F414980

General Info

Members Datasets Scaffolds Average Seq Length
341 192 331 72

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|8055412473|8055413411
Length 66
Sequence LTVKEAAARLGTTERFPRRLIAERRIRYVKLGGSHVRIPESALAEFIASGVVEPVTVSWSGGKVVA

Samples

Sample ID Description Type Environment
1 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
2 2791355406 Streptomyces rhizosphaericus NRRL B-24304 Isolate Unclassified
3 2808606982 Streptomyces sp. SLBN-118 Isolate Unclassified
4 2995463766 Streptacidiphilus fuscans NEAU-YB345 Isolate Unclassified
5 3002998708 Actinomadura barringtoniae GKU 128 Isolate Unclassified
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
8 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
9 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
10 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
11 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
12 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
13 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
14 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
15 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
16 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
17 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
18 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
19 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
20 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
21 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
22 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
23 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
24 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
25 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
26 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
27 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
28 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
29 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
30 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
31 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
32 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
33 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
34 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
35 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
36 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
37 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
38 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
39 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
40 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
41 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
42 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
43 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
44 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
45 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
46 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
47 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
48 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
49 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
66 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
67 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
68 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
69 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
70 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
71 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
72 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
73 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
74 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
75 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
76 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
77 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
78 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
79 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
80 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
81 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
82 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
83 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
84 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
85 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
86 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
87 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
88 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
89 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
90 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
91 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
92 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
93 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
94 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
95 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
96 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
97 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
98 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
99 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
100 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
101 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
102 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
103 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
104 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
105 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
106 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
107 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
108 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
109 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
110 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
111 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
112 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
113 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
114 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
115 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
116 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
117 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
118 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
119 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
120 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
121 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
122 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
123 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
124 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
125 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
126 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
127 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
128 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
129 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
130 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
131 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
132 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
133 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
134 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
135 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
136 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
137 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
138 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
139 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
140 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
141 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
142 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
143 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
144 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
145 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
146 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
147 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
148 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
149 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
150 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
151 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
152 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
153 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
154 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
155 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
156 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
157 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
158 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
159 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
160 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
161 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
162 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
163 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
164 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
165 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
166 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
167 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
168 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
169 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
170 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
171 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
172 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
173 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
174 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
175 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
176 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
177 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
178 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
179 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
180 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
181 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
182 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
183 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
184 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
185 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
186 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
187 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
188 8008485437 Streptomyces mimosae 3MP-10 Isolate Unclassified
189 8025524527 Streptomyces sp. 3MP-14 Isolate Unclassified
190 8048356638 Streptomyces rhizosphaericus DSM 41760 Isolate Rhizosphere
191 8055412473 Micromonospora phytophila DSM 105363 Isolate Nodule
192 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.07
Metatranscriptomes 0
Isolates 2.93

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.29
Nodule 0.29
Rhizoplane 2.05
Rhizosphere 94.43
Stem 0
Stem Tuber 0
Unclassified 2.93

