070689_100000022 3300005340 Bacteria 127360
12 Ga0070691_10275451 3300005341 Bacteria 911
13 Ga0070687_100016081 3300005343 Bacteria 3402
14 Ga0070687_100267534 3300005343 Bacteria 1070
15 Ga0070692_10600928 3300005345 Bacteria 728
16 Ga0070675_100191561 3300005354 Bacteria 1772
17 Ga0070673_100907382 3300005364 Bacteria 817
18 Ga0070688_100001378 3300005365 Bacteria 12071
19 Ga0070701_10000175 3300005438 Bacteria 19804
20 Ga0070705_100027286 3300005440 Bacteria 3117
21 Ga0070705_100081194 3300005440 Bacteria 1992
22 Ga0070700_101718072 3300005441 Bacteria 539
23 Ga0070694_100020147 3300005444 Bacteria 4249
24 Ga0070694_100244781 3300005444 Bacteria 1354
25 Ga0070694_100414904 3300005444 Bacteria 1057
26 Ga0070708_100084670 3300005445 Bacteria 2876
27 Ga0070708_100717339 3300005445 Bacteria 941
28 Ga0070708_100767026 3300005445 Unclassified 907
29 Ga0070708_100815999 3300005445 Bacteria 877
30 Ga0070681_10004685 3300005458 Bacteria 13080
31 Ga0070681_10554083 3300005458 Bacteria 1063
32 Ga0068867_100002394 3300005459 Bacteria 13193
33 Ga0070685_10000110 3300005466 Bacteria 52202
34 Ga0070706_100007399 3300005467 Bacteria 10299
35 Ga0070706_100056142 3300005467 Bacteria 3634
36 Ga0070707_100000110 3300005468 Bacteria 75472
37 Ga0070707_100033769 3300005468 Bacteria 4878
38 Ga0070707_100052127 3300005468 Bacteria 3922
39 Ga0070707_100340225 3300005468 Bacteria 1457
40 Ga0070698_100040721 3300005471 Bacteria 4774
41 Ga0070698_100128240 3300005471 Bacteria 2493
42 Ga0070698_100312680 3300005471 Bacteria 1502
43 Ga0070698_100330508 3300005471 Bacteria 1455
44 Ga0070698_100452892 3300005471 Bacteria 1219
45 Ga0070699_100005174 3300005518 Bacteria 11477
46 Ga0070699_100015955 3300005518 Bacteria 6450
47 Ga0070699_100018815 3300005518 Bacteria 5933
48 Ga0070699_100239064 3300005518 Bacteria 1620
49 Ga0070679_100195938 3300005530 Bacteria 1988
50 Ga0070679_100238697 3300005530 Bacteria 1776
51 Ga0070697_100023334 3300005536 Bacteria 4919
52 Ga0070697_100028513 3300005536 Bacteria 4470
53 Ga0070697_100028836 3300005536 Bacteria 4447
54 Ga0070697_100036874 3300005536 Bacteria 3949
55 Ga0070686_100000025 3300005544 Bacteria 127360
56 Ga0070686_100003946 3300005544 Bacteria 8158
57 Ga0070686_100398935 3300005544 Bacteria 1045
58 Ga0070695_100117852 3300005545 Bacteria 1812
59 Ga0070696_100016571 3300005546 Bacteria 4966
60 Ga0070696_100730398 3300005546 Unclassified 809
61 Ga0070665_100159574 3300005548 Bacteria 2257
62 Ga0070704_100105152 3300005549 Bacteria 2137
63 Ga0070704_100222443 3300005549 Bacteria 1535
64 Ga0070704_100805705 3300005549 Bacteria 839
65 Ga0068855_100108873 3300005563 Bacteria 3182
66 Ga0070664_100528913 3300005564 Bacteria 1089
67 Ga0068857_100020829 3300005577 Bacteria 5768
68 Ga0068856_100193726 3300005614 Bacteria 2046
69 Ga0070702_100050017 3300005615 Bacteria 2386
70 Ga0068859_100000648 3300005617 Bacteria 34840
71 Ga0068859_100510672 3300005617 Bacteria 1297
72 Ga0068866_10378677 3300005718 Bacteria 907
73 Ga0068861_100195447 3300005719 Bacteria 1694
74 Ga0068863_100175957 3300005841 Bacteria 2054
75 Ga0068863_100488839 3300005841 Bacteria 1211
76 Ga0068858_100007935 3300005842 Bacteria 10228
77 Ga0068860_100433994 3300005843 Bacteria 1304
78 Ga0081539_10039633 3300005985 Bacteria 2776
79 Ga0081539_10130889 3300005985 Bacteria 1232
80 Ga0070715_10539615 3300006163 Bacteria 674
81 Ga0070716_100029194 3300006173 Bacteria 2979
82 Ga0070712_100406163 3300006175 Bacteria 1126
83 Ga0097621_100008183 3300006237 Bacteria 7521
84 Ga0097621_100055197 3300006237 Bacteria 3243
85 Ga0097621_100229357 3300006237 Bacteria 1621
86 Ga0068871_100003662 3300006358 Bacteria 10564
87 Ga0068871_100046456 3300006358 Bacteria 3497
88 Ga0068871_100465035 3300006358 Bacteria 1136
89 Ga0068871_100470556 3300006358 Bacteria 1129
90 Ga0075431_100464354 3300006847 Bacteria 1260
91 Ga0075433_10008945 3300006852 Bacteria 7995
92 Ga0075434_100093312 3300006871 Bacteria 3013
93 Ga0068865_100146979 3300006881 Bacteria 1784
94 Ga0068865_100148814 3300006881 Bacteria 1774
95 Ga0075436_100100674 3300006914 Bacteria 2012
96 Ga0097620_100000648 3300006931 Bacteria 34840
97 Ga0097620_100510620 3300006931 Bacteria 1297
98 Ga0075435_100031733 3300007076 Bacteria 4166
99 Ga0105240_10015831 3300009093 Bacteria 10231
100 Ga0105240_10062864 3300009093 Bacteria 4620
101 Ga0111539_10006836 3300009094 Bacteria 14657
102 Ga0105245_10761675 3300009098 Bacteria 1004
103 Ga0105247_10098212 3300009101 Bacteria 1869
104 Ga0114129_10158588 3300009147 Bacteria 3093
105 Ga0114129_12465795 3300009147 Bacteria 622
106 Ga0105243_10366781 3300009148 Bacteria 1327
107 Ga0105241_10044900 3300009174 Bacteria 3350
108 Ga0105241_10197065 3300009174 Bacteria 1680
109 Ga0105242_10017692 3300009176 Bacteria 5559
110 Ga0105242_10023822 3300009176 Bacteria 4829
