F414856

General Info

Members Datasets Scaffolds Average Seq Length
341 187 682 115

Family's Representative Sequence

Representative Sequence 3300045976|Ga0466967_0150308|Ga0466967_0150308_332_730
Length 132
Sequence MTRLNRSRLAGVSGTSNTSVDPTVPPSGTGCLECDAAGGWWVHLRRCAACGHIGCCDDSPQRHATAHWRTSGHPIIRSFEPGEDWFWNFETDSYYDGPELAAPESRPVDETAPGPRGRVPSDWMAQLQARRG

Samples

Sample ID Description Type Environment
1 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
2 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
3 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
4 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
5 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
6 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
7 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
8 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
9 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
10 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
11 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
12 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
13 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
14 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
15 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
16 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
17 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
18 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
19 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
20 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
21 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
22 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
23 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
24 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
25 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
26 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
27 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
28 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
29 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
30 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
31 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
32 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
33 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
34 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
35 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
36 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
37 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
38 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
39 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
40 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
41 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
42 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
43 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
44 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
45 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
46 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
47 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
48 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
49 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
50 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
51 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
52 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
77 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
78 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
79 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
80 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
81 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
82 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
83 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
84 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
85 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
86 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
87 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
88 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
89 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
90 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
91 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
92 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
93 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
94 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
95 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
96 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