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070682_101959184 3300005337 Bacteria 514
2 Ga0070674_100388695 3300005356 Bacteria 1137
3 Ga0070709_10031113 3300005434 Bacteria 3208
4 Ga0070709_10794535 3300005434 Unclassified 742
5 Ga0070709_10891246 3300005434 Unclassified 703
6 Ga0070714_100122870 3300005435 Bacteria 2311
7 Ga0070714_101477202 3300005435 Bacteria 664
8 Ga0070714_102494164 3300005435 Bacteria 502
9 Ga0070714_102494707 3300005435 Unclassified 502
10 Ga0070713_100119274 3300005436 Bacteria 2311
11 Ga0070713_100921823 3300005436 Bacteria 841
12 Ga0070713_101275388 3300005436 Bacteria 712
13 Ga0070713_101621597 3300005436 Bacteria 628
14 Ga0070710_10005047 3300005437 Bacteria 6248
15 Ga0070710_10284414 3300005437 Bacteria 1074
16 Ga0070710_10367587 3300005437 Bacteria 956
17 Ga0070710_10550359 3300005437 Bacteria 797
18 Ga0070711_100074702 3300005439 Bacteria 2398
19 Ga0070711_100161795 3300005439 Bacteria 1697
20 Ga0070711_100269972 3300005439 Bacteria 1342
21 Ga0070711_100287195 3300005439 Bacteria 1304
22 Ga0070711_100883432 3300005439 Unclassified 762
23 Ga0070711_101055253 3300005439 Unclassified 699
24 Ga0070708_100000768 3300005445 Bacteria 24119
25 Ga0070708_100015389 3300005445 Bacteria 6317
26 Ga0070708_100126445 3300005445 Bacteria 2363
27 Ga0070706_100134947 3300005467 Bacteria 2304
28 Ga0070706_100258698 3300005467 Bacteria 1625
29 Ga0070706_101573341 3300005467 Bacteria 600
30 Ga0070707_100011408 3300005468 Bacteria 8286
31 Ga0070699_100002369 3300005518 Bacteria 16907
32 Ga0070693_100429158 3300005547 Unclassified 923
33 Ga0068856_100734991 3300005614 Bacteria 1007
34 Ga0070702_101146957 3300005615 Unclassified 623
35 Ga0068866_10147419 3300005718 Bacteria 1359
36 Ga0081455_11043161 3300005937 Bacteria 505
37 Ga0070717_10012264 3300006028 Bacteria 6534
38 Ga0070717_10204017 3300006028 Bacteria 1733
39 Ga0070715_10331384 3300006163 Bacteria 825
40 Ga0070716_100008990 3300006173 Bacteria 4970
41 Ga0070716_101331471 3300006173 Bacteria 581
42 Ga0070712_100015374 3300006175 Bacteria 4928
43 Ga0070712_100147949 3300006175 Bacteria 1800
44 Ga0070712_100529058 3300006175 Bacteria 991
45 Ga0070712_101281393 3300006175 Unclassified 638
46 Ga0070712_101716326 3300006175 Bacteria 550
47 Ga0075428_100365357 3300006844 Bacteria 1548
48 Ga0075430_100672401 3300006846 Unclassified 854
49 Ga0075431_100019042 3300006847 Bacteria 6994
50 Ga0075433_10048620 3300006852 Bacteria 3689
51 Ga0075434_100044999 3300006871 Bacteria 4378
52 Ga0075434_100061327 3300006871 Bacteria 3741
53 Ga0075434_101865430 3300006871 Bacteria 607
54 Ga0075429_100887082 3300006880 Unclassified 781
55 Ga0075436_100630558 3300006914 Bacteria 791
56 Ga0075436_100781339 3300006914 Bacteria 710
57 Ga0075435_100024383 3300007076 Bacteria 4694
58 Ga0075435_100070637 3300007076 Bacteria 2850
59 Ga0075435_101256348 3300007076 Bacteria 648
60 Ga0105240_11913203 3300009093 Unclassified 617
61 Ga0111539_11114282 3300009094 Bacteria 917
62 Ga0105245_10299134 3300009098 Bacteria 1578
63 Ga0105245_10743689 3300009098 Unclassified 1016
64 Ga0114129_10353680 3300009147 Bacteria 1945
65 Ga0114129_13206547 3300009147 Bacteria 532
66 Ga0105243_10064142 3300009148 Bacteria 2946
67 Ga0105243_12237388 3300009148 Unclassified 584
68 Ga0105237_11252447 3300009545 Unclassified 748
69 Ga0105249_10085559 3300009553 Bacteria 2938
70 Ga0105249_13442852 3300009553 Unclassified 509
71 Ga0105246_10213916 3300011119 Bacteria 1506
72 Ga0157369_10426454 3300013105 Bacteria 1375
73 Ga0157378_10403205 3300013297 Bacteria 1348
74 Ga0157378_12201751 3300013297 Unclassified 602
75 Ga0163162_13136343 3300013306 Unclassified 531
76 Ga0157375_10196314 3300013308 Bacteria 2173
77 Ga0157375_10441766 3300013308 Bacteria 1467
78 Ga0157380_11972027 3300014326 Unclassified 645
79 Ga0163161_10159814 3300017792 Bacteria 1718
80 Ga0207426_1022696 3300025302 Bacteria 2150
81 Ga0207692_10020703 3300025898 Bacteria 2997
82 Ga0207692_10097315 3300025898 Bacteria 1609
83 Ga0207642_10024706 3300025899 Bacteria 2420
84 Ga0207642_11117576 3300025899 Unclassified 510
85 Ga0207699_10013323 3300025906 Bacteria 4206
86 Ga0207699_10317197 3300025906 Bacteria 1092
87 Ga0207684_10182857 3300025910 Bacteria 1808
88 Ga0207684_10814284 3300025910 Bacteria 789
89 Ga0207684_11314819 3300025910 Bacteria 595
90 Ga0207693_10017666 3300025915 Bacteria 5687
91 Ga0207693_10097716 3300025915 Bacteria 2303
92 Ga0207693_10209521 3300025915 Bacteria 1532
93 Ga0207693_10297529 3300025915 Bacteria 1264
94 Ga0207693_10467081 3300025915 Bacteria 986
95 Ga0207663_10009627 3300025916 Bacteria 5115
96 Ga0207663_10023947 3300025916 Bacteria 3512
97 Ga0207663_10151059 3300025916 Bacteria 1629
98 Ga0207687_10841185 3300025927 Unclassified 784
99 Ga0207700_10005716 3300025928 Bacteria 7472
100 Ga0207700_10316530 3300025928 Bacteria 1351
101 Ga0207700_10918748 3300025928 Bacteria 783
102 Ga0207700_11342012 3300025928 Bacteria 637
103 Ga0207700_11769861 3300025928 Bacteria 544
104 Ga0207664_10077015 3300025929 Bacteria 2701
105 Ga0207664_10110083 3300025929 Bacteria 2289
106 Ga0207664_11331240 3300025929 Bacteria 638
107 Ga0207644_10946817 3300025931 Bacteria 722
108 Ga0207686_10134160 3300025934 Bacteria 1702
109 Ga0207686_11661102 3300025934 Unclassified 528
110 Ga0207709_10083141 3300025935 Bacteria 2069
111 Ga0207704_11470309 3300025938 Unclassified 584
112 Ga0207665_10002522 3300025939 Bacteria 12316
113 Ga0207712_10091615 3300025961 Bacteria 2240
114 Ga0207675_101632965 3300026118 Unclassified 665
115 Ga0307508_10028141 3300031616 Bacteria 5084
116 Ga0307514_10583923 3300031649 Bacteria 507
117 Ga0307413_11885304 3300031824 Bacteria 537
118 Ga0307406_10361184 3300031901 Bacteria 1138
119 Ga0307409_101338680 3300031995 Bacteria 742
120 Ga0307416_100132347 3300032002 Bacteria 2248
121 Ga0307507_10398929 3300033179 Bacteria 783
122 Ga0373926_0351020 3300035083 Bacteria 579
123 Ga0373934_0000052 3300035086 Bacteria 39557
124 Ga0373934_0000826 3300035086 Bacteria 11176
125 Ga0373944_0163617 3300035089 Bacteria 790
126 Ga0373923_0014184 3300035111 Bacteria 2988
127 Ga0373923_0095959 3300035111 Bacteria 1302
128 Ga0373923_0150176 3300035111 Bacteria 1058
129 Ga0373936_0002592 3300035113 Bacteria 6776
130 Ga0373936_0025544 3300035113 Bacteria 2310
131 Ga0373945_0007176 3300035116 Bacteria 3606
132 Ga0373953_0000049 3300035117 Bacteria 30634
133 Ga0373953_0042185 3300035117 Bacteria 1817
134 Ga0373954_0002010 3300035118 Bacteria 8449
135 Ga0373954_0048285 3300035118 Bacteria 1994
136 Ga0373956_0002102 3300035119 Bacteria 8257
137 Ga0373956_0148284 3300035119 Bacteria 1103
138 Ga0373957_0000096 3300035120 Bacteria 20961
139 Ga0373957_0024479 3300035120 Bacteria 2168
140 Ga0373943_0000655 3300035170 Bacteria 14996
141 Ga0373943_0068659 3300035170 Bacteria 1790
142 Ga0373946_0000492 3300035171 Bacteria 13089
143 Ga0373946_0124913 3300035171 Bacteria 1178
144 Ga0373955_0000313 3300035172 Bacteria 20150
145 Ga0373955_0008903 3300035172 Bacteria 4680
146 Ga0373924_0000017 3300035410 Bacteria 42763
147 Ga0373924_0057189 3300035410 Bacteria 1626
148 Ga0373924_0192470 3300035410 Bacteria 899
149 Ga0373931_0150772 3300035691 Bacteria 1355
150 Ga0373935_0001003 3300035692 Bacteria 15351
151 Ga0373935_0056035 3300035692 Bacteria 2512
152 Ga0373927_0001070 3300035695 Bacteria 20944
153 Ga0373933_0000079 3300035724 Bacteria 60394
154 Ga0373933_0016508 3300035724 Bacteria 4130
155 Ga0373947_0000830 3300035725 Bacteria 18648
156 Ga0373947_0413520 3300035725 Bacteria 911
157 Ga0373947_0573447 3300035725 Bacteria 769
158 Ga0373947_0645171 3300035725 Bacteria 722
159 Ga0373937_0000189 3300036401 Bacteria 60393
160 Ga0373937_0001102 3300036401 Bacteria 22734
161 Ga0373925_0017177 3300037068 Bacteria 5239
162 Ga0373925_0075275 3300037068 Bacteria 2558
163 Ga0373925_0097393 3300037068 Bacteria 2256
164 Ga0373925_0543547 3300037068 Bacteria 955
165 Ga0395901_1801483 3300038443 Bacteria 561