111 Ga0105242_10087306 3300009176 Bacteria 2619
112 Ga0105242_10442581 3300009176 Bacteria 1223
113 Ga0105248_10002205 3300009177 Bacteria 21578
114 Ga0105248_10065784 3300009177 Bacteria 4070
115 Ga0105237_10064120 3300009545 Bacteria 3671
116 Ga0105238_10035599 3300009551 Bacteria 5061
117 Ga0105238_10218584 3300009551 Bacteria 1881
118 Ga0105238_10226839 3300009551 Bacteria 1845
119 Ga0105249_10601524 3300009553 Bacteria 1154
120 Ga0105249_11845422 3300009553 Bacteria 677
121 Ga0105239_10018426 3300010375 Bacteria 7712
122 Ga0157370_10155937 3300013104 Bacteria 2124
123 Ga0157369_10067790 3300013105 Bacteria 3835
124 Ga0157374_11020755 3300013296 Bacteria 846
125 Ga0157378_10473906 3300013297 Bacteria 1246
126 Ga0157378_12003508 3300013297 Bacteria 629
127 Ga0157378_12004597 3300013297 Bacteria 629
128 Ga0163162_12416842 3300013306 Bacteria 604
129 Ga0157372_12483216 3300013307 Bacteria 595
130 Ga0157375_10015505 3300013308 Bacteria 6823
131 Ga0163163_10044095 3300014325 Bacteria 4375
132 Ga0157380_10123958 3300014326 Bacteria 2193
133 Ga0182008_10017341 3300014497 Archaea 3737
134 Ga0157379_10047364 3300014968 Bacteria 3835
135 Ga0157376_10039130 3300014969 Bacteria 3864
136 Ga0207653_10156722 3300025885 Bacteria 841
137 Ga0207642_10296024 3300025899 Bacteria 936
138 Ga0207642_10365098 3300025899 Bacteria 855
139 Ga0207642_10598998 3300025899 Bacteria 686
140 Ga0207685_10022783 3300025905 Unclassified 2122
141 Ga0207684_10199444 3300025910 Bacteria 1726
142 Ga0207684_10848217 3300025910 Bacteria 770
143 Ga0207654_10331495 3300025911 Bacteria 1043
144 Ga0207654_10564384 3300025911 Bacteria 809
145 Ga0207707_10024625 3300025912 Bacteria 5268
146 Ga0207707_10026324 3300025912 Bacteria 5084
147 Ga0207707_10027137 3300025912 Bacteria 5007
148 Ga0207707_10028704 3300025912 Bacteria 4861
149 Ga0207695_10035889 3300025913 Bacteria 5367
150 Ga0207695_10102244 3300025913 Bacteria 2859
151 Ga0207671_10079512 3300025914 Bacteria 2457
152 Ga0207660_10557996 3300025917 Bacteria 932
153 Ga0207662_10047696 3300025918 Bacteria 2537
154 Ga0207662_10257588 3300025918 Bacteria 1147
155 Ga0207652_11670029 3300025921 Bacteria 541
156 Ga0207646_10000035 3300025922 Bacteria 209056
157 Ga0207646_10216475 3300025922 Bacteria 1730
158 Ga0207646_10240673 3300025922 Bacteria 1635
159 Ga0207646_10384772 3300025922 Bacteria 1267
160 Ga0207646_10688884 3300025922 Bacteria 914
161 Ga0207659_10066807 3300025926 Bacteria 2611
162 Ga0207659_11246526 3300025926 Bacteria 639
163 Ga0207687_10654157 3300025927 Bacteria 889
164 Ga0207686_10095095 3300025934 Bacteria 1976
165 Ga0207686_10271629 3300025934 Bacteria 1247
166 Ga0207686_10281745 3300025934 Bacteria 1227
167 Ga0207686_11211769 3300025934 Bacteria 618
168 Ga0207670_10000023 3300025936 Bacteria 145527
169 Ga0207670_10414207 3300025936 Bacteria 1080
170 Ga0207704_10178339 3300025938 Bacteria 1532
171 Ga0207665_10115277 3300025939 Bacteria 1893
172 Ga0207711_10002514 3300025941 Bacteria 16336
173 Ga0207711_10050652 3300025941 Bacteria 3555
174 Ga0207711_11560381 3300025941 Bacteria 603
175 Ga0207689_10916260 3300025942 Bacteria 739
176 Ga0207667_10234290 3300025949 Bacteria 1879
177 Ga0207712_10786672 3300025961 Bacteria 835
178 Ga0207640_10655297 3300025981 Bacteria 895
179 Ga0207703_10032489 3300026035 Bacteria 4131
180 Ga0207639_10074105 3300026041 Bacteria 2672
181 Ga0207708_10000228 3300026075 Bacteria 44336
182 Ga0207702_10618958 3300026078 Bacteria 1063
183 Ga0207641_10481076 3300026088 Bacteria 1203
184 Ga0207641_11032941 3300026088 Bacteria 819
185 Ga0207648_10003116 3300026089 Bacteria 17512
186 Ga0207674_10009486 3300026116 Bacteria 11113
187 Ga0207675_100227679 3300026118 Bacteria 1798
188 Ga0207683_10639767 3300026121 Bacteria 985
189 Ga0268266_10037241 3300028379 Bacteria 4145
190 Ga0268264_11540426 3300028381 Bacteria 675
191 Ga0265337_1009339 3300028556 Bacteria 3504
192 Ga0265337_1061801 3300028556 Bacteria 1037
193 Ga0265326_10015151 3300028558 Bacteria 2241
194 Ga0265319_1005501 3300028563 Bacteria 6059
195 Ga0265334_10035798 3300028573 Bacteria 1963
196 Ga0265334_10080255 3300028573 Bacteria 1202
197 Ga0265318_10015289 3300028577 Bacteria 3197
198 Ga0265323_10014078 3300028653 Bacteria 3177
199 Ga0265323_10015978 3300028653 Bacteria 2939
200 Ga0265323_10036165 3300028653 Bacteria 1817
201 Ga0265323_10239863 3300028653 Bacteria 565
202 Ga0265322_10050908 3300028654 Bacteria 1176
203 Ga0265338_10000101 3300028800 Bacteria 159323
204 Ga0265338_10005734 3300028800 Bacteria 16058
205 Ga0265338_10049566 3300028800 Bacteria 3805
206 Ga0265338_10108449 3300028800 Bacteria 2242
207 Ga0265338_10612476 3300028800 Bacteria 758
208 Ga0265324_10002412 3300029957 Bacteria 9620
209 Ga0265324_10009118 3300029957 Bacteria 3893
210 Ga0265332_10053809 3300031238 Bacteria 1727