97 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
98 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
99 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
100 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
101 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
102 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
103 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
104 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
105 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
106 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
107 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
108 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
109 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
110 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
111 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
112 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
113 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
114 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
115 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
116 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
117 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
118 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
119 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
120 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
121 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
122 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
123 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
124 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
125 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
126 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
127 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
128 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
129 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
130 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
131 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
132 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
133 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
134 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
135 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
136 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
137 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
138 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
139 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
140 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
141 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
142 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
143 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
144 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
145 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
146 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
147 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
148 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
149 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
150 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
151 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
152 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
153 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
154 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
155 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
156 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
157 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
158 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
159 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
160 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
161 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
162 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
163 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
164 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
165 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
166 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
167 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
168 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
169 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
170 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
171 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
172 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
173 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
174 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
175 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
176 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
177 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
178 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
179 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
180 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
181 2558860280 Kutzneria sp. 744 Isolate Unclassified
182 2565956761 Rhodococcus qingshengii BKS 20-40 Isolate Rhizosphere
183 2816332139 Pseudonocardia kunmingensis DSM 45301 Isolate Unclassified
184 2839986021 Cellulosimicrobium cellulans JZ5 Isolate Unclassified
185 2842888712 Tsukamurella sp. R-71941 Isolate Unclassified
186 2929212328 Mycolicibacterium sp. R-73050 Hybrid assembly Isolate Unclassified
187 2995463766 Streptacidiphilus fuscans NEAU-YB345 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 95.6
Metatranscriptomes 2.35
Isolates 2.05

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 14.96
Nodule 0
Rhizoplane 7.92
Rhizosphere 70.97
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466967_0150308 3300045976 Bacteria 2176
2 Ga0068868_100231539 3300005338 Bacteria 1550
3 Ga0070668_100062800 3300005347 Bacteria 2879
4 Ga0070667_100236542 3300005367 Bacteria 1630
5 Ga0070709_10008165 3300005434 Bacteria 5747
6 Ga0070714_100024181 3300005435 Bacteria 4997
7 Ga0070714_100121686 3300005435 Bacteria 2322
8 Ga0070713_100058326 3300005436 Bacteria 3219
9 Ga0070713_100078180 3300005436 Bacteria 2815
10 Ga0070713_100144756 3300005436 Bacteria 2108
11 Ga0070713_101180906 3300005436 Bacteria 740
12 Ga0070710_10010204 3300005437 Bacteria 4608
13 Ga0070710_10012470 3300005437 Bacteria 4222
14 Ga0070711_100015958 3300005439 Bacteria 4760
15 Ga0070711_100025587 3300005439 Bacteria 3864
16 Ga0070711_101058908 3300005439 Bacteria 698
17 Ga0070663_100639206 3300005455 Bacteria 899
18 Ga0070681_10403673 3300005458 Bacteria 1278
19 Ga0070706_100013396 3300005467 Bacteria 7580
20 Ga0070706_100351108 3300005467 Bacteria 1375
21 Ga0070706_100470766 3300005467 Bacteria 1169
22 Ga0070707_100198137 3300005468 Bacteria 1958
23 Ga0070707_100500671 3300005468 Bacteria 1176
24 Ga0070698_100108188 3300005471 Bacteria 2747
25 Ga0070698_100407877 3300005471 Bacteria 1293
26 Ga0070699_100699945 3300005518 Bacteria 926
27 Ga0068853_100025036 3300005539 Bacteria 5007
28 Ga0070665_100143266 3300005548 Bacteria 2393
29 Ga0068856_101095567 3300005614 Bacteria 814
30 Ga0068863_100548228 3300005841 Bacteria 1142
31 Ga0070717_10009367 3300006028 Bacteria 7354
32 Ga0070717_10039820 3300006028 Bacteria 3825
33 Ga0075365_10054533 3300006038 Bacteria 2651
34 Ga0075365_10071556 3300006038 Bacteria 2335
35 Ga0075365_10270566 3300006038 Bacteria 1195
36 Ga0075365_10322496 3300006038 Bacteria 1088
37 Ga0075365_10404785 3300006038 Bacteria 963
38 Ga0075368_10140103 3300006042 Bacteria 1008
39 Ga0075368_10192475 3300006042 Bacteria 862
40 Ga0075363_100006376 3300006048 Bacteria 5348
41 Ga0075363_100028681 3300006048 Bacteria 2865
42 Ga0075363_100062083 3300006048 Bacteria 2015
43 Ga0075363_100103299 3300006048 Bacteria 1579
44 Ga0075364_10007084 3300006051 Bacteria 6629
45 Ga0075364_10010370 3300006051 Bacteria 5627
46 Ga0075364_10021645 3300006051 Bacteria 4052
47 Ga0075364_10031118 3300006051 Bacteria 3428
48 Ga0075364_10117954 3300006051 Bacteria 1775
49 Ga0075364_10131139 3300006051 Bacteria 1682
50 Ga0075364_10145770 3300006051 Bacteria 1594
51 Ga0075364_10455335 3300006051 Bacteria 874
52 Ga0075364_11086175 3300006051 Bacteria 543
53 Ga0070715_10003750 3300006163 Bacteria 4895
54 Ga0070716_100001006 3300006173 Bacteria 12311
55 Ga0070716_100322968 3300006173 Bacteria 1082
56 Ga0070716_100336237 3300006173 Bacteria 1064
57 Ga0070712_100018582 3300006175 Bacteria 4518
58 Ga0070712_100028175 3300006175 Bacteria 3755
59 Ga0070712_100487997 3300006175 Bacteria 1031
60 Ga0070712_100567196 3300006175 Bacteria 958
61 Ga0075362_10138964 3300006177 Bacteria 1160
62 Ga0075367_11123763 3300006178 Bacteria 502
63 Ga0075369_10002880 3300006186 Bacteria 6205
64 Ga0075370_10008096 3300006353 Bacteria 5394
65 Ga0075370_10054375 3300006353 Bacteria 2273
66 Ga0075370_10130355 3300006353 Bacteria 1467
67 Ga0075370_10358703 3300006353 Bacteria 871
68 Ga0105250_10041918 3300009092 Bacteria 1834
69 Ga0105247_10078701 3300009101 Bacteria 2074
70 Ga0105248_10722108 3300009177 Bacteria 1124
71 Ga0105237_10229395 3300009545 Bacteria 1858
72 Ga0105237_12356791 3300009545 Bacteria 542