166 Ga0436363_0523736 3300039450 Bacteria 931
167 Ga0451797_0129694 3300041453 Unclassified 570
168 Ga0451797_1374536 3300041453 Bacteria 714
169 Ga0451798_0659557 3300041458 Bacteria 562
170 Ga0451802_1423631 3300041460 Unclassified 828
171 Ga0439448_0030127 3300042005 Bacteria 1720
172 Ga0439448_0059763 3300042005 Unclassified 1259
173 Ga0439463_010506 3300042016 Bacteria 2273
174 Ga0439463_129341 3300042016 Bacteria 653
175 Ga0439440_0035291 3300042993 Bacteria 1199
176 Ga0466969_0082358 3300044656 Bacteria 1534
177 Ga0466971_0057650 3300044719 Bacteria 1752
178 Ga0466970_0027612 3300044765 Bacteria 2978
179 Ga0466970_0389483 3300044765 Unclassified 794
180 Ga0466957_0006776 3300044842 Bacteria 6473
181 Ga0466959_0102540 3300045049 Unclassified 2048
182 Ga0466959_0399353 3300045049 Unclassified 934
183 Ga0466958_0004596 3300045836 Bacteria 7311
184 Ga0466967_0015696 3300045976 Bacteria 5948
185 Ga0495592_0000154 3300046454 Bacteria 59985
186 Ga0495592_0006132 3300046454 Bacteria 8939
187 Ga0495603_0317530 3300046455 Bacteria 894
188 Ga0495629_0038295 3300046459 Bacteria 3378
189 Ga0495629_0933858 3300046459 Unclassified 567
190 Ga0495641_0017481 3300046461 Bacteria 3737
191 Ga0495641_0082885 3300046461 Unclassified 1436
192 Ga0495651_0000240 3300046462 Bacteria 42303
193 Ga0495651_0004999 3300046462 Bacteria 10127
194 Ga0495651_0449866 3300046462 Bacteria 832
195 Ga0495653_0000750 3300046463 Bacteria 24833
196 Ga0495653_0002616 3300046463 Bacteria 14323
197 Ga0495653_0007847 3300046463 Bacteria 8738
198 Ga0495653_0204962 3300046463 Bacteria 1336
199 Ga0495653_0748491 3300046463 Bacteria 591
200 Ga0495580_0228781 3300046472 Bacteria 1277
201 Ga0495582_0015308 3300046473 Bacteria 4215
202 Ga0495639_0444520 3300046475 Bacteria 658
203 Ga0495662_0028674 3300046476 Bacteria 2687
204 Ga0495664_0008264 3300046477 Bacteria 5800
205 Ga0495664_0012673 3300046477 Bacteria 4775
206 Ga0495608_0000123 3300046511 Bacteria 55519
207 Ga0495608_0005540 3300046511 Bacteria 9019
208 Ga0495608_0274145 3300046511 Bacteria 1048
209 Ga0495618_0021719 3300046514 Bacteria 3957
210 Ga0495618_0336593 3300046514 Bacteria 932
211 Ga0495618_0814527 3300046514 Bacteria 543
212 Ga0495628_0001401 3300046516 Bacteria 22116
213 Ga0495628_0004909 3300046516 Bacteria 11770
214 Ga0495628_0254448 3300046516 Bacteria 1310
215 Ga0495628_0261728 3300046516 Unclassified 1289
216 Ga0495630_0013427 3300046517 Bacteria 5960
217 Ga0495630_0041422 3300046517 Bacteria 3439
218 Ga0495630_0932533 3300046517 Unclassified 661
219 Ga0495630_1090125 3300046517 Bacteria 606
220 Ga0495637_0356111 3300046520 Unclassified 513
221 Ga0495666_0465039 3300046526 Bacteria 566
222 Ga0495652_0000278 3300046529 Bacteria 60389
223 Ga0495652_0007763 3300046529 Bacteria 9862
224 Ga0495652_0013313 3300046529 Bacteria 7404
225 Ga0495652_0238479 3300046529 Bacteria 1355
226 Ga0495665_0024161 3300046531 Bacteria 3265
227 Ga0495665_0120309 3300046531 Bacteria 1375
228 Ga0495640_0014886 3300046533 Bacteria 5866
229 Ga0495640_0481219 3300046533 Bacteria 756
230 Ga0495587_0000126 3300046536 Bacteria 57849
231 Ga0495587_0004680 3300046536 Bacteria 8988
232 Ga0495587_0691862 3300046536 Unclassified 559
233 Ga0495645_0008587 3300046543 Bacteria 7135
234 Ga0495645_0520523 3300046543 Bacteria 741
235 Ga0495645_0972702 3300046543 Bacteria 500
236 Ga0495667_0000123 3300046559 Bacteria 55776
237 Ga0495667_0052215 3300046559 Bacteria 2694
238 Ga0495667_0072329 3300046559 Bacteria 2247
239 Ga0495656_0312515 3300046615 Unclassified 808
240 Ga0495656_0362469 3300046615 Unclassified 753
241 Ga0495634_0030595 3300046642 Bacteria 3717
242 Ga0495634_0145077 3300046642 Bacteria 1504
243 Ga0495634_0297399 3300046642 Bacteria 977
244 Ga0495635_0001360 3300046663 Bacteria 16268
245 Ga0495635_0008772 3300046663 Bacteria 7059
246 Ga0495661_0582636 3300046665 Bacteria 527
247 Ga0495657_0000164 3300046675 Bacteria 59903
248 Ga0495657_0017171 3300046675 Bacteria 5259
249 Ga0495599_0000096 3300046678 Bacteria 61855
250 Ga0495599_0001736 3300046678 Bacteria 12606
251 Ga0495599_0022746 3300046678 Bacteria 3915
252 Ga0495599_0244556 3300046678 Bacteria 1093
253 Ga0495623_0000243 3300046679 Bacteria 35316
254 Ga0495623_0162158 3300046679 Bacteria 1313
255 Ga0495646_0003894 3300046680 Bacteria 9338
256 Ga0495646_0013229 3300046680 Bacteria 5244
257 Ga0495646_0254410 3300046680 Bacteria 940
258 Ga0495613_0022827 3300046689 Bacteria 4662
259 Ga0495613_0095004 3300046689 Bacteria 2157
260 Ga0495624_0002304 3300046690 Bacteria 14540
261 Ga0495600_0000513 3300046809 Bacteria 20094
262 Ga0495600_0015344 3300046809 Bacteria 4842
263 Ga0495581_0025800 3300047315 Bacteria 3408
264 Ga0495581_0242650 3300047315 Bacteria 1054
265 Ga0495604_0000141 3300047317 Bacteria 61811
266 Ga0495604_0038663 3300047317 Bacteria 3753
267 Ga0495636_0664030 3300047318 Bacteria 513
268 Ga0495674_0008352 3300047319 Bacteria 9871
269 Ga0495674_0008821 3300047319 Bacteria 9590
270 Ga0495674_1131131 3300047319 Bacteria 595
271 Ga0495676_0171393 3300047321 Bacteria 1527
272 Ga0495676_0814986 3300047321 Bacteria 601
273 Ga0495680_0000874 3300047322 Bacteria 33467
274 Ga0495680_0006143 3300047322 Bacteria 11209
275 Ga0495680_0013960 3300047322 Bacteria 6983
276 Ga0495680_0108896 3300047322 Bacteria 2055
277 Ga0495687_156077 3300047443 Bacteria 774
278 Ga0495675_0000519 3300047444 Bacteria 25004
279 Ga0495684_0013227 3300047471 Bacteria 6369
280 Ga0495684_0014255 3300047471 Bacteria 6116
281 Ga0495593_0029127 3300047673 Bacteria 3030
282 Ga0495602_0000189 3300048088 Bacteria 58271
283 Ga0495602_0006576 3300048088 Bacteria 12182
284 Ga0495602_0705411 3300048088 Unclassified 684
285 Ga0496102_1924564 3300048905 Unclassified 508
286 Ga0496104_1021580 3300048907 Unclassified 731
287 Ga0496114_0336173 3300048917 Bacteria 1335
288 Ga0501034_0898128 3300049571 Bacteria 774
289 Ga0501036_1503293 3300049572 Unclassified 545
290 Ga0501038_0719069 3300049574 Bacteria 747
291 Ga0501039_0132551 3300049575 Unclassified 1956
292 Ga0501041_0196505 3300049577 Bacteria 1264
293 Ga0501042_0402210 3300049578 Bacteria 992
294 Ga0501043_0437625 3300049579 Bacteria 984
295 Ga0501043_0793366 3300049579 Bacteria 686
296 Ga0501046_0439671 3300049580 Bacteria 939
297 Ga0501046_0495855 3300049580 Bacteria 875
298 Ga0501067_0180870 3300049583 Bacteria 1174
299 Ga0501072_1182919 3300049588 Unclassified 594
300 Ga0501075_0564833 3300049591 Bacteria 868
301 Ga0501076_0933749 3300049592 Bacteria 715
302 Ga0501250_082351 3300049680 Bacteria 549
303 Ga0501079_0333014 3300049741 Unclassified 1189
304 Ga0501044_0030153 3300049823 Bacteria 5717
305 Ga0501044_0534350 3300049823 Bacteria 1071
306 Ga0501044_0681778 3300049823 Bacteria 914
307 Ga0501044_0687850 3300049823 Bacteria 909
308 Ga0501045_0549167 3300049824 Bacteria 857
309 nmdc:mga05p37_170192_c1 3300050507 Bacteria 2657
310 nmdc:mga05p37_81777_c1 3300050507 Bacteria 3979
311 nmdc:mga09592_567508_c1 3300050508 Bacteria 974
312 nmdc:mga0qj67_262431_c1 3300050509 Bacteria 1401
313 nmdc:mga06r32_6413_c1 3300050510 Bacteria 10568
314 nmdc:mga06r32_961183_c1 3300050510 Bacteria 808
315 nmdc:mga08y16_1054152_c1 3300050511 Bacteria 790
316 nmdc:mga0n895_113538_c1 3300050512 Bacteria 2727
317 nmdc:mga0n895_239073_c1 3300050512 Bacteria 1843
318 nmdc:mga0rr50_207795_c1 3300050513 Bacteria 1612
319 nmdc:mga0rr50_43553_c1 3300050513 Bacteria 3286
320 nmdc:mga08x19_222569_c1 3300050514 Bacteria 1297
321 nmdc:mga0a205_40504_c1 3300050515 Bacteria 4485
322 Ga0495601_0118634 3300053077 Bacteria 1717
323 Ga0495595_0001228 3300053084 Bacteria 9976
324 Ga0495595_0003678 3300053084 Bacteria 6097
325 Ga0495619_0015781 3300053085 Bacteria 4782
326 Ga0501084_1679413 3300054114 Unclassified 531
327 Ga0501082_0814234 3300060353 Unclassified 817
328 Ga0501082_1493458 3300060353 Unclassified 590
329 Ga0466962_0020022 3300061719 Bacteria 3216
330 Ga0466962_0120582 3300061719 Bacteria 1265
331 Ga0530510_0092752 3300061734 Bacteria 2204