211 Ga0265320_10033216 3300031240 Bacteria 2635
212 Ga0265320_10148165 3300031240 Bacteria 1060
213 Ga0265325_10006703 3300031241 Bacteria 6967
214 Ga0265325_10024801 3300031241 Bacteria 3258
215 Ga0265340_10192056 3300031247 Bacteria 920
216 Ga0265339_10004033 3300031249 Bacteria 10143
217 Ga0265331_10085343 3300031250 Bacteria 1463
218 Ga0265316_10008681 3300031344 Bacteria 9405
219 Ga0265316_10046383 3300031344 Bacteria 3443
220 Ga0265313_10000993 3300031595 Bacteria 27845
221 Ga0265313_10036890 3300031595 Bacteria 2451
222 Ga0265313_10241900 3300031595 Bacteria 738
223 Ga0265314_10011963 3300031711 Bacteria 7116
224 Ga0265314_10019808 3300031711 Bacteria 5202
225 Ga0265314_10196489 3300031711 Bacteria 1196
226 Ga0265342_10213454 3300031712 Bacteria 1042
227 Ga0316576_10310266 3300031727 Bacteria 1178
228 Ga0316578_10017945 3300031728 Bacteria 3865
229 Ga0316578_10591970 3300031728 Bacteria 650
230 Ga0316577_10283814 3300031733 Bacteria 937
231 Ga0316577_10478666 3300031733 Bacteria 708
232 Ga0307407_10828413 3300031903 Bacteria 706
233 Ga0373934_0218510 3300035086 Bacteria 786
234 Ga0373923_0541533 3300035111 Bacteria 570
235 Ga0373936_0450668 3300035113 Bacteria 595
236 Ga0373953_0073910 3300035117 Bacteria 1410
237 Ga0373954_0119292 3300035118 Bacteria 1280
238 Ga0373956_0530113 3300035119 Bacteria 562
239 Ga0373946_0084184 3300035171 Bacteria 1398
240 Ga0373946_0089462 3300035171 Bacteria 1362
241 Ga0373955_0328885 3300035172 Bacteria 924
242 Ga0373924_0067617 3300035410 Bacteria 1503
243 Ga0373931_0674050 3300035691 Bacteria 681
244 Ga0373931_0823083 3300035691 Bacteria 620
245 Ga0373935_0043798 3300035692 Bacteria 2818
246 Ga0373935_0085142 3300035692 Bacteria 2060
247 Ga0373935_0816080 3300035692 Bacteria 689
248 Ga0373927_0003751 3300035695 Bacteria 10788
249 Ga0373927_0017689 3300035695 Bacteria 4690
250 Ga0373933_0422082 3300035724 Bacteria 871
251 Ga0373947_0003794 3300035725 Bacteria 8910
252 Ga0373947_0176467 3300035725 Unclassified 1389
253 Ga0316582_0004470 3300036647 Bacteria 7079
254 Ga0316582_0039198 3300036647 Bacteria 2949
255 Ga0316582_0559559 3300036647 Bacteria 788
256 Ga0316584_0024699 3300036712 Bacteria 4400
257 Ga0316584_0598720 3300036712 Archaea 765
258 Ga0373925_0002956 3300037068 Bacteria 13418
259 Ga0373925_0121844 3300037068 Bacteria 2025
260 Ga0373925_0463226 3300037068 Bacteria 1039
261 Ga0395905_0037494 3300037471 Bacteria 4551
262 Ga0316581_0127970 3300037588 Bacteria 783
263 Ga0436363_1079450 3300039450 Bacteria 3349
264 Ga0436362_0468795 3300039453 Bacteria 1458
265 Ga0439433_0043445 3300041999 Bacteria 1049
266 Ga0439460_0151255 3300042461 Bacteria 774
267 Ga0451577_0000360 3300042876 Bacteria 84786
268 Ga0451577_0000476 3300042876 Bacteria 68574
269 Ga0451577_0081612 3300042876 Bacteria 2884
270 Ga0451577_0120791 3300042876 Bacteria 2347
271 Ga0451577_0969833 3300042876 Bacteria 764
272 Ga0451577_0989573 3300042876 Bacteria 755
273 Ga0451577_1751710 3300042876 Bacteria 546
274 Ga0453683_0148631 3300044673 Bacteria 1480
275 Ga0453683_0628300 3300044673 Bacteria 701
276 Ga0466965_0071582 3300044683 Bacteria 1744
277 Ga0466963_0071672 3300044694 Bacteria 2333
278 Ga0453684_0000197 3300044712 Bacteria 264445
279 Ga0453684_0000261 3300044712 Bacteria 226765
280 Ga0453684_0013423 3300044712 Bacteria 13304
281 Ga0453684_0092885 3300044712 Bacteria 3718
282 Ga0453684_0208858 3300044712 Bacteria 2271
283 Ga0453684_1100623 3300044712 Bacteria 839
284 Ga0453684_1186641 3300044712 Bacteria 802
285 Ga0466971_0000008 3300044719 Bacteria 108703
286 Ga0451576_0000354 3300045051 Bacteria 110089
287 Ga0451576_0005886 3300045051 Bacteria 15218
288 Ga0451576_0026939 3300045051 Bacteria 6176
289 Ga0451576_2203340 3300045051 Bacteria 566
290 Ga0451576_2717684 3300045051 Bacteria 504
291 Ga0466967_0047641 3300045976 Bacteria 3737
292 Ga0495592_0136678 3300046454 Bacteria 1709
293 Ga0495603_0391474 3300046455 Bacteria 797
294 Ga0495603_0463015 3300046455 Bacteria 726
295 Ga0495653_0786473 3300046463 Bacteria 573
296 Ga0495582_0144270 3300046473 Bacteria 1350
297 Ga0495594_0003035 3300046499 Bacteria 8703
298 Ga0495594_0004201 3300046499 Bacteria 7394
299 Ga0495594_0476230 3300046499 Bacteria 710
300 Ga0495618_0566389 3300046514 Bacteria 679
301 Ga0495630_0144500 3300046517 Bacteria 1809
302 Ga0495640_0420381 3300046533 Bacteria 819
303 Ga0495622_0132026 3300046557 Bacteria 1137
304 Ga0495635_0044250 3300046663 Bacteria 3072
305 Ga0495658_0575836 3300046683 Bacteria 721
306 Ga0495624_0456953 3300046690 Bacteria 765
307 Ga0495581_0006289 3300047315 Bacteria 6886
308 Ga0495636_0076760 3300047318 Bacteria 1433
309 Ga0495680_0180405 3300047322 Bacteria 1524
310 Ga0495614_0175018 3300048089 Bacteria 964
311 Ga0496115_0146837 3300048918 Bacteria 1946
312 Ga0501032_0018457 3300049569 Bacteria 4887