73 Ga0105238_10066132 3300009551 Bacteria 3616
74 Ga0105249_10434755 3300009553 Bacteria 1349
75 Ga0105239_10583430 3300010375 Bacteria 1274
76 Ga0105239_12124335 3300010375 Bacteria 653
77 Ga0105239_12345176 3300010375 Bacteria 621
78 Ga0105246_11736257 3300011119 Bacteria 594
79 Ga0157369_10856646 3300013105 Bacteria 933
80 Ga0157374_11415354 3300013296 Bacteria 718
81 Ga0157375_10263883 3300013308 Bacteria 1884
82 Ga0157379_10516928 3300014968 Bacteria 1108
83 Ga0157379_10531622 3300014968 Bacteria 1092
84 Ga0197907_11351405 3300020069 Bacteria 1778
85 Ga0206356_10901819 3300020070 Bacteria 693
86 Ga0206355_1373942 3300020076 Bacteria 827
87 Ga0206350_10718750 3300020080 Bacteria 708
88 Ga0206353_10088086 3300020082 Bacteria 1153
89 Ga0213876_10062964 3300021384 Bacteria 1958
90 Ga0213876_10355236 3300021384 Bacteria 779
91 Ga0213875_10015299 3300021388 Bacteria 3733
92 Ga0224712_10026061 3300022467 Bacteria 2062
93 Ga0224712_10294801 3300022467 Bacteria 757
94 Ga0207692_10003343 3300025898 Bacteria 6253
95 Ga0207692_10098394 3300025898 Bacteria 1601
96 Ga0207692_11195430 3300025898 Bacteria 505
97 Ga0207710_10124101 3300025900 Bacteria 1235
98 Ga0207710_10279151 3300025900 Bacteria 840
99 Ga0207685_10028416 3300025905 Bacteria 1969
100 Ga0207685_10187309 3300025905 Bacteria 963
101 Ga0207699_10002238 3300025906 Bacteria 9132
102 Ga0207705_11217898 3300025909 Bacteria 577
103 Ga0207684_10068823 3300025910 Bacteria 3008
104 Ga0207693_10003037 3300025915 Bacteria 14508
105 Ga0207693_10032548 3300025915 Bacteria 4114
106 Ga0207693_10189984 3300025915 Bacteria 1616
107 Ga0207693_10666886 3300025915 Bacteria 807
108 Ga0207663_10005221 3300025916 Bacteria 6535
109 Ga0207663_10017418 3300025916 Bacteria 4003
110 Ga0207646_10127542 3300025922 Bacteria 2288
111 Ga0207646_10171615 3300025922 Bacteria 1958
112 Ga0207700_10013355 3300025928 Bacteria 5340
113 Ga0207700_10014574 3300025928 Bacteria 5155
114 Ga0207700_10078222 3300025928 Bacteria 2572
115 Ga0207700_11495820 3300025928 Bacteria 599
116 Ga0207664_10006920 3300025929 Bacteria 7844
117 Ga0207664_10012045 3300025929 Bacteria 6174
118 Ga0207664_11206373 3300025929 Bacteria 675
119 Ga0207664_11329827 3300025929 Bacteria 638
120 Ga0207664_11472162 3300025929 Bacteria 602
121 Ga0207664_11981446 3300025929 Bacteria 505
122 Ga0207669_10153804 3300025937 Bacteria 1615
123 Ga0207669_10513372 3300025937 Bacteria 961
124 Ga0207704_10036579 3300025938 Bacteria 2826
125 Ga0207665_10001671 3300025939 Bacteria 14927
126 Ga0207665_10018268 3300025939 Bacteria 4605
127 Ga0207665_11259734 3300025939 Bacteria 590
128 Ga0207711_10025588 3300025941 Bacteria 4950
129 Ga0207711_10299880 3300025941 Bacteria 1482
130 Ga0207712_10145707 3300025961 Bacteria 1823
131 Ga0207668_10058535 3300025972 Bacteria 2694
132 Ga0207668_11930426 3300025972 Bacteria 532
133 Ga0207640_11069950 3300025981 Bacteria 712
134 Ga0207658_10224976 3300025986 Bacteria 1580
135 Ga0207658_10455827 3300025986 Bacteria 1133
136 Ga0207677_10879270 3300026023 Bacteria 807
137 Ga0207639_10151320 3300026041 Bacteria 1944
138 Ga0207678_10597407 3300026067 Bacteria 967
139 Ga0207641_11675490 3300026088 Bacteria 638
140 Ga0268266_10096197 3300028379 Bacteria 2602
141 Ga0268266_10459099 3300028379 Bacteria 1212
142 Ga0268266_10490580 3300028379 Bacteria 1172
143 Ga0265760_10073918 3300031090 Bacteria 1048
144 Ga0307513_10001838 3300031456 Bacteria 30130
145 Ga0307413_10159134 3300031824 Bacteria 1584
146 Ga0307413_10435644 3300031824 Bacteria 1036
147 Ga0307410_10075400 3300031852 Bacteria 2351
148 Ga0307412_10054354 3300031911 Bacteria 2658
149 Ga0307412_11020155 3300031911 Bacteria 732
150 Ga0307409_101466397 3300031995 Bacteria 709
151 Ga0307409_101618218 3300031995 Bacteria 676
152 Ga0307416_100225007 3300032002 Bacteria 1803
153 Ga0307416_100364702 3300032002 Bacteria 1468
154 Ga0307414_11353713 3300032004 Bacteria 661
155 Ga0307415_100098417 3300032126 Bacteria 2138
156 Ga0307415_100328024 3300032126 Bacteria 1279
157 Ga0307510_10201558 3300033180 Bacteria 1524
158 Ga0373936_0511646 3300035113 Bacteria 559
159 Ga0373945_0444185 3300035116 Bacteria 573
160 Ga0373946_0041688 3300035171 Bacteria 1884
161 Ga0373931_0771714 3300035691 Bacteria 639
162 Ga0373935_0020454 3300035692 Bacteria 4045
163 Ga0373935_0707425 3300035692 Bacteria 741
164 Ga0373947_0069344 3300035725 Bacteria 2158
165 Ga0373937_0914260 3300036401 Bacteria 826
166 Ga0436364_0401332 3300037853 Bacteria 3837
167 Ga0436365_0709722 3300039437 Bacteria 4644