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049574 Ga0501038_0719069 Ga0501038_0719069_501_692 62
2 3300049823 Ga0501044_0681778 Ga0501044_0681778_269_460 62
3 3300031901 Ga0307406_10361184 Ga0307406_103611842 63
4 3300032002 Ga0307416_100132347 Ga0307416_1001323473 63
5 3300042005 Ga0439448_0030127 Ga0439448_0030127_1270_1467 63
6 3300042016 Ga0439463_010506 Ga0439463_010506_597_794 63
7 3300046520 Ga0495637_0356111 Ga0495637_0356111_206_403 63
8 3300046615 Ga0495656_0312515 Ga0495656_0312515_524_721 63
9 3300046665 Ga0495661_0582636 Ga0495661_0582636_196_393 63
10 3300047318 Ga0495636_0664030 Ga0495636_0664030_80_277 63
11 3300049572 Ga0501036_1503293 Ga0501036_1503293_86_286 63
12 3300050507 nmdc:mga05p37_170192_c1 nmdc:mga05p37_170192_c1_462_653 63
13 3300050508 nmdc:mga09592_567508_c1 nmdc:mga09592_567508_c1_117_308 63
14 3300050509 nmdc:mga0qj67_262431_c1 nmdc:mga0qj67_262431_c1_475_666 63
15 3300050510 nmdc:mga06r32_6413_c1 nmdc:mga06r32_6413_c1_2025_2216 63
16 3300009098 Ga0105245_10299134 Ga0105245_102991342 64
17 3300025927 Ga0207687_10841185 Ga0207687_108411852 64
18 3300009147 Ga0114129_13206547 Ga0114129_132065472 65
19 3300031824 Ga0307413_11885304 Ga0307413_118853042 65
20 3300031995 Ga0307409_101338680 Ga0307409_1013386802 65
21 3300044656 Ga0466969_0082358 Ga0466969_0082358_1250_1447 65
22 3300049680 Ga0501250_082351 Ga0501250_082351_340_537 65
23 iso_pu_bacteria 2616644814 2616695238 65
24 iso_pu_bacteria 2791355406 2793982135 65
25 iso_pu_bacteria 2808606982 2811845548 65
26 iso_pu_bacteria 2995463766 2995467642 65
27 iso_pu_bacteria 8008485437 8008487110 65
28 iso_pu_bacteria 8025524527 8025525129 65
29 iso_pu_bacteria 8048356638 8048361507 65
30 iso_pu_bacteria 8055412473 8055413411 65
31 iso_pu_bacteria 8056829672 8056831842 65
32 3300038443 Ga0395901_1801483 Ga0395901_1801483_150_350 66
33 3300042005 Ga0439448_0059763 Ga0439448_0059763_585_785 66
34 3300042016 Ga0439463_129341 Ga0439463_129341_391_591 66
35 3300044719 Ga0466971_0057650 Ga0466971_0057650_268_468 66
36 3300044765 Ga0466970_0389483 Ga0466970_0389483_532_732 66
37 3300044842 Ga0466957_0006776 Ga0466957_0006776_3847_4047 66
38 3300045049 Ga0466959_0102540 Ga0466959_0102540_807_1007 66
39 3300045836 Ga0466958_0004596 Ga0466958_0004596_1300_1500 66
40 3300045976 Ga0466967_0015696 Ga0466967_0015696_1685_1885 66
41 3300048905 Ga0496102_1924564 Ga0496102_1924564_155_355 66
42 3300048917 Ga0496114_0336173 Ga0496114_0336173_1092_1292 66
43 3300049823 Ga0501044_0687850 Ga0501044_0687850_645_845 66
44 3300061719 Ga0466962_0020022 Ga0466962_0020022_917_1117 66
45 3300005434 Ga0070709_10794535 Ga0070709_107945352 67
46 3300005439 Ga0070711_100883432 Ga0070711_1008834322 67
47 3300009148 Ga0105243_12237388 Ga0105243_122373882 67
48 3300009545 Ga0105237_11252447 Ga0105237_112524472 67
49 3300013306 Ga0163162_13136343 Ga0163162_131363431 67
50 3300005356 Ga0070674_100388695 Ga0070674_1003886952 68
51 3300005547 Ga0070693_100429158 Ga0070693_1004291581 68
52 3300005615 Ga0070702_101146957 Ga0070702_1011469572 68
53 3300005718 Ga0068866_10147419 Ga0068866_101474192 68
54 3300009093 Ga0105240_11913203 Ga0105240_119132031 68
55 3300009098 Ga0105245_10743689 Ga0105245_107436891 68
56 3300009148 Ga0105243_10064142 Ga0105243_100641422 68
57 3300009553 Ga0105249_10085559 Ga0105249_100855592 68
58 3300009553 Ga0105249_13442852 Ga0105249_134428521 68
59 3300011119 Ga0105246_10213916 Ga0105246_102139161 68
60 3300013297 Ga0157378_10403205 Ga0157378_104032052 68
61 3300013297 Ga0157378_12201751 Ga0157378_122017511 68
62 3300013308 Ga0157375_10196314 Ga0157375_101963142 68
63 3300013308 Ga0157375_10441766 Ga0157375_104417661 68
64 3300014326 Ga0157380_11972027 Ga0157380_119720272 68
65 3300017792 Ga0163161_10159814 Ga0163161_101598142 68
66 3300025899 Ga0207642_10024706 Ga0207642_100247062 68
67 3300025899 Ga0207642_11117576 Ga0207642_111175761 68
68 3300025934 Ga0207686_10134160 Ga0207686_101341602 68
69 3300025934 Ga0207686_11661102 Ga0207686_116611021 68
70 3300025935 Ga0207709_10083141 Ga0207709_100831412 68
71 3300025938 Ga0207704_11470309 Ga0207704_114703091 68
72 3300025961 Ga0207712_10091615 Ga0207712_100916152 68
73 3300026118 Ga0207675_101632965 Ga0207675_1016329652 68
74 3300041458 Ga0451798_0659557 Ga0451798_0659557_27_236 68
75 3300044765 Ga0466970_0027612 Ga0466970_0027612_1542_1751 68
76 3300046543 Ga0495645_0972702 Ga0495645_0972702_36_245 68
77 3300049575 Ga0501039_0132551 Ga0501039_0132551_1239_1445 68
78 3300049588 Ga0501072_1182919 Ga0501072_1182919_262_468 68
79 3300049592 Ga0501076_0933749 Ga0501076_0933749_436_642 68
80 3300049741 Ga0501079_0333014 Ga0501079_0333014_537_743 68
81 3300054114 Ga0501084_1679413 Ga0501084_1679413_215_421 68
82 3300060353 Ga0501082_0814234 Ga0501082_0814234_45_251 68
83 3300061734 Ga0530510_0092752 Ga0530510_0092752_673_879 68
84 3300025302 Ga0207426_1022696 Ga0207426_10226962 69
85 3300025931 Ga0207644_10946817 Ga0207644_109468172 69
86 3300031616 Ga0307508_10028141 Ga0307508_100281412 69
87 3300031649 Ga0307514_10583923 Ga0307514_105839232 69
88 3300033179 Ga0307507_10398929 Ga0307507_103989292 69
89 3300035089 Ga0373944_0163617 Ga0373944_0163617_429_638 69