313 Ga0501032_0137924 3300049569 Bacteria 1607
314 Ga0501037_0000080 3300049573 Bacteria 87262
315 Ga0501038_0000240 3300049574 Bacteria 46263
316 Ga0501069_0228394 3300049585 Bacteria 1083
317 Ga0501071_1610951 3300049587 Bacteria 501
318 Ga0501073_0168796 3300049589 Bacteria 1515
319 Ga0501075_0379232 3300049591 Bacteria 1078
320 Ga0501075_1150284 3300049591 Bacteria 589
321 Ga0501044_0003710 3300049823 Bacteria 17153
322 Ga0501045_0768157 3300049824 Bacteria 710
323 nmdc:mga05p37_1745461_c1 3300050507 Bacteria 604
324 nmdc:mga0qj67_94552_c1 3300050509 Bacteria 2404
325 nmdc:mga06r32_18937_c1 3300050510 Bacteria 6312
326 nmdc:mga08y16_53280_c1 3300050511 Bacteria 4231
327 nmdc:mga0n895_687339_c1 3300050512 Bacteria 1020
328 nmdc:mga0rr50_1501809_c1 3300050513 Bacteria 570
329 nmdc:mga08x19_77535_c1 3300050514 Bacteria 2176
330 nmdc:mga0a205_110573_c1 3300050515 Bacteria 2646
331 nmdc:mga0a205_36782_c1 3300050515 Bacteria 4706
332 nmdc:mga0a205_692593_c1 3300050515 Bacteria 869
333 Ga0495601_0151456 3300053077 Bacteria 1514
334 Ga0495601_0341350 3300053077 Bacteria 974
335 Ga0495595_0060550 3300053084 Bacteria 1772
336 Ga0495619_0111095 3300053085 Bacteria 1873
337 Ga0495619_0990955 3300053085 Bacteria 562
338 Ga0500555_000004 3300053103 Bacteria 343705
339 Ga0500556_0056385 3300053104 Bacteria 1435
340 Ga0500645_081131 3300053730 Bacteria 926
341 Ga0466962_0000004 3300061719 Bacteria 179133
342 Ga0530510_0050599 3300061734 Bacteria 3001

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300013307 Ga0157372_12483216 Ga0157372_124832161 115
2 3300025941 Ga0207711_11560381 Ga0207711_115603811 124
3 3300035691 Ga0373931_0674050 Ga0373931_0674050_146_541 130
4 3300006881 Ga0068865_100146979 Ga0068865_1001469793 136
5 3300025938 Ga0207704_10178339 Ga0207704_101783392 136
6 3300028573 Ga0265334_10080255 Ga0265334_100802552 136
7 3300031712 Ga0265342_10213454 Ga0265342_102134542 136
8 3300005289 Ga0065704_10375361 Ga0065704_103753612 137
9 3300005330 Ga0070690_100000107 Ga0070690_10000010715 137
10 3300005336 Ga0070680_100998050 Ga0070680_1009980501 137
11 3300005340 Ga0070689_100000022 Ga0070689_10000002214 137
12 3300005341 Ga0070691_10275451 Ga0070691_102754512 137
13 3300005343 Ga0070687_100016081 Ga0070687_1000160813 137
14 3300005345 Ga0070692_10600928 Ga0070692_106009282 137
15 3300005354 Ga0070675_100191561 Ga0070675_1001915612 137
16 3300005364 Ga0070673_100907382 Ga0070673_1009073821 137
17 3300005365 Ga0070688_100001378 Ga0070688_10000137812 137
18 3300005438 Ga0070701_10000175 Ga0070701_1000017514 137
19 3300005440 Ga0070705_100027286 Ga0070705_1000272864 137
20 3300005440 Ga0070705_100081194 Ga0070705_1000811943 137
21 3300005441 Ga0070700_101718072 Ga0070700_1017180721 137
22 3300005444 Ga0070694_100020147 Ga0070694_1000201471 137
23 3300005444 Ga0070694_100244781 Ga0070694_1002447811 137
24 3300005444 Ga0070694_100414904 Ga0070694_1004149042 137
25 3300005445 Ga0070708_100084670 Ga0070708_1000846702 137
26 3300005445 Ga0070708_100717339 Ga0070708_1007173392 137
27 3300005445 Ga0070708_100767026 Ga0070708_1007670261 137
28 3300005445 Ga0070708_100815999 Ga0070708_1008159992 137
29 3300005458 Ga0070681_10004685 Ga0070681_100046858 137
30 3300005458 Ga0070681_10554083 Ga0070681_105540832 137
31 3300005459 Ga0068867_100002394 Ga0068867_1000023944 137
32 3300005466 Ga0070685_10000110 Ga0070685_1000011014 137
33 3300005467 Ga0070706_100007399 Ga0070706_1000073994 137
34 3300005468 Ga0070707_100000110 Ga0070707_10000011034 137
35 3300005468 Ga0070707_100340225 Ga0070707_1003402252 137
36 3300005471 Ga0070698_100040721 Ga0070698_1000407212 137
37 3300005471 Ga0070698_100128240 Ga0070698_1001282402 137
38 3300005471 Ga0070698_100312680 Ga0070698_1003126802 137
39 3300005471 Ga0070698_100452892 Ga0070698_1004528921 137
40 3300005518 Ga0070699_100015955 Ga0070699_1000159553 137
41 3300005518 Ga0070699_100018815 Ga0070699_1000188153 137
42 3300005518 Ga0070699_100239064 Ga0070699_1002390642 137
43 3300005530 Ga0070679_100195938 Ga0070679_1001959382 137
44 3300005536 Ga0070697_100023334 Ga0070697_1000233343 137
45 3300005536 Ga0070697_100028513 Ga0070697_1000285135 137
46 3300005536 Ga0070697_100028836 Ga0070697_1000288365 137
47 3300005544 Ga0070686_100000025 Ga0070686_100000025117 137
48 3300005544 Ga0070686_100003946 Ga0070686_1000039469 137
49 3300005544 Ga0070686_100398935 Ga0070686_1003989352 137
50 3300005545 Ga0070695_100117852 Ga0070695_1001178522 137
51 3300005546 Ga0070696_100016571 Ga0070696_1000165716 137
52 3300005546 Ga0070696_100730398 Ga0070696_1007303981 137
53 3300005549 Ga0070704_100105152 Ga0070704_1001051522 137
54 3300005549 Ga0070704_100222443 Ga0070704_1002224431 137
55 3300005549 Ga0070704_100805705 Ga0070704_1008057052 137
56 3300005615 Ga0070702_100050017 Ga0070702_1000500172 137