168 Ga0436365_1104928 3300039437 Bacteria 2446
169 Ga0439461_0001213 3300041410 Bacteria 3929
170 Ga0439466_0006149 3300041411 Bacteria 4573
171 Ga0439465_0119921 3300041413 Bacteria 921
172 Ga0451793_0357475 3300041452 Bacteria 707
173 Ga0439431_0002418 3300041997 Bacteria 4131
174 Ga0439442_000556 3300042002 Bacteria 8148
175 Ga0439445_0060364 3300042004 Bacteria 1036
176 Ga0466969_0002086 3300044656 Bacteria 10674
177 Ga0466969_0093410 3300044656 Bacteria 1423
178 Ga0466972_0017176 3300044658 Bacteria 3619
179 Ga0466972_0023757 3300044658 Bacteria 3047
180 Ga0466972_0282181 3300044658 Bacteria 776
181 Ga0466965_0000542 3300044683 Bacteria 13635
182 Ga0466965_0007602 3300044683 Bacteria 4986
183 Ga0466965_0011573 3300044683 Bacteria 4137
184 Ga0466965_0699330 3300044683 Bacteria 581
185 Ga0466965_0824524 3300044683 Bacteria 538
186 Ga0466966_0000478 3300044684 Bacteria 25793
187 Ga0466966_0104825 3300044684 Bacteria 1746
188 Ga0466966_0111590 3300044684 Bacteria 1685
189 Ga0466966_0240886 3300044684 Bacteria 1091
190 Ga0466961_0004559 3300044693 Bacteria 8690
191 Ga0466961_0012718 3300044693 Bacteria 5390
192 Ga0466961_0139113 3300044693 Bacteria 1521
193 Ga0466961_0157167 3300044693 Bacteria 1418
194 Ga0466963_0002736 3300044694 Bacteria 9951
195 Ga0466963_0010425 3300044694 Bacteria 5626
196 Ga0466963_0056683 3300044694 Bacteria 2608
197 Ga0466963_0162136 3300044694 Bacteria 1556
198 Ga0466963_1278174 3300044694 Bacteria 515
199 Ga0466971_0004442 3300044719 Bacteria 6054
200 Ga0466971_0017882 3300044719 Bacteria 3140
201 Ga0466971_0042083 3300044719 Bacteria 2053
202 Ga0466968_0001757 3300044735 Bacteria 7813
203 Ga0466968_0109046 3300044735 Bacteria 1243
204 Ga0466970_0001535 3300044765 Bacteria 11120
205 Ga0466970_0006819 3300044765 Bacteria 5717
206 Ga0466970_0092747 3300044765 Bacteria 1640
207 Ga0466970_0163865 3300044765 Bacteria 1230
208 Ga0466957_0009202 3300044842 Bacteria 5633
209 Ga0466957_0014109 3300044842 Bacteria 4648
210 Ga0466957_0014685 3300044842 Bacteria 4563
211 Ga0466957_0072794 3300044842 Bacteria 2128
212 Ga0466957_0848894 3300044842 Bacteria 651
213 Ga0466960_0000131 3300044901 Bacteria 25244
214 Ga0466960_0000972 3300044901 Bacteria 10179
215 Ga0466960_0002360 3300044901 Bacteria 7102
216 Ga0466960_0022405 3300044901 Bacteria 2824
217 Ga0466960_0109707 3300044901 Bacteria 1432
218 Ga0466959_0011653 3300045049 Bacteria 6322
219 Ga0466959_0071418 3300045049 Bacteria 2513
220 Ga0466959_0131772 3300045049 Bacteria 1771
221 Ga0466958_0005583 3300045836 Bacteria 6784
222 Ga0466958_0006063 3300045836 Bacteria 6553
223 Ga0466958_0044180 3300045836 Bacteria 2685
224 Ga0466967_0012503 3300045976 Bacteria 6498
225 Ga0466967_0288100 3300045976 Bacteria 1577
226 Ga0466967_0515520 3300045976 Bacteria 1174
227 Ga0466967_0534975 3300045976 Bacteria 1152
228 Ga0466967_2254931 3300045976 Bacteria 540
229 Ga0495603_0272990 3300046455 Bacteria 972
230 Ga0495641_0016534 3300046461 Bacteria 3884
231 Ga0495582_0418061 3300046473 Bacteria 773
232 Ga0495639_0030138 3300046475 Bacteria 2411
233 Ga0495628_0176194 3300046516 Bacteria 1619
234 Ga0495630_0977370 3300046517 Bacteria 644
235 Ga0495630_1519142 3300046517 Bacteria 502
236 Ga0495640_0032574 3300046533 Bacteria 3712
237 Ga0495668_0021684 3300046616 Bacteria 3680
238 Ga0495634_0827144 3300046642 Bacteria 527
239 Ga0495588_0584301 3300046674 Bacteria 585
240 Ga0495624_0342735 3300046690 Bacteria 899
241 Ga0495581_0106772 3300047315 Bacteria 1627
242 Ga0495676_0089938 3300047321 Bacteria 2299
243 Ga0495680_0065844 3300047322 Bacteria 2774
244 Ga0495680_0701352 3300047322 Bacteria 668
245 Ga0495683_0213584 3300047323 Bacteria 864
246 Ga0495593_0013401 3300047673 Bacteria 4679
247 Ga0496100_0117992 3300048903 Bacteria 1853
248 Ga0496100_1627491 3300048903 Bacteria 510
249 Ga0496101_0016790 3300048904 Bacteria 4955
250 Ga0496101_0532273 3300048904 Bacteria 929
251 Ga0496102_0000319 3300048905 Bacteria 60314
252 Ga0496102_0615888 3300048905 Bacteria 1009
253 Ga0496103_0025303 3300048906 Bacteria 3586
254 Ga0496104_0190501 3300048907 Bacteria 1962
255 Ga0496105_0728633 3300048908 Bacteria 759
256 Ga0496108_0025872 3300048911 Bacteria 4840
257 Ga0496108_0060284 3300048911 Bacteria 3193
258 Ga0496108_0850042 3300048911 Bacteria 785
259 Ga0496108_0862221 3300048911 Bacteria 779
260 Ga0496109_0008699 3300048912 Bacteria 8643
261 Ga0496109_0541847 3300048912 Bacteria 1098
262 Ga0496109_0566350 3300048912 Bacteria 1071
