F414839

General Info

Members Datasets Scaffolds Average Seq Length
341 139 682 277

Family's Representative Sequence

Representative Sequence 3300042531|Ga0450918_022074|Ga0450918_022074_234_1040
Length 268
Sequence MCRWLAYSGTPIRLEELLVKRDRSLIDQSLHSRLGATTTNGDGFGVGWYDDAGAPRLYRSTHPAWNDRNLRELAAGVSSHLFFAHIRASTGTAIQETNTHPFRHGNWLWMHNGLNRELVLAIDDSLFTSIEGTTDSETMFYLALTCGLETDPVGAVERMVALVEDAGHAAGVEHPIQMTVATTDGRCIWAFRYSSEGGSRSLYFSTRIDALKAMYPESPDLAALGDETRAVVSEPLGDLVGAWNEVPESHVAIVQTGGDELRPFTPRG

Samples

Sample ID Description Type Environment
1 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
2 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
3 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
6 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
7 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
8 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
9 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
10 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
11 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
12 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
13 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
14 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
15 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
16 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
17 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
18 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
19 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
20 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
21 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
22 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
23 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
24 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
25 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
26 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
27 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
28 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
29 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
30 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
31 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
32 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
33 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
40 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
41 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
42 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
44 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
45 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
46 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
47 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
48 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
49 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
50 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
51 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
52 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
53 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
54 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
55 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
56 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
57 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
58 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
59 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
60 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
61 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
62 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
63 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
64 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
65 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
66 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
67 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
68 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
69 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
70 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
71 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
72 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
73 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
74 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
75 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
76 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
77 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
78 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
79 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
80 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
81 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
82 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
83 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
84 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
85 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
86 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
87 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
88 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
89 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
90 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
91 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
92 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
93 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
94 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
95 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
96 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
97 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
98 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
99 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
100 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
101 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
102 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
103 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
104 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
105 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
106 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
107 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
108 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
109 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
110 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
111 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
112 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
113 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
114 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
115 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
116 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
117 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
118 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
119 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
120 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
121 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
122 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
123 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
124 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
125 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
126 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
127 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
128 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
129 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
130 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
131 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
132 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
133 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
134 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
135 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
136 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
137 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
138 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
139 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.71
Metatranscriptomes 0.29
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.28
Nodule 0
Rhizoplane 1.76
Rhizosphere 91.2
Stem 0
Stem Tuber 0
Unclassified 0.59