57 3300005617 Ga0068859_100000648 Ga0068859_1000006487 137
58 3300005617 Ga0068859_100510672 Ga0068859_1005106722 137
59 3300005718 Ga0068866_10378677 Ga0068866_103786772 137
60 3300005719 Ga0068861_100195447 Ga0068861_1001954473 137
61 3300006237 Ga0097621_100055197 Ga0097621_1000551973 137
62 3300006358 Ga0068871_100003662 Ga0068871_1000036628 137
63 3300006852 Ga0075433_10008945 Ga0075433_100089457 137
64 3300006871 Ga0075434_100093312 Ga0075434_1000933122 137
65 3300006881 Ga0068865_100148814 Ga0068865_1001488142 137
66 3300006914 Ga0075436_100100674 Ga0075436_1001006742 137
67 3300006931 Ga0097620_100000648 Ga0097620_1000006487 137
68 3300006931 Ga0097620_100510620 Ga0097620_1005106202 137
69 3300007076 Ga0075435_100031733 Ga0075435_1000317334 137
70 3300009098 Ga0105245_10761675 Ga0105245_107616752 137
71 3300009147 Ga0114129_10158588 Ga0114129_101585882 137
72 3300009147 Ga0114129_12465795 Ga0114129_124657952 137
73 3300009148 Ga0105243_10366781 Ga0105243_103667811 137
74 3300009176 Ga0105242_10017692 Ga0105242_100176926 137
75 3300009176 Ga0105242_10023822 Ga0105242_100238222 137
76 3300009176 Ga0105242_10442581 Ga0105242_104425811 137
77 3300009177 Ga0105248_10002205 Ga0105248_1000220516 137
78 3300009553 Ga0105249_11845422 Ga0105249_118454221 137
79 3300013296 Ga0157374_11020755 Ga0157374_110207551 137
80 3300013297 Ga0157378_10473906 Ga0157378_104739062 137
81 3300013297 Ga0157378_12003508 Ga0157378_120035081 137
82 3300013308 Ga0157375_10015505 Ga0157375_100155057 137
83 3300014326 Ga0157380_10123958 Ga0157380_101239582 137
84 3300014969 Ga0157376_10039130 Ga0157376_100391303 137
85 3300025885 Ga0207653_10156722 Ga0207653_101567221 137
86 3300025899 Ga0207642_10365098 Ga0207642_103650981 137
87 3300025905 Ga0207685_10022783 Ga0207685_100227832 137
88 3300025912 Ga0207707_10026324 Ga0207707_100263242 137
89 3300025912 Ga0207707_10028704 Ga0207707_100287045 137
90 3300025917 Ga0207660_10557996 Ga0207660_105579961 137
91 3300025918 Ga0207662_10047696 Ga0207662_100476962 137
92 3300025921 Ga0207652_11670029 Ga0207652_116700291 137
93 3300025922 Ga0207646_10000035 Ga0207646_10000035155 137
94 3300025922 Ga0207646_10240673 Ga0207646_102406732 137
95 3300025922 Ga0207646_10384772 Ga0207646_103847722 137
96 3300025926 Ga0207659_11246526 Ga0207659_112465262 137
97 3300025927 Ga0207687_10654157 Ga0207687_106541571 137
98 3300025934 Ga0207686_10271629 Ga0207686_102716292 137
99 3300025934 Ga0207686_10281745 Ga0207686_102817452 137
100 3300025934 Ga0207686_11211769 Ga0207686_112117691 137
101 3300025936 Ga0207670_10000023 Ga0207670_1000002337 137
102 3300025939 Ga0207665_10115277 Ga0207665_101152772 137
103 3300025941 Ga0207711_10002514 Ga0207711_100025145 137
104 3300025942 Ga0207689_10916260 Ga0207689_109162602 137
105 3300026075 Ga0207708_10000228 Ga0207708_1000022826 137
106 3300026089 Ga0207648_10003116 Ga0207648_1000311610 137
107 3300026118 Ga0207675_100227679 Ga0207675_1002276792 137
108 3300035086 Ga0373934_0218510 Ga0373934_0218510_248_661 137
109 3300035111 Ga0373923_0541533 Ga0373923_0541533_44_457 137
110 3300035113 Ga0373936_0450668 Ga0373936_0450668_105_518 137
111 3300035117 Ga0373953_0073910 Ga0373953_0073910_161_574 137
112 3300035118 Ga0373954_0119292 Ga0373954_0119292_766_1179 137
113 3300035119 Ga0373956_0530113 Ga0373956_0530113_88_501 137
114 3300035171 Ga0373946_0089462 Ga0373946_0089462_55_468 137
115 3300035172 Ga0373955_0328885 Ga0373955_0328885_11_424 137
116 3300035410 Ga0373924_0067617 Ga0373924_0067617_531_944 137
117 3300035692 Ga0373935_0085142 Ga0373935_0085142_1057_1470 137
118 3300035692 Ga0373935_0816080 Ga0373935_0816080_89_502 137
119 3300035695 Ga0373927_0017689 Ga0373927_0017689_910_1323 137
120 3300035724 Ga0373933_0422082 Ga0373933_0422082_143_556 137
121 3300035725 Ga0373947_0176467 Ga0373947_0176467_796_1209 137
122 3300037068 Ga0373925_0121844 Ga0373925_0121844_96_509 137
123 3300037068 Ga0373925_0463226 Ga0373925_0463226_212_625 137
124 3300042461 Ga0439460_0151255 Ga0439460_0151255_12_449 137
125 3300042876 Ga0451577_0120791 Ga0451577_0120791_1691_2104 137
126 3300044673 Ga0453683_0628300 Ga0453683_0628300_141_578 137
127 3300044712 Ga0453684_1100623 Ga0453684_1100623_158_571 137
128 3300046454 Ga0495592_0136678 Ga0495592_0136678_190_603 137
129 3300046455 Ga0495603_0391474 Ga0495603_0391474_347_760 137
130 3300046455 Ga0495603_0463015 Ga0495603_0463015_221_658 137
131 3300046463 Ga0495653_0786473 Ga0495653_0786473_85_498 137
132 3300046473 Ga0495582_0144270 Ga0495582_0144270_550_963 137
133 3300046499 Ga0495594_0003035 Ga0495594_0003035_4374_4787 137
134 3300046499 Ga0495594_0004201 Ga0495594_0004201_1253_1666 137
135 3300046499 Ga0495594_0476230 Ga0495594_0476230_223_660 137
136 3300046514 Ga0495618_0566389 Ga0495618_0566389_248_661 137
137 3300046517 Ga0495630_0144500 Ga0495630_0144500_860_1273 137