90 3300035111 Ga0373923_0150176 Ga0373923_0150176_575_784 69
91 3300035113 Ga0373936_0002592 Ga0373936_0002592_1271_1480 69
92 3300035116 Ga0373945_0007176 Ga0373945_0007176_1265_1474 69
93 3300035170 Ga0373943_0000655 Ga0373943_0000655_5931_6140 69
94 3300035171 Ga0373946_0000492 Ga0373946_0000492_27_236 69
95 3300035692 Ga0373935_0001003 Ga0373935_0001003_6271_6480 69
96 3300035695 Ga0373927_0001070 Ga0373927_0001070_655_864 69
97 3300035725 Ga0373947_0000830 Ga0373947_0000830_7739_7948 69
98 3300035725 Ga0373947_0413520 Ga0373947_0413520_101_310 69
99 3300037068 Ga0373925_0017177 Ga0373925_0017177_3382_3591 69
100 3300041453 Ga0451797_0129694 Ga0451797_0129694_148_360 69
101 3300041460 Ga0451802_1423631 Ga0451802_1423631_468_680 69
102 3300046461 Ga0495641_0082885 Ga0495641_0082885_199_408 69
103 3300046462 Ga0495651_0449866 Ga0495651_0449866_522_731 69
104 3300046463 Ga0495653_0002616 Ga0495653_0002616_5236_5445 69
105 3300046477 Ga0495664_0008264 Ga0495664_0008264_2298_2507 69
106 3300046511 Ga0495608_0274145 Ga0495608_0274145_74_283 69
107 3300046514 Ga0495618_0336593 Ga0495618_0336593_181_390 69
108 3300046516 Ga0495628_0261728 Ga0495628_0261728_980_1189 69
109 3300046517 Ga0495630_0013427 Ga0495630_0013427_521_730 69
110 3300046529 Ga0495652_0013313 Ga0495652_0013313_6602_6811 69
111 3300046531 Ga0495665_0024161 Ga0495665_0024161_504_713 69
112 3300046533 Ga0495640_0481219 Ga0495640_0481219_331_543 69
113 3300046536 Ga0495587_0691862 Ga0495587_0691862_54_263 69
114 3300046559 Ga0495667_0052215 Ga0495667_0052215_1264_1473 69
115 3300046642 Ga0495634_0145077 Ga0495634_0145077_531_740 69
116 3300046663 Ga0495635_0001360 Ga0495635_0001360_2232_2441 69
117 3300046678 Ga0495599_0244556 Ga0495599_0244556_350_559 69
118 3300046680 Ga0495646_0254410 Ga0495646_0254410_712_921 69
119 3300046689 Ga0495613_0095004 Ga0495613_0095004_1342_1554 69
120 3300046690 Ga0495624_0002304 Ga0495624_0002304_12572_12781 69
121 3300047315 Ga0495581_0242650 Ga0495581_0242650_565_774 69
122 3300047319 Ga0495674_0008352 Ga0495674_0008352_3677_3886 69
123 3300047322 Ga0495680_0013960 Ga0495680_0013960_5872_6081 69
124 3300047443 Ga0495687_156077 Ga0495687_156077_429_638 69
125 3300047471 Ga0495684_0013227 Ga0495684_0013227_5491_5700 69
126 3300049571 Ga0501034_0898128 Ga0501034_0898128_221_436 69
127 3300049579 Ga0501043_0437625 Ga0501043_0437625_417_629 69
128 3300049580 Ga0501046_0495855 Ga0501046_0495855_485_697 69
129 3300049583 Ga0501067_0180870 Ga0501067_0180870_241_450 69
130 3300049823 Ga0501044_0030153 Ga0501044_0030153_333_545 69
131 3300049823 Ga0501044_0534350 Ga0501044_0534350_206_421 69
132 3300061719 Ga0466962_0120582 Ga0466962_0120582_164_376 69
133 3300005435 Ga0070714_101477202 Ga0070714_1014772022 70
134 iso_pu_bacteria 3002998708 3002998874 70
135 3300005445 Ga0070708_100000768 Ga0070708_1000007688 71
136 3300005445 Ga0070708_100015389 Ga0070708_1000153894 71
137 3300005518 Ga0070699_100002369 Ga0070699_10000236920 71
138 3300006844 Ga0075428_100365357 Ga0075428_1003653572 71
139 3300006846 Ga0075430_100672401 Ga0075430_1006724012 71
140 3300006847 Ga0075431_100019042 Ga0075431_1000190422 71
141 3300006880 Ga0075429_100887082 Ga0075429_1008870822 71
142 3300042993 Ga0439440_0035291 Ga0439440_0035291_174_389 71
143 3300045049 Ga0466959_0399353 Ga0466959_0399353_605_820 71
144 3300046615 Ga0495656_0362469 Ga0495656_0362469_307_522 71
145 3300050510 nmdc:mga06r32_961183_c1 nmdc:mga06r32_961183_c1_116_331 71
146 3300005435 Ga0070714_102494164 Ga0070714_1024941641 72
147 3300005437 Ga0070710_10284414 Ga0070710_102844142 72
148 3300005439 Ga0070711_100074702 Ga0070711_1000747024 72
149 3300006163 Ga0070715_10331384 Ga0070715_103313842 72
150 3300006175 Ga0070712_100529058 Ga0070712_1005290582 72
151 3300025915 Ga0207693_10467081 Ga0207693_104670812 72
152 3300025916 Ga0207663_10023947 Ga0207663_100239474 72
153 3300035086 Ga0373934_0000052 Ga0373934_0000052_24297_24527 72
154 3300035111 Ga0373923_0014184 Ga0373923_0014184_2540_2770 72
155 3300035117 Ga0373953_0000049 Ga0373953_0000049_12897_13127 72
156 3300035118 Ga0373954_0002010 Ga0373954_0002010_7014_7244 72
157 3300035119 Ga0373956_0002102 Ga0373956_0002102_4176_4406 72
158 3300035120 Ga0373957_0000096 Ga0373957_0000096_13096_13326 72
159 3300035172 Ga0373955_0000313 Ga0373955_0000313_3105_3335 72
160 3300035410 Ga0373924_0000017 Ga0373924_0000017_18501_18731 72
161 3300035410 Ga0373924_0192470 Ga0373924_0192470_603_824 72
162 3300035724 Ga0373933_0000079 Ga0373933_0000079_31685_31915 72
163 3300036401 Ga0373937_0000189 Ga0373937_0000189_31685_31915 72
164 3300041453 Ga0451797_1374536 Ga0451797_1374536_209_436 72
165 3300046454 Ga0495592_0000154 Ga0495592_0000154_31685_31915 72
166 3300046462 Ga0495651_0000240 Ga0495651_0000240_10389_10619 72
167 3300046463 Ga0495653_0000750 Ga0495653_0000750_10145_10375 72
168 3300046511 Ga0495608_0000123 Ga0495608_0000123_28026_28256 72
169 3300046516 Ga0495628_0001401 Ga0495628_0001401_9554_9784 72
170 3300046529 Ga0495652_0000278 Ga0495652_0000278_28480_28710 72
171 3300046536 Ga0495587_0000126 Ga0495587_0000126_25935_26165 72
172 3300046543 Ga0495645_0520523 Ga0495645_0520523_356_586 72
173 3300046559 Ga0495667_0000123 Ga0495667_0000123_27067_27297 72