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0450918_022074 3300042531 Bacteria 1112
2 JGI24738J21930_10029897 3300002075 Bacteria 1113
3 JGI25407J50210_10022077 3300003373 Bacteria 1655
4 Ga0070683_100037277 3300005329 Bacteria 4450
5 Ga0070683_100049997 3300005329 Bacteria 3868
6 Ga0070683_100380584 3300005329 Bacteria 1345
7 Ga0070659_100194588 3300005366 Bacteria 1667
8 Ga0070713_100042569 3300005436 Bacteria 3708
9 Ga0070701_10167198 3300005438 Bacteria 1278
10 Ga0070694_100064121 3300005444 Bacteria 2514
11 Ga0070678_100253245 3300005456 Bacteria 1477
12 Ga0070684_100004099 3300005535 Bacteria 11029
13 Ga0070684_100007333 3300005535 Bacteria 8573
14 Ga0070684_100059378 3300005535 Bacteria 3343
15 Ga0070684_100121855 3300005535 Bacteria 2346
16 Ga0070665_100121015 3300005548 Bacteria 2619
17 Ga0070664_100174842 3300005564 Unclassified 1906
18 Ga0070664_100442146 3300005564 Bacteria 1193
19 Ga0068857_100015680 3300005577 Bacteria 6625
20 Ga0068857_100025562 3300005577 Bacteria 5199
21 Ga0068857_100037490 3300005577 Bacteria 4295
22 Ga0068870_10030150 3300005840 Bacteria 2740
23 Ga0081455_10000399 3300005937 Bacteria 57228
24 Ga0081455_10002965 3300005937 Bacteria 19843
25 Ga0081455_10007487 3300005937 Bacteria 11489
26 Ga0081455_10009750 3300005937 Bacteria 9836
27 Ga0081455_10079304 3300005937 Bacteria 2696
28 Ga0081455_10093453 3300005937 Bacteria 2431
29 Ga0081455_10239614 3300005937 Bacteria 1334
30 Ga0081538_10000720 3300005981 Bacteria 36112
31 Ga0081538_10000983 3300005981 Bacteria 30287
32 Ga0081538_10007677 3300005981 Bacteria 9297
33 Ga0081538_10010960 3300005981 Bacteria 7382
34 Ga0081538_10013034 3300005981 Bacteria 6615
35 Ga0081538_10022668 3300005981 Bacteria 4544
36 Ga0081538_10032411 3300005981 Bacteria 3502
37 Ga0081538_10088172 3300005981 Bacteria 1616
38 Ga0081538_10093141 3300005981 Bacteria 1548
39 Ga0081538_10098493 3300005981 Bacteria 1481
40 Ga0081538_10117334 3300005981 Bacteria 1289
41 Ga0070717_10013755 3300006028 Bacteria 6210
42 Ga0075365_10013101 3300006038 Bacteria 4945
43 Ga0075365_10164002 3300006038 Bacteria 1549
44 Ga0075364_10012451 3300006051 Bacteria 5203
45 Ga0075432_10079095 3300006058 Bacteria 1190
46 Ga0075367_10096928 3300006178 Bacteria 1799
47 Ga0075428_100027384 3300006844 Bacteria 6307
48 Ga0075428_100059679 3300006844 Bacteria 4177
49 Ga0075430_100023817 3300006846 Bacteria 5213
50 Ga0075430_100039973 3300006846 Bacteria 3970
51 Ga0075431_100017689 3300006847 Bacteria 7247
52 Ga0075431_100027589 3300006847 Bacteria 5827
53 Ga0075431_100524405 3300006847 Bacteria 1174
54 Ga0075431_100649765 3300006847 Bacteria 1035
55 Ga0075433_10018670 3300006852 Bacteria 5767
56 Ga0075429_100011934 3300006880 Bacteria 7532
57 Ga0075429_100018912 3300006880 Bacteria 5967
58 Ga0075429_100035929 3300006880 Bacteria 4309
59 Ga0111539_10005512 3300009094 Bacteria 16373
60 Ga0111539_10012190 3300009094 Bacteria 10785
61 Ga0111539_10064195 3300009094 Bacteria 4345
62 Ga0111539_10121390 3300009094 Bacteria 3062
63 Ga0114129_10005096 3300009147 Bacteria 18504
64 Ga0114129_10010166 3300009147 Bacteria 13415
65 Ga0114129_10088499 3300009147 Bacteria 4293
66 Ga0114129_10106795 3300009147 Bacteria 3867
67 Ga0114129_10548663 3300009147 Bacteria 1503
68 Ga0105243_10679446 3300009148 Bacteria 1001
69 Ga0105242_10499624 3300009176 Bacteria 1157
70 Ga0105246_10016995 3300011119 Bacteria 4619
71 Ga0105246_10369300 3300011119 Bacteria 1182
72 Ga0105246_10381050 3300011119 Bacteria 1165
73 Ga0206350_11452709 3300020080 Bacteria 1472
74 Ga0207688_10009309 3300025901 Bacteria 5355
75 Ga0207645_10217229 3300025907 Bacteria 1260
76 Ga0207643_10035887 3300025908 Bacteria 2781
77 Ga0207643_10281191 3300025908 Bacteria 1032
78 Ga0207691_10231595 3300025940 Bacteria 1600
79 Ga0207661_10017844 3300025944 Bacteria 5260
80 Ga0207679_10040594 3300025945 Unclassified 3333
81 Ga0207679_10398480 3300025945 Bacteria 1210
82 Ga0207648_10569108 3300026089 Bacteria 1042
83 Ga0207674_10003106 3300026116 Bacteria 20505
84 Ga0207674_10011988 3300026116 Bacteria 9715
85 Ga0207674_10061662 3300026116 Bacteria 3788
86 Ga0207674_10084740 3300026116 Bacteria 3166
87 Ga0207675_100668893 3300026118 Bacteria 1045
88 Ga0207683_10171668 3300026121 Bacteria 1964
89 Ga0207428_10001728 3300027907 Bacteria 22368