263 Ga0496109_0811200 3300048912 Bacteria 874
264 Ga0496111_0239384 3300048914 Bacteria 1348
265 Ga0496112_0003600 3300048915 Bacteria 12890
266 Ga0496112_0013340 3300048915 Bacteria 7584
267 Ga0496112_0016771 3300048915 Bacteria 6869
268 Ga0496113_0022843 3300048916 Bacteria 4430
269 Ga0496113_0027259 3300048916 Bacteria 4094
270 Ga0496113_0256669 3300048916 Bacteria 1396
271 Ga0496114_0138459 3300048917 Bacteria 2106
272 Ga0496115_0218503 3300048918 Bacteria 1573
273 Ga0496122_0137832 3300048925 Bacteria 1533
274 Ga0496123_0014124 3300048926 Bacteria 6641
275 Ga0496124_0442345 3300048927 Bacteria 889
276 Ga0496125_0072241 3300048928 Bacteria 2690
277 Ga0496125_0145420 3300048928 Bacteria 1639
278 Ga0496125_0146540 3300048928 Bacteria 1630
279 Ga0496126_0002811 3300048929 Bacteria 22838
280 Ga0501032_0003359 3300049569 Bacteria 12282
281 Ga0501033_0253792 3300049570 Bacteria 1246
282 Ga0501033_0254790 3300049570 Bacteria 1243
283 Ga0501033_0714937 3300049570 Bacteria 681
284 Ga0501034_0010616 3300049571 Bacteria 9585
285 Ga0501036_0051553 3300049572 Bacteria 3484
286 Ga0501037_0000307 3300049573 Bacteria 41601
287 Ga0501037_0598083 3300049573 Bacteria 741
288 Ga0501038_0002749 3300049574 Bacteria 16398
289 Ga0501038_0360896 3300049574 Bacteria 1130
290 Ga0501039_0002691 3300049575 Bacteria 13262
291 Ga0501040_0389441 3300049576 Bacteria 1000
292 Ga0501043_0000422 3300049579 Bacteria 38076
293 Ga0501043_1147853 3300049579 Bacteria 547
294 Ga0501068_0063045 3300049584 Bacteria 2255
295 Ga0501070_0026920 3300049586 Bacteria 4822
296 Ga0501071_0520901 3300049587 Bacteria 912
297 Ga0501073_0065195 3300049589 Bacteria 2540
298 Ga0501077_0030304 3300049593 Bacteria 3443
299 Ga0501079_0756613 3300049741 Bacteria 765
300 Ga0501080_0413184 3300049742 Bacteria 1213
301 Ga0501080_0652360 3300049742 Bacteria 931
302 Ga0501035_0490586 3300049822 Bacteria 1012
303 Ga0501044_0012280 3300049823 Bacteria 9273
304 Ga0501044_0085501 3300049823 Bacteria 3187
305 Ga0501045_1084519 3300049824 Bacteria 586
306 nmdc:mga03683_655621_c1 3300050489 Bacteria 517
307 nmdc:mga03n38_2463_c1 3300050490 Bacteria 5729
308 nmdc:mga03n38_494530_c1 3300050490 Bacteria 686
309 nmdc:mga03n38_91836_c1 3300050490 Bacteria 1447
310 nmdc:mga00v17_112482_c2 3300050491 Bacteria 642
311 nmdc:mga00v17_194313_c1 3300050491 Bacteria 1311
312 nmdc:mga00v17_523013_c1 3300050491 Bacteria 768
313 nmdc:mga00v17_71645_c1 3300050491 Bacteria 2149
314 nmdc:mga00v17_74292_c2 3300050491 Bacteria 1816
315 nmdc:mga00v17_81755_c1 3300050491 Bacteria 2018
316 nmdc:mga0yw44_15011_c1 3300050492 Bacteria 4135
317 nmdc:mga0yw44_25299_c1 3300050492 Bacteria 3373
318 nmdc:mga0yw44_394758_c1 3300050492 Bacteria 935
319 nmdc:mga0yw44_587970_c1 3300050492 Bacteria 756
320 nmdc:mga0yw44_596423_c1 3300050492 Bacteria 750
321 nmdc:mga0yw44_86045_c1 3300050492 Bacteria 1979
322 nmdc:mga06z11_484803_c1 3300050494 Bacteria 748
323 nmdc:mga0sz30_424866_c1 3300050516 Bacteria 596
324 nmdc:mga0sz30_54022_c1 3300050516 Bacteria 1708
325 Ga0500635_0001296 3300053080 Bacteria 5976
326 Ga0495619_0244756 3300053085 Bacteria 1243
327 Ga0495619_0682090 3300053085 Bacteria 699
328 Ga0500556_0091773 3300053104 Bacteria 1161
329 Ga0500642_0171775 3300053130 Bacteria 1015
330 Ga0500652_000726 3300053131 Bacteria 11184
331 Ga0500616_0045806 3300053153 Bacteria 2328
332 Ga0466962_0041464 3300061719 Bacteria 2202
333 Ga0466962_0043427 3300061719 Bacteria 2151
334 Ga0466962_0089320 3300061719 Bacteria 1476
335 2559423286 2558860280 Bacteria 11429938
336 2566991273 2565956761 Bacteria 6601618
337 2816508282 2816332139 Bacteria 9138787
338 2839987685 2839986021 Bacteria 3685650
339 2842890369 2842888712 Bacteria 4279094
340 2929217813 2929212328 Bacteria 7708288
341 2995464080 2995463766 Bacteria 8577691
342 Ga0466967_0150308
343 Ga0068868_100231539
344 Ga0070668_100062800
345 Ga0070667_100236542
346 Ga0070709_10008165
347 Ga0070714_100024181
348 Ga0070714_100121686
349 Ga0070713_100058326
350 Ga0070713_100078180
351 Ga0070713_100144756
352 Ga0070713_101180906
353 Ga0070710_10010204
354 Ga0070710_10012470
355 Ga0070711_100015958
356 Ga0070711_100025587
357 Ga0070711_101058908
358 Ga0070663_100639206
359 Ga0070681_10403673
360 Ga0070706_100013396
361 Ga0070706_100351108
362 Ga0070706_100470766
363 Ga0070707_100198137
364 Ga0070707_100500671
365 Ga0070698_100108188
366 Ga0070698_100407877
367 Ga0070699_100699945
368 Ga0068853_100025036
369 Ga0070665_100143266
370 Ga0068856_101095567
371 Ga0068863_100548228
372 Ga0070717_10009367