138 3300046533 Ga0495640_0420381 Ga0495640_0420381_269_682 137
139 3300046557 Ga0495622_0132026 Ga0495622_0132026_183_596 137
140 3300046663 Ga0495635_0044250 Ga0495635_0044250_601_1014 137
141 3300046683 Ga0495658_0575836 Ga0495658_0575836_256_669 137
142 3300047315 Ga0495581_0006289 Ga0495581_0006289_4922_5335 137
143 3300047318 Ga0495636_0076760 Ga0495636_0076760_830_1243 137
144 3300047322 Ga0495680_0180405 Ga0495680_0180405_296_709 137
145 3300048089 Ga0495614_0175018 Ga0495614_0175018_243_656 137
146 3300050507 nmdc:mga05p37_1745461_c1 nmdc:mga05p37_1745461_c1_88_501 137
147 3300050509 nmdc:mga0qj67_94552_c1 nmdc:mga0qj67_94552_c1_90_527 137
148 3300050513 nmdc:mga0rr50_1501809_c1 nmdc:mga0rr50_1501809_c1_73_486 137
149 3300050514 nmdc:mga08x19_77535_c1 nmdc:mga08x19_77535_c1_1327_1740 137
150 3300050515 nmdc:mga0a205_36782_c1 nmdc:mga0a205_36782_c1_244_657 137
151 3300053077 Ga0495601_0151456 Ga0495601_0151456_980_1393 137
152 3300053077 Ga0495601_0341350 Ga0495601_0341350_286_699 137
153 3300053084 Ga0495595_0060550 Ga0495595_0060550_273_686 137
154 3300053085 Ga0495619_0111095 Ga0495619_0111095_476_889 137
155 3300053085 Ga0495619_0990955 Ga0495619_0990955_135_548 137
156 3300031727 Ga0316576_10310266 Ga0316576_103102661 138
157 3300031728 Ga0316578_10017945 Ga0316578_100179454 138
158 3300031733 Ga0316577_10283814 Ga0316577_102838141 138
159 3300036647 Ga0316582_0039198 Ga0316582_0039198_2063_2479 138
160 3300036712 Ga0316584_0024699 Ga0316584_0024699_3820_4236 138
161 3300042876 Ga0451577_0969833 Ga0451577_0969833_17_433 138
162 3300042876 Ga0451577_1751710 Ga0451577_1751710_95_511 138
163 3300044712 Ga0453684_0013423 Ga0453684_0013423_1239_1655 138
164 3300044712 Ga0453684_0092885 Ga0453684_0092885_1197_1613 138
165 3300044712 Ga0453684_0208858 Ga0453684_0208858_353_769 138
166 3300045051 Ga0451576_0026939 Ga0451576_0026939_3240_3656 138
167 3300045051 Ga0451576_2203340 Ga0451576_2203340_39_455 138
168 3300053103 Ga0500555_000004 Ga0500555_000004_139787_140203 138
169 3300053730 Ga0500645_081131 Ga0500645_081131_63_479 138
170 3300001991 JGI24743J22301_10004610 JGI24743J22301_100046102 139
171 3300002155 JGI24033J26618_1000013 JGI24033J26618_100001319 139
172 3300003320 rootH2_10004745 rootH2_1000474548 139
173 3300003322 rootL2_10257196 rootL2_102571964 139
174 3300005331 Ga0070670_101055949 Ga0070670_1010559491 139
175 3300005338 Ga0068868_100543555 Ga0068868_1005435552 139
176 3300005339 Ga0070660_100249881 Ga0070660_1002498812 139
177 3300005343 Ga0070687_100267534 Ga0070687_1002675342 139
178 3300005467 Ga0070706_100056142 Ga0070706_1000561426 139
179 3300005468 Ga0070707_100033769 Ga0070707_1000337693 139
180 3300005468 Ga0070707_100052127 Ga0070707_1000521276 139
181 3300005471 Ga0070698_100330508 Ga0070698_1003305081 139
182 3300005518 Ga0070699_100005174 Ga0070699_10000517416 139
183 3300005530 Ga0070679_100238697 Ga0070679_1002386972 139
184 3300005536 Ga0070697_100036874 Ga0070697_1000368746 139
185 3300005548 Ga0070665_100159574 Ga0070665_1001595742 139
186 3300005563 Ga0068855_100108873 Ga0068855_1001088731 139
187 3300005564 Ga0070664_100528913 Ga0070664_1005289132 139
188 3300005577 Ga0068857_100020829 Ga0068857_1000208296 139
189 3300005614 Ga0068856_100193726 Ga0068856_1001937262 139
190 3300005841 Ga0068863_100175957 Ga0068863_1001759572 139
191 3300005841 Ga0068863_100488839 Ga0068863_1004888391 139
192 3300005842 Ga0068858_100007935 Ga0068858_1000079356 139
193 3300005843 Ga0068860_100433994 Ga0068860_1004339941 139
194 3300005985 Ga0081539_10039633 Ga0081539_100396333 139
195 3300005985 Ga0081539_10130889 Ga0081539_101308891 139
196 3300006163 Ga0070715_10539615 Ga0070715_105396151 139
197 3300006173 Ga0070716_100029194 Ga0070716_1000291942 139
198 3300006175 Ga0070712_100406163 Ga0070712_1004061631 139
199 3300006237 Ga0097621_100008183 Ga0097621_1000081833 139
200 3300006237 Ga0097621_100229357 Ga0097621_1002293572 139
201 3300006358 Ga0068871_100046456 Ga0068871_1000464563 139
202 3300006358 Ga0068871_100465035 Ga0068871_1004650352 139
203 3300006358 Ga0068871_100470556 Ga0068871_1004705562 139
204 3300006847 Ga0075431_100464354 Ga0075431_1004643542 139
205 3300009093 Ga0105240_10015831 Ga0105240_100158317 139
206 3300009093 Ga0105240_10062864 Ga0105240_100628642 139
207 3300009094 Ga0111539_10006836 Ga0111539_100068362 139
208 3300009101 Ga0105247_10098212 Ga0105247_100982122 139
209 3300009174 Ga0105241_10044900 Ga0105241_100449003 139
210 3300009174 Ga0105241_10197065 Ga0105241_101970652 139
211 3300009176 Ga0105242_10087306 Ga0105242_100873062 139
212 3300009177 Ga0105248_10065784 Ga0105248_100657842 139
213 3300009545 Ga0105237_10064120 Ga0105237_100641204 139
214 3300009551 Ga0105238_10035599 Ga0105238_100355995 139