174 3300046675 Ga0495657_0000164 Ga0495657_0000164_31684_31914 72
175 3300046678 Ga0495599_0000096 Ga0495599_0000096_28319_28549 72
176 3300046679 Ga0495623_0000243 Ga0495623_0000243_27953_28183 72
177 3300046680 Ga0495646_0003894 Ga0495646_0003894_1316_1546 72
178 3300046809 Ga0495600_0000513 Ga0495600_0000513_2435_2665 72
179 3300047317 Ga0495604_0000141 Ga0495604_0000141_31963_32193 72
180 3300047322 Ga0495680_0000874 Ga0495680_0000874_28104_28334 72
181 3300047444 Ga0495675_0000519 Ga0495675_0000519_10028_10258 72
182 3300048088 Ga0495602_0000189 Ga0495602_0000189_26357_26587 72
183 3300053084 Ga0495595_0001228 Ga0495595_0001228_9526_9756 72
184 3300049577 Ga0501041_0196505 Ga0501041_0196505_424_645 73
185 3300049578 Ga0501042_0402210 Ga0501042_0402210_285_506 73
186 3300049579 Ga0501043_0793366 Ga0501043_0793366_109_330 73
187 3300049580 Ga0501046_0439671 Ga0501046_0439671_319_540 73
188 3300049591 Ga0501075_0564833 Ga0501075_0564833_157_378 73
189 3300049824 Ga0501045_0549167 Ga0501045_0549167_37_258 73
190 3300060353 Ga0501082_1493458 Ga0501082_1493458_279_500 73
191 3300005434 Ga0070709_10031113 Ga0070709_100311133 75
192 3300005435 Ga0070714_100122870 Ga0070714_1001228702 75
193 3300005435 Ga0070714_102494707 Ga0070714_1024947071 75
194 3300005436 Ga0070713_100119274 Ga0070713_1001192742 75
195 3300005436 Ga0070713_101621597 Ga0070713_1016215971 75
196 3300005437 Ga0070710_10005047 Ga0070710_100050472 75
197 3300005437 Ga0070710_10550359 Ga0070710_105503592 75
198 3300005439 Ga0070711_100161795 Ga0070711_1001617953 75
199 3300005439 Ga0070711_100269972 Ga0070711_1002699722 75
200 3300005439 Ga0070711_101055253 Ga0070711_1010552532 75
201 3300005445 Ga0070708_100126445 Ga0070708_1001264452 75
202 3300005467 Ga0070706_100134947 Ga0070706_1001349472 75
203 3300005467 Ga0070706_100258698 Ga0070706_1002586982 75
204 3300005467 Ga0070706_101573341 Ga0070706_1015733412 75
205 3300005468 Ga0070707_100011408 Ga0070707_1000114086 75
206 3300005937 Ga0081455_11043161 Ga0081455_110431612 75
207 3300006028 Ga0070717_10012264 Ga0070717_100122649 75
208 3300006173 Ga0070716_100008990 Ga0070716_1000089903 75
209 3300006175 Ga0070712_100015374 Ga0070712_1000153742 75
210 3300006175 Ga0070712_100147949 Ga0070712_1001479492 75
211 3300006852 Ga0075433_10048620 Ga0075433_100486205 75
212 3300006871 Ga0075434_100044999 Ga0075434_1000449994 75
213 3300006871 Ga0075434_100061327 Ga0075434_1000613275 75
214 3300006871 Ga0075434_101865430 Ga0075434_1018654302 75
215 3300006914 Ga0075436_100630558 Ga0075436_1006305581 75
216 3300006914 Ga0075436_100781339 Ga0075436_1007813392 75
217 3300007076 Ga0075435_100024383 Ga0075435_1000243835 75
218 3300007076 Ga0075435_100070637 Ga0075435_1000706372 75
219 3300009094 Ga0111539_11114282 Ga0111539_111142822 75
220 3300009147 Ga0114129_10353680 Ga0114129_103536802 75
221 3300025898 Ga0207692_10020703 Ga0207692_100207033 75
222 3300025898 Ga0207692_10097315 Ga0207692_100973152 75
223 3300025906 Ga0207699_10013323 Ga0207699_100133233 75
224 3300025910 Ga0207684_10182857 Ga0207684_101828572 75
225 3300025910 Ga0207684_10814284 Ga0207684_108142842 75
226 3300025910 Ga0207684_11314819 Ga0207684_113148192 75
227 3300025915 Ga0207693_10017666 Ga0207693_100176665 75
228 3300025915 Ga0207693_10097716 Ga0207693_100977162 75
229 3300025916 Ga0207663_10009627 Ga0207663_100096272 75
230 3300025916 Ga0207663_10151059 Ga0207663_101510592 75
231 3300025928 Ga0207700_10005716 Ga0207700_100057164 75
232 3300025928 Ga0207700_11342012 Ga0207700_113420122 75
233 3300025928 Ga0207700_11769861 Ga0207700_117698611 75
234 3300025929 Ga0207664_10110083 Ga0207664_101100832 75
235 3300025939 Ga0207665_10002522 Ga0207665_100025224 75
236 3300035083 Ga0373926_0351020 Ga0373926_0351020_22_249 75
237 3300035086 Ga0373934_0000826 Ga0373934_0000826_5244_5471 75
238 3300035111 Ga0373923_0095959 Ga0373923_0095959_659_886 75
239 3300035113 Ga0373936_0025544 Ga0373936_0025544_1318_1545 75
240 3300035117 Ga0373953_0042185 Ga0373953_0042185_677_904 75
241 3300035118 Ga0373954_0048285 Ga0373954_0048285_455_682 75
242 3300035119 Ga0373956_0148284 Ga0373956_0148284_593_820 75
243 3300035120 Ga0373957_0024479 Ga0373957_0024479_1623_1850 75
244 3300035170 Ga0373943_0068659 Ga0373943_0068659_1164_1391 75
245 3300035171 Ga0373946_0124913 Ga0373946_0124913_585_812 75
246 3300035172 Ga0373955_0008903 Ga0373955_0008903_4314_4541 75
247 3300035410 Ga0373924_0057189 Ga0373924_0057189_662_889 75
248 3300035691 Ga0373931_0150772 Ga0373931_0150772_75_302 75
249 3300035692 Ga0373935_0056035 Ga0373935_0056035_1636_1863 75
250 3300035724 Ga0373933_0016508 Ga0373933_0016508_3198_3425 75
251 3300035725 Ga0373947_0645171 Ga0373947_0645171_419_646 75
252 3300036401 Ga0373937_0001102 Ga0373937_0001102_11310_11537 75
253 3300037068 Ga0373925_0075275 Ga0373925_0075275_1757_1984 75
254 3300037068 Ga0373925_0097393 Ga0373925_0097393_605_832 75
255 3300046454 Ga0495592_0006132 Ga0495592_0006132_4454_4681 75
256 3300046455 Ga0495603_0317530 Ga0495603_0317530_58_285 75
257 3300046459 Ga0495629_0038295 Ga0495629_0038295_944_1171 75
258 3300046459 Ga0495629_0933858 Ga0495629_0933858_29_256 75