373 Ga0070717_10039820
374 Ga0075365_10054533
375 Ga0075365_10071556
376 Ga0075365_10270566
377 Ga0075365_10322496
378 Ga0075365_10404785
379 Ga0075368_10140103
380 Ga0075368_10192475
381 Ga0075363_100006376
382 Ga0075363_100028681
383 Ga0075363_100062083
384 Ga0075363_100103299
385 Ga0075364_10007084
386 Ga0075364_10010370
387 Ga0075364_10021645
388 Ga0075364_10031118
389 Ga0075364_10117954
390 Ga0075364_10131139
391 Ga0075364_10145770
392 Ga0075364_10455335
393 Ga0075364_11086175
394 Ga0070715_10003750
395 Ga0070716_100001006
396 Ga0070716_100322968
397 Ga0070716_100336237
398 Ga0070712_100018582
399 Ga0070712_100028175
400 Ga0070712_100487997
401 Ga0070712_100567196
402 Ga0075362_10138964
403 Ga0075367_11123763
404 Ga0075369_10002880
405 Ga0075370_10008096
406 Ga0075370_10054375
407 Ga0075370_10130355
408 Ga0075370_10358703
409 Ga0105250_10041918
410 Ga0105247_10078701
411 Ga0105248_10722108
412 Ga0105237_10229395
413 Ga0105237_12356791
414 Ga0105238_10066132
415 Ga0105249_10434755
416 Ga0105239_10583430
417 Ga0105239_12124335
418 Ga0105239_12345176
419 Ga0105246_11736257
420 Ga0157369_10856646
421 Ga0157374_11415354
422 Ga0157375_10263883
423 Ga0157379_10516928
424 Ga0157379_10531622
425 Ga0197907_11351405
426 Ga0206356_10901819
427 Ga0206355_1373942
428 Ga0206350_10718750
429 Ga0206353_10088086
430 Ga0213876_10062964
431 Ga0213876_10355236
432 Ga0213875_10015299
433 Ga0224712_10026061
434 Ga0224712_10294801
435 Ga0207692_10003343
436 Ga0207692_10098394
437 Ga0207692_11195430
438 Ga0207710_10124101
439 Ga0207710_10279151
440 Ga0207685_10028416
441 Ga0207685_10187309
442 Ga0207699_10002238
443 Ga0207705_11217898
444 Ga0207684_10068823
445 Ga0207693_10003037
446 Ga0207693_10032548
447 Ga0207693_10189984
448 Ga0207693_10666886
449 Ga0207663_10005221
450 Ga0207663_10017418
451 Ga0207646_10127542
452 Ga0207646_10171615
453 Ga0207700_10013355
454 Ga0207700_10014574
455 Ga0207700_10078222
456 Ga0207700_11495820
457 Ga0207664_10006920
458 Ga0207664_10012045
459 Ga0207664_11206373
460 Ga0207664_11329827
461 Ga0207664_11472162
462 Ga0207664_11981446
463 Ga0207669_10153804
464 Ga0207669_10513372
465 Ga0207704_10036579
466 Ga0207665_10001671
467 Ga0207665_10018268
468 Ga0207665_11259734
469 Ga0207711_10025588
470 Ga0207711_10299880
471 Ga0207712_10145707
472 Ga0207668_10058535
473 Ga0207668_11930426
474 Ga0207640_11069950
475 Ga0207658_10224976
476 Ga0207658_10455827
477 Ga0207677_10879270
478 Ga0207639_10151320
479 Ga0207678_10597407
480 Ga0207641_11675490
481 Ga0268266_10096197
482 Ga0268266_10459099
483 Ga0268266_10490580
484 Ga0265760_10073918
485 Ga0307513_10001838
486 Ga0307413_10159134
487 Ga0307413_10435644
488 Ga0307410_10075400
489 Ga0307412_10054354
490 Ga0307412_11020155
491 Ga0307409_101466397
492 Ga0307409_101618218
493 Ga0307416_100225007
494 Ga0307416_100364702
495 Ga0307414_11353713
496 Ga0307415_100098417
497 Ga0307415_100328024
498 Ga0307510_10201558
499 Ga0373936_0511646
500 Ga0373945_0444185
501 Ga0373946_0041688
502 Ga0373931_0771714
503 Ga0373935_0020454
504 Ga0373935_0707425
505 Ga0373947_0069344
506 Ga0373937_0914260
507 Ga0436364_0401332
508 Ga0436365_0709722
509 Ga0436365_1104928
510 Ga0439461_0001213
511 Ga0439466_0006149
512 Ga0439465_0119921
513 Ga0451793_0357475
514 Ga0439431_0002418
515 Ga0439442_000556
516 Ga0439445_0060364
517 Ga0466969_0002086
518 Ga0466969_0093410
519 Ga0466972_0017176
520 Ga0466972_0023757
521 Ga0466972_0282181
522 Ga0466965_0000542
523 Ga0466965_0007602
524 Ga0466965_0011573
525 Ga0466965_0699330
526 Ga0466965_0824524
527 Ga0466966_0000478
528 Ga0466966_0104825
529 Ga0466966_0111590
530 Ga0466966_0240886
531 Ga0466961_0004559
532 Ga0466961_0012718
533 Ga0466961_0139113
534 Ga0466961_0157167
535 Ga0466963_0002736
536 Ga0466963_0010425
537 Ga0466963_0056683
538 Ga0466963_0162136
539 Ga0466963_1278174
540 Ga0466971_0004442
541 Ga0466971_0017882
542 Ga0466971_0042083
543 Ga0466968_0001757
544 Ga0466968_0109046
545 Ga0466970_0001535
546 Ga0466970_0006819
547 Ga0466970_0092747
548 Ga0466970_0163865
549 Ga0466957_0009202
550 Ga0466957_0014109
551 Ga0466957_0014685
552 Ga0466957_0072794
553 Ga0466957_0848894
554 Ga0466960_0000131
555 Ga0466960_0000972
556 Ga0466960_0002360
557 Ga0466960_0022405
558 Ga0466960_0109707
559 Ga0466959_0011653
560 Ga0466959_0071418
561 Ga0466959_0131772
562 Ga0466958_0005583
563 Ga0466958_0006063
564 Ga0466958_0044180
565 Ga0466967_0012503
566 Ga0466967_0288100
567 Ga0466967_0515520
568 Ga0466967_0534975
569 Ga0466967_2254931