215 3300009551 Ga0105238_10218584 Ga0105238_102185842 139
216 3300009551 Ga0105238_10226839 Ga0105238_102268392 139
217 3300009553 Ga0105249_10601524 Ga0105249_106015242 139
218 3300010375 Ga0105239_10018426 Ga0105239_100184262 139
219 3300013104 Ga0157370_10155937 Ga0157370_101559372 139
220 3300013105 Ga0157369_10067790 Ga0157369_100677902 139
221 3300013297 Ga0157378_12004597 Ga0157378_120045971 139
222 3300013306 Ga0163162_12416842 Ga0163162_124168422 139
223 3300014325 Ga0163163_10044095 Ga0163163_100440956 139
224 3300014497 Ga0182008_10017341 Ga0182008_100173412 139
225 3300014968 Ga0157379_10047364 Ga0157379_100473642 139
226 3300025899 Ga0207642_10296024 Ga0207642_102960242 139
227 3300025899 Ga0207642_10598998 Ga0207642_105989982 139
228 3300025910 Ga0207684_10199444 Ga0207684_101994442 139
229 3300025910 Ga0207684_10848217 Ga0207684_108482172 139
230 3300025911 Ga0207654_10331495 Ga0207654_103314952 139
231 3300025911 Ga0207654_10564384 Ga0207654_105643841 139
232 3300025912 Ga0207707_10024625 Ga0207707_100246253 139
233 3300025912 Ga0207707_10027137 Ga0207707_100271372 139
234 3300025913 Ga0207695_10035889 Ga0207695_100358893 139
235 3300025913 Ga0207695_10102244 Ga0207695_101022442 139
236 3300025914 Ga0207671_10079512 Ga0207671_100795124 139
237 3300025918 Ga0207662_10257588 Ga0207662_102575883 139
238 3300025922 Ga0207646_10216475 Ga0207646_102164753 139
239 3300025922 Ga0207646_10688884 Ga0207646_106888842 139
240 3300025926 Ga0207659_10066807 Ga0207659_100668072 139
241 3300025934 Ga0207686_10095095 Ga0207686_100950952 139
242 3300025936 Ga0207670_10414207 Ga0207670_104142072 139
243 3300025941 Ga0207711_10050652 Ga0207711_100506525 139
244 3300025949 Ga0207667_10234290 Ga0207667_102342902 139
245 3300025961 Ga0207712_10786672 Ga0207712_107866721 139
246 3300025981 Ga0207640_10655297 Ga0207640_106552971 139
247 3300026035 Ga0207703_10032489 Ga0207703_100324894 139
248 3300026041 Ga0207639_10074105 Ga0207639_100741052 139
249 3300026078 Ga0207702_10618958 Ga0207702_106189581 139
250 3300026088 Ga0207641_10481076 Ga0207641_104810761 139
251 3300026088 Ga0207641_11032941 Ga0207641_110329412 139
252 3300026116 Ga0207674_10009486 Ga0207674_1000948611 139
253 3300026121 Ga0207683_10639767 Ga0207683_106397671 139
254 3300028379 Ga0268266_10037241 Ga0268266_100372411 139
255 3300028381 Ga0268264_11540426 Ga0268264_115404261 139
256 3300028556 Ga0265337_1009339 Ga0265337_10093392 139
257 3300028556 Ga0265337_1061801 Ga0265337_10618012 139
258 3300028558 Ga0265326_10015151 Ga0265326_100151512 139
259 3300028563 Ga0265319_1005501 Ga0265319_10055015 139
260 3300028573 Ga0265334_10035798 Ga0265334_100357982 139
261 3300028577 Ga0265318_10015289 Ga0265318_100152894 139
262 3300028653 Ga0265323_10014078 Ga0265323_100140784 139
263 3300028653 Ga0265323_10015978 Ga0265323_100159781 139
264 3300028653 Ga0265323_10036165 Ga0265323_100361652 139
265 3300028653 Ga0265323_10239863 Ga0265323_102398631 139
266 3300028654 Ga0265322_10050908 Ga0265322_100509081 139
267 3300028800 Ga0265338_10000101 Ga0265338_1000010110 139
268 3300028800 Ga0265338_10005734 Ga0265338_100057344 139
269 3300028800 Ga0265338_10049566 Ga0265338_100495662 139
270 3300028800 Ga0265338_10108449 Ga0265338_101084492 139
271 3300028800 Ga0265338_10612476 Ga0265338_106124762 139
272 3300029957 Ga0265324_10002412 Ga0265324_100024122 139
273 3300029957 Ga0265324_10009118 Ga0265324_100091182 139
274 3300031238 Ga0265332_10053809 Ga0265332_100538092 139
275 3300031240 Ga0265320_10033216 Ga0265320_100332162 139
276 3300031240 Ga0265320_10148165 Ga0265320_101481652 139
277 3300031241 Ga0265325_10006703 Ga0265325_100067032 139
278 3300031241 Ga0265325_10024801 Ga0265325_100248012 139
279 3300031247 Ga0265340_10192056 Ga0265340_101920562 139
280 3300031249 Ga0265339_10004033 Ga0265339_100040336 139
281 3300031250 Ga0265331_10085343 Ga0265331_100853432 139
282 3300031344 Ga0265316_10008681 Ga0265316_100086814 139
283 3300031344 Ga0265316_10046383 Ga0265316_100463832 139
284 3300031595 Ga0265313_10000993 Ga0265313_100009933 139
285 3300031595 Ga0265313_10036890 Ga0265313_100368902 139
286 3300031595 Ga0265313_10241900 Ga0265313_102419001 139
287 3300031711 Ga0265314_10011963 Ga0265314_100119638 139
288 3300031711 Ga0265314_10019808 Ga0265314_100198085 139
289 3300031711 Ga0265314_10196489 Ga0265314_101964892 139
290 3300031728 Ga0316578_10591970 Ga0316578_105919701 139
291 3300031733 Ga0316577_10478666 Ga0316577_104786661 139
292 3300031903 Ga0307407_10828413 Ga0307407_108284132 139
293 3300035171 Ga0373946_0084184 Ga0373946_0084184_364_783 139
294 3300035691 Ga0373931_0823083 Ga0373931_0823083_118_537 139
295 3300035692 Ga0373935_0043798 Ga0373935_0043798_579_998 139
296 3300035695 Ga0373927_0003751 Ga0373927_0003751_4383_4802 139
297 3300035725 Ga0373947_0003794 Ga0373947_0003794_6679_7098 139