259 3300046461 Ga0495641_0017481 Ga0495641_0017481_1785_2012 75
260 3300046462 Ga0495651_0004999 Ga0495651_0004999_4626_4853 75
261 3300046463 Ga0495653_0007847 Ga0495653_0007847_1969_2196 75
262 3300046472 Ga0495580_0228781 Ga0495580_0228781_949_1176 75
263 3300046473 Ga0495582_0015308 Ga0495582_0015308_2566_2793 75
264 3300046475 Ga0495639_0444520 Ga0495639_0444520_63_290 75
265 3300046476 Ga0495662_0028674 Ga0495662_0028674_373_600 75
266 3300046477 Ga0495664_0012673 Ga0495664_0012673_2636_2863 75
267 3300046511 Ga0495608_0005540 Ga0495608_0005540_6486_6713 75
268 3300046514 Ga0495618_0021719 Ga0495618_0021719_1688_1915 75
269 3300046516 Ga0495628_0004909 Ga0495628_0004909_10031_10258 75
270 3300046517 Ga0495630_0041422 Ga0495630_0041422_2178_2405 75
271 3300046517 Ga0495630_1090125 Ga0495630_1090125_26_253 75
272 3300046526 Ga0495666_0465039 Ga0495666_0465039_233_460 75
273 3300046529 Ga0495652_0007763 Ga0495652_0007763_1309_1536 75
274 3300046531 Ga0495665_0120309 Ga0495665_0120309_153_380 75
275 3300046533 Ga0495640_0014886 Ga0495640_0014886_1530_1757 75
276 3300046536 Ga0495587_0004680 Ga0495587_0004680_6445_6672 75
277 3300046543 Ga0495645_0008587 Ga0495645_0008587_5014_5241 75
278 3300046559 Ga0495667_0072329 Ga0495667_0072329_440_667 75
279 3300046642 Ga0495634_0030595 Ga0495634_0030595_1968_2195 75
280 3300046642 Ga0495634_0297399 Ga0495634_0297399_430_657 75
281 3300046663 Ga0495635_0008772 Ga0495635_0008772_5309_5536 75
282 3300046675 Ga0495657_0017171 Ga0495657_0017171_2789_3016 75
283 3300046678 Ga0495599_0001736 Ga0495599_0001736_10031_10258 75
284 3300046679 Ga0495623_0162158 Ga0495623_0162158_540_767 75
285 3300046680 Ga0495646_0013229 Ga0495646_0013229_4428_4655 75
286 3300046689 Ga0495613_0022827 Ga0495613_0022827_1941_2168 75
287 3300046809 Ga0495600_0015344 Ga0495600_0015344_2449_2676 75
288 3300047315 Ga0495581_0025800 Ga0495581_0025800_901_1128 75
289 3300047317 Ga0495604_0038663 Ga0495604_0038663_477_704 75
290 3300047319 Ga0495674_0008821 Ga0495674_0008821_1709_1936 75
291 3300047321 Ga0495676_0171393 Ga0495676_0171393_1104_1331 75
292 3300047321 Ga0495676_0814986 Ga0495676_0814986_347_574 75
293 3300047322 Ga0495680_0006143 Ga0495680_0006143_4446_4673 75
294 3300047471 Ga0495684_0014255 Ga0495684_0014255_1709_1936 75
295 3300047673 Ga0495593_0029127 Ga0495593_0029127_1912_2139 75
296 3300048088 Ga0495602_0006576 Ga0495602_0006576_2433_2660 75
297 3300048907 Ga0496104_1021580 Ga0496104_1021580_176_403 75
298 3300050507 nmdc:mga05p37_81777_c1 nmdc:mga05p37_81777_c1_2064_2291 75
299 3300050511 nmdc:mga08y16_1054152_c1 nmdc:mga08y16_1054152_c1_126_353 75
300 3300050512 nmdc:mga0n895_113538_c1 nmdc:mga0n895_113538_c1_784_1011 75
301 3300050512 nmdc:mga0n895_239073_c1 nmdc:mga0n895_239073_c1_1143_1370 75
302 3300050513 nmdc:mga0rr50_207795_c1 nmdc:mga0rr50_207795_c1_781_1008 75
303 3300050513 nmdc:mga0rr50_43553_c1 nmdc:mga0rr50_43553_c1_893_1120 75
304 3300050514 nmdc:mga08x19_222569_c1 nmdc:mga08x19_222569_c1_90_317 75
305 3300050515 nmdc:mga0a205_40504_c1 nmdc:mga0a205_40504_c1_2565_2792 75
306 3300053077 Ga0495601_0118634 Ga0495601_0118634_74_301 75
307 3300053084 Ga0495595_0003678 Ga0495595_0003678_3380_3607 75
308 3300053085 Ga0495619_0015781 Ga0495619_0015781_1978_2205 75
309 3300006175 Ga0070712_101281393 Ga0070712_1012813932 76
310 3300025915 Ga0207693_10297529 Ga0207693_102975292 76
311 3300005337 Ga0070682_101959184 Ga0070682_1019591842 77
312 3300005434 Ga0070709_10891246 Ga0070709_108912462 77
313 3300005436 Ga0070713_100921823 Ga0070713_1009218232 77
314 3300005436 Ga0070713_101275388 Ga0070713_1012753882 77
315 3300005437 Ga0070710_10367587 Ga0070710_103675872 77
316 3300005439 Ga0070711_100287195 Ga0070711_1002871952 77
317 3300005614 Ga0068856_100734991 Ga0068856_1007349912 77
318 3300006028 Ga0070717_10204017 Ga0070717_102040172 77
319 3300006173 Ga0070716_101331471 Ga0070716_1013314712 77
320 3300006175 Ga0070712_101716326 Ga0070712_1017163261 77
321 3300007076 Ga0075435_101256348 Ga0075435_1012563481 77
322 3300013105 Ga0157369_10426454 Ga0157369_104264543 77
323 3300025906 Ga0207699_10317197 Ga0207699_103171972 77
324 3300025915 Ga0207693_10209521 Ga0207693_102095212 77
325 3300025928 Ga0207700_10316530 Ga0207700_103165302 77
326 3300025928 Ga0207700_10918748 Ga0207700_109187482 77
327 3300025929 Ga0207664_10077015 Ga0207664_100770152 77
328 3300025929 Ga0207664_11331240 Ga0207664_113312401 77
329 3300035725 Ga0373947_0573447 Ga0373947_0573447_389_622 77
330 3300037068 Ga0373925_0543547 Ga0373925_0543547_312_545 77
331 3300039450 Ga0436363_0523736 Ga0436363_0523736_225_458 77
332 3300046463 Ga0495653_0204962 Ga0495653_0204962_46_279 77
333 3300046463 Ga0495653_0748491 Ga0495653_0748491_292_525 77
334 3300046514 Ga0495618_0814527 Ga0495618_0814527_39_272 77
335 3300046516 Ga0495628_0254448 Ga0495628_0254448_662_895 77
336 3300046517 Ga0495630_0932533 Ga0495630_0932533_219_452 77
337 3300046529 Ga0495652_0238479 Ga0495652_0238479_255_488 77
338 3300046678 Ga0495599_0022746 Ga0495599_0022746_1574_1807 77
339 3300047319 Ga0495674_1131131 Ga0495674_1131131_55_288 77
340 3300047322 Ga0495680_0108896 Ga0495680_0108896_940_1173 77
341 3300048088 Ga0495602_0705411 Ga0495602_0705411_28_261 77