570 Ga0495603_0272990
571 Ga0495641_0016534
572 Ga0495582_0418061
573 Ga0495639_0030138
574 Ga0495628_0176194
575 Ga0495630_0977370
576 Ga0495630_1519142
577 Ga0495640_0032574
578 Ga0495668_0021684
579 Ga0495634_0827144
580 Ga0495588_0584301
581 Ga0495624_0342735
582 Ga0495581_0106772
583 Ga0495676_0089938
584 Ga0495680_0065844
585 Ga0495680_0701352
586 Ga0495683_0213584
587 Ga0495593_0013401
588 Ga0496100_0117992
589 Ga0496100_1627491
590 Ga0496101_0016790
591 Ga0496101_0532273
592 Ga0496102_0000319
593 Ga0496102_0615888
594 Ga0496103_0025303
595 Ga0496104_0190501
596 Ga0496105_0728633
597 Ga0496108_0025872
598 Ga0496108_0060284
599 Ga0496108_0850042
600 Ga0496108_0862221
601 Ga0496109_0008699
602 Ga0496109_0541847
603 Ga0496109_0566350
604 Ga0496109_0811200
605 Ga0496111_0239384
606 Ga0496112_0003600
607 Ga0496112_0013340
608 Ga0496112_0016771
609 Ga0496113_0022843
610 Ga0496113_0027259
611 Ga0496113_0256669
612 Ga0496114_0138459
613 Ga0496115_0218503
614 Ga0496122_0137832
615 Ga0496123_0014124
616 Ga0496124_0442345
617 Ga0496125_0072241
618 Ga0496125_0145420
619 Ga0496125_0146540
620 Ga0496126_0002811
621 Ga0501032_0003359
622 Ga0501033_0253792
623 Ga0501033_0254790
624 Ga0501033_0714937
625 Ga0501034_0010616
626 Ga0501036_0051553
627 Ga0501037_0000307
628 Ga0501037_0598083
629 Ga0501038_0002749
630 Ga0501038_0360896
631 Ga0501039_0002691
632 Ga0501040_0389441
633 Ga0501043_0000422
634 Ga0501043_1147853
635 Ga0501068_0063045
636 Ga0501070_0026920
637 Ga0501071_0520901
638 Ga0501073_0065195
639 Ga0501077_0030304
640 Ga0501079_0756613
641 Ga0501080_0413184
642 Ga0501080_0652360
643 Ga0501035_0490586
644 Ga0501044_0012280
645 Ga0501044_0085501
646 Ga0501045_1084519
647 nmdc:mga03683_655621_c1
648 nmdc:mga03n38_2463_c1
649 nmdc:mga03n38_494530_c1
650 nmdc:mga03n38_91836_c1
651 nmdc:mga00v17_112482_c2
652 nmdc:mga00v17_194313_c1
653 nmdc:mga00v17_523013_c1
654 nmdc:mga00v17_71645_c1
655 nmdc:mga00v17_74292_c2
656 nmdc:mga00v17_81755_c1
657 nmdc:mga0yw44_15011_c1
658 nmdc:mga0yw44_25299_c1
659 nmdc:mga0yw44_394758_c1
660 nmdc:mga0yw44_587970_c1
661 nmdc:mga0yw44_596423_c1
662 nmdc:mga0yw44_86045_c1
663 nmdc:mga06z11_484803_c1
664 nmdc:mga0sz30_424866_c1
665 nmdc:mga0sz30_54022_c1
666 Ga0500635_0001296
667 Ga0495619_0244756
668 Ga0495619_0682090
669 Ga0500556_0091773
670 Ga0500642_0171775
671 Ga0500652_000726
672 Ga0500616_0045806
673 Ga0466962_0041464
674 Ga0466962_0043427
675 Ga0466962_0089320
676 2559423286
677 2566991273
678 2816508282
679 2839987685
680 2842890369
681 2929217813
682 2995464080

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02148

zf-UBP

Zn-finger in ubiquitin-hydrolases and other protein

31

100

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
2i50-assembly1.cif.gz_A solution structure of ubp-m znf-ubp domain 0.7831 36 89
2ida-assembly1.cif.gz_A error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.7402 15 88
2idh-assembly5.cif.gz_E crystal structure of human fe65 ww domain 0.6569 66 87
2e45-assembly1.cif.gz_A solution structure of fe65 ww domain 0.6291 66 94
7ms6-assembly1.cif.gz_A structure of usp5 zinc-finger ubiquitin binding domain co-crystallized with (2-fluoro-4-((4-phenylpiperidin-1-yl)sulfonyl)benzoyl)glycine 0.6276 8 86
ID Description Score Start End Superfamily
af_I1MCC9_211_290_3.30.40.10 Alpha Beta;2-Layer Sandwich;Herpes Virus-1;Zinc/RING finger domain, C3HC4 (zinc finger) 0.852 35 87 3.30.40.10
af_Q0J492_27_131_3.30.40.10 Alpha Beta;2-Layer Sandwich;Herpes Virus-1;Zinc/RING finger domain, C3HC4 (zinc finger) 0.8205 33 87 3.30.40.10
af_A4I4U4_147_248_3.30.40.10 Alpha Beta;2-Layer Sandwich;Herpes Virus-1;Zinc/RING finger domain, C3HC4 (zinc finger) 0.8111 34 88 3.30.40.10
af_P38748_276_364_3.30.40.10 Alpha Beta;2-Layer Sandwich;Herpes Virus-1;Zinc/RING finger domain, C3HC4 (zinc finger) 0.8085 35 93 3.30.40.10
af_K7TY00_53_173_3.30.40.10 Alpha Beta;2-Layer Sandwich;Herpes Virus-1;Zinc/RING finger domain, C3HC4 (zinc finger) 0.7905 35 90 3.30.40.10
ID Description Score Start End GO Terms
AF-A0A7H0I4M0-F1-model_v4 UBP-type zinc finger domain-containing protein 0.8886 34 87 GO:0008270
AF-A0A536JFN2-F1-model_v4 UBP-type zinc finger domain-containing protein 0.8821 36 87 GO:0008270
AF-A0A536AU09-F1-model_v4 UBP-type zinc finger domain-containing protein 0.8738 39 87 GO:0008270
AF-A0A4Y4B2C0-F1-model_v4 UBP-type domain-containing protein 0.8676 33 87 GO:0008270
AF-A0A7W0S772-F1-model_v4 UBP-type zinc finger domain-containing protein 0.8666 34 87 GO:0008270

Map