298 3300036647 Ga0316582_0004470 Ga0316582_0004470_1595_2014 139
299 3300036647 Ga0316582_0559559 Ga0316582_0559559_140_583 139
300 3300036712 Ga0316584_0598720 Ga0316584_0598720_160_579 139
301 3300037068 Ga0373925_0002956 Ga0373925_0002956_74_493 139
302 3300037471 Ga0395905_0037494 Ga0395905_0037494_166_627 139
303 3300037588 Ga0316581_0127970 Ga0316581_0127970_327_746 139
304 3300039450 Ga0436363_1079450 Ga0436363_1079450_305_724 139
305 3300039453 Ga0436362_0468795 Ga0436362_0468795_242_661 139
306 3300041999 Ga0439433_0043445 Ga0439433_0043445_82_501 139
307 3300042876 Ga0451577_0000360 Ga0451577_0000360_6261_6680 139
308 3300042876 Ga0451577_0000476 Ga0451577_0000476_59481_59900 139
309 3300042876 Ga0451577_0081612 Ga0451577_0081612_1107_1529 139
310 3300042876 Ga0451577_0989573 Ga0451577_0989573_41_460 139
311 3300044673 Ga0453683_0148631 Ga0453683_0148631_21_440 139
312 3300044683 Ga0466965_0071582 Ga0466965_0071582_84_503 139
313 3300044694 Ga0466963_0071672 Ga0466963_0071672_996_1415 139
314 3300044712 Ga0453684_0000197 Ga0453684_0000197_191417_191836 139
315 3300044712 Ga0453684_0000261 Ga0453684_0000261_74956_75375 139
316 3300044712 Ga0453684_1186641 Ga0453684_1186641_172_594 139
317 3300044719 Ga0466971_0000008 Ga0466971_0000008_57277_57696 139
318 3300045051 Ga0451576_0000354 Ga0451576_0000354_55250_55669 139
319 3300045051 Ga0451576_0005886 Ga0451576_0005886_9277_9696 139
320 3300045051 Ga0451576_2717684 Ga0451576_2717684_49_468 139
321 3300045976 Ga0466967_0047641 Ga0466967_0047641_1205_1624 139
322 3300046690 Ga0495624_0456953 Ga0495624_0456953_63_482 139
323 3300048918 Ga0496115_0146837 Ga0496115_0146837_1119_1538 139
324 3300049569 Ga0501032_0018457 Ga0501032_0018457_3464_3883 139
325 3300049569 Ga0501032_0137924 Ga0501032_0137924_458_877 139
326 3300049573 Ga0501037_0000080 Ga0501037_0000080_22008_22427 139
327 3300049574 Ga0501038_0000240 Ga0501038_0000240_18185_18604 139
328 3300049585 Ga0501069_0228394 Ga0501069_0228394_299_718 139
329 3300049587 Ga0501071_1610951 Ga0501071_1610951_25_444 139
330 3300049589 Ga0501073_0168796 Ga0501073_0168796_928_1347 139
331 3300049591 Ga0501075_0379232 Ga0501075_0379232_291_710 139
332 3300049591 Ga0501075_1150284 Ga0501075_1150284_121_540 139
333 3300049823 Ga0501044_0003710 Ga0501044_0003710_11277_11696 139
334 3300049824 Ga0501045_0768157 Ga0501045_0768157_74_496 139
335 3300050510 nmdc:mga06r32_18937_c1 nmdc:mga06r32_18937_c1_511_930 139
336 3300050511 nmdc:mga08y16_53280_c1 nmdc:mga08y16_53280_c1_1664_2086 139
337 3300050512 nmdc:mga0n895_687339_c1 nmdc:mga0n895_687339_c1_233_652 139
338 3300050515 nmdc:mga0a205_110573_c1 nmdc:mga0a205_110573_c1_122_541 139
339 3300050515 nmdc:mga0a205_692593_c1 nmdc:mga0a205_692593_c1_437_856 139
340 3300053104 Ga0500556_0056385 Ga0500556_0056385_610_1029 139
341 3300061719 Ga0466962_0000004 Ga0466962_0000004_50762_51181 139
342 3300061734 Ga0530510_0050599 Ga0530510_0050599_1471_1893 139

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01894

UPF0047

Uncharacterised protein family UPF0047

47

161

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
1vmj-assembly1.cif.gz_A crystal structure of a putative thiamin phosphate synthase (tm0723) from thermotoga maritima msb8 at 1.52 a resolution 0.9836 1 139
2p6c-assembly1.cif.gz_A crystal structure of hypothetical protein aq_2013 from aquifex aeolicus vf5. 0.975 1 139
2p6c-assembly1.cif.gz_A crystal structure of hypothetical protein aq_2013 from aquifex aeolicus vf5. 0.9681 1 139
1xbf-assembly1.cif.gz_C x-ray structure northeast structural genomics consortium target car10 from c. acetobutylicum 0.9637 4 137
1xbf-assembly1.cif.gz_C x-ray structure northeast structural genomics consortium target car10 from c. acetobutylicum 0.9482 4 137
ID Description Score Start End Superfamily
2p6cB00 Mainly Beta;Sandwich;Jelly Rolls;YjbQ-like 0.9747 1 139 2.60.120.460
2p6cB00 Mainly Beta;Sandwich;Jelly Rolls;YjbQ-like 0.9678 1 139 2.60.120.460
1xbfB00 Mainly Beta;Sandwich;Jelly Rolls;YjbQ-like 0.9528 6 137 2.60.120.460
2p6hB00 Mainly Beta;Sandwich;Jelly Rolls;YjbQ-like 0.9458 4 139 2.60.120.460
1vphC00 Mainly Beta;Sandwich;Jelly Rolls;YjbQ-like 0.9438 2 139 2.60.120.460
ID Description Score Start End GO Terms
AF-C8W673-F1-model_v4 Polynucleotide adenylyltransferase/metal dependent phosphohydrolase (EC 2.7.7.72) 0.9922 1 139 GO:0000049
GO:0000166
GO:0008033
GO:0016787
GO:0160016
AF-A7C3B4-F1-model_v4 deleted 0.9922 2 139
AF-A0A1V4XI05-F1-model_v4 Secondary thiamine-phosphate synthase enzyme 0.992 2 139
AF-A0A2N5YRF0-F1-model_v4 Secondary thiamine-phosphate synthase enzyme 0.9917 1 139
AF-A0A821KC14-F1-model_v4 Secondary thiamine-phosphate synthase enzyme 0.9917 5 139

Feature Viewer

pLDDT pTM Quality
95.6 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map