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12728

HTH_17

Helix-turn-helix domain

1

51

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
4j2n-assembly1.cif.gz_A crystal structure of mycobacteriophage pukovnik xis 0.9234 12 56
6amk-assembly1.cif.gz_B structure of streptomyces venezuelae bldc-whii opt complex 0.8861 11 59
6amk-assembly1.cif.gz_A structure of streptomyces venezuelae bldc-whii opt complex 0.8819 11 59
6ama-assembly1.cif.gz_A structure of s. coelicolor/s. venezuelae bldc-smea-ssfa complex to 3.09 angstrom 0.8669 10 59
6ama-assembly1.cif.gz_B structure of s. coelicolor/s. venezuelae bldc-smea-ssfa complex to 3.09 angstrom 0.8595 10 59
ID Description Score Start End Superfamily
af_P9WLC3_19_69_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9328 13 61 1.10.10.10
af_I6YE30_32_77_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9318 13 55 1.10.10.10
af_P9WKT7_24_74_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9263 12 61 1.10.10.10
af_O53399_195_246_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9207 12 61 1.10.10.10
af_P9WKT7_24_74_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8933 12 61 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A523E0Z8-F1-model_v4 DNA-binding protein 0.9829 8 62 GO:0003677
AF-A0A0A0J166-F1-model_v4 DNA-binding protein 0.9618 6 61 GO:0003677
AF-A0A4V2XYN9-F1-model_v4 Helix-turn-helix domain-containing protein 0.9594 10 65 GO:0003677
AF-A0A7J9ZRL3-F1-model_v4 Helix-turn-helix domain-containing protein 0.9206 6 65 GO:0003677
AF-A0A5S4GM51-F1-model_v4 Helix-turn-helix domain-containing protein 0.9193 6 65 GO:0003677

Feature Viewer

pLDDT pTM Quality
75.41 0.57 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map