90 Ga0207428_10042239 3300027907 Bacteria 3687
91 Ga0207428_10066793 3300027907 Bacteria 2833
92 Ga0207428_10219754 3300027907 Bacteria 1425
93 Ga0307517_10011196 3300028786 Bacteria 12449
94 Ga0307511_10142220 3300030521 Bacteria 1405
95 Ga0307508_10015830 3300031616 Bacteria 6871
96 Ga0307514_10072581 3300031649 Bacteria 2577
97 Ga0307516_10103499 3300031730 Bacteria 2660
98 Ga0307518_10051511 3300031838 Bacteria 2992
99 Ga0373941_0020357 3300035115 Bacteria 1859
100 Ga0373956_0196029 3300035119 Bacteria 957
101 Ga0373927_0104971 3300035695 Bacteria 1840
102 Ga0395899_0000921 3300037312 Bacteria 27676
103 Ga0395899_0001079 3300037312 Bacteria 24565
104 Ga0395899_0032670 3300037312 Bacteria 3911
105 Ga0395899_0055380 3300037312 Bacteria 2933
106 Ga0395899_0282669 3300037312 Bacteria 1128
107 Ga0395900_0006041 3300037418 Bacteria 12631
108 Ga0395900_0007576 3300037418 Bacteria 11210
109 Ga0395900_0008888 3300037418 Bacteria 10314
110 Ga0395900_0009902 3300037418 Bacteria 9762
111 Ga0395900_0009922 3300037418 Bacteria 9749
112 Ga0395898_0005065 3300037466 Bacteria 14288
113 Ga0395898_0008666 3300037466 Bacteria 10730
114 Ga0395898_0034416 3300037466 Bacteria 5049
115 Ga0395898_0044072 3300037466 Bacteria 4394
116 Ga0395905_0009171 3300037471 Bacteria 9688
117 Ga0395905_0055067 3300037471 Bacteria 3723
118 Ga0395905_0073225 3300037471 Bacteria 3211
119 Ga0395905_0394977 3300037471 Bacteria 1277
120 Ga0395901_0006587 3300038443 Bacteria 11735
121 Ga0395901_0009366 3300038443 Bacteria 9934
122 Ga0395901_0040308 3300038443 Bacteria 4836
123 Ga0395901_0091429 3300038443 Bacteria 3185
124 Ga0395901_0191118 3300038443 Bacteria 2147
125 Ga0450907_018960 3300042146 Bacteria 1153
126 Ga0451576_0156023 3300045051 Bacteria 2381
127 Ga0466967_0605398 3300045976 Bacteria 1082
128 Ga0495603_0048488 3300046455 Bacteria 2529
129 Ga0495629_0142718 3300046459 Bacteria 1666
130 Ga0495638_0029568 3300046460 Bacteria 3533
131 Ga0495641_0067931 3300046461 Bacteria 1602
132 Ga0495582_0112908 3300046473 Bacteria 1527
133 Ga0495584_0064529 3300046491 Bacteria 1841
134 Ga0495620_0110479 3300046515 Bacteria 1090
135 Ga0495643_0007596 3300046522 Bacteria 6970
136 Ga0495633_0041533 3300046558 Bacteria 2187
137 Ga0495668_0172446 3300046616 Bacteria 1185
138 Ga0495611_0192762 3300046648 Bacteria 951
139 Ga0495659_0040187 3300046664 Bacteria 1666
140 Ga0495670_0008889 3300046691 Bacteria 4941
141 Ga0495589_0035168 3300046794 Bacteria 2513
142 Ga0495660_0018165 3300046810 Bacteria 4043
143 Ga0495683_0026510 3300047323 Bacteria 2966
144 Ga0495687_010276 3300047443 Bacteria 5142
145 Ga0495685_000854 3300047447 Bacteria 9277
146 Ga0495681_0003359 3300047470 Bacteria 11138
147 Ga0495626_0081119 3300048091 Bacteria 1441
148 Ga0496106_0200741 3300048909 Bacteria 1587
149 Ga0496109_0096455 3300048912 Bacteria 2739
150 Ga0496109_0096889 3300048912 Bacteria 2733
151 Ga0496109_0482667 3300048912 Bacteria 1170
152 Ga0496113_0065861 3300048916 Bacteria 2743
153 Ga0496114_0086864 3300048917 Bacteria 2651
154 Ga0501031_0010048 3300049568 Bacteria 6166
155 Ga0501031_0030048 3300049568 Bacteria 3544
156 Ga0501031_0123735 3300049568 Bacteria 1689
157 Ga0501031_0346635 3300049568 Bacteria 961
158 Ga0501032_0000274 3300049569 Bacteria 43406
159 Ga0501032_0017206 3300049569 Bacteria 5077
160 Ga0501032_0071633 3300049569 Bacteria 2310
161 Ga0501033_0000629 3300049570 Bacteria 32631
162 Ga0501033_0010887 3300049570 Bacteria 6972
163 Ga0501033_0040264 3300049570 Bacteria 3489
164 Ga0501034_0015643 3300049571 Bacteria 7794
165 Ga0501034_0022195 3300049571 Bacteria 6468
166 Ga0501036_0000296 3300049572 Bacteria 34579
167 Ga0501036_0002824 3300049572 Bacteria 13760
168 Ga0501036_0019714 3300049572 Bacteria 5662
169 Ga0501036_0054916 3300049572 Bacteria 3374
170 Ga0501036_0268609 3300049572 Bacteria 1428
171 Ga0501036_0409849 3300049572 Bacteria 1130
172 Ga0501037_0000379 3300049573 Bacteria 36982
173 Ga0501037_0074849 3300049573 Bacteria 2459
174 Ga0501038_0000186 3300049574 Bacteria 53569
175 Ga0501038_0167433 3300049574 Bacteria 1781
176 Ga0501038_0176297 3300049574 Bacteria 1727
177 Ga0501039_0000141 3300049575 Bacteria 49210
178 Ga0501039_0003753 3300049575 Bacteria 11412
179 Ga0501039_0017225 3300049575 Bacteria 5542
180 Ga0501039_0085328 3300049575 Bacteria 2459
181 Ga0501039_0158527 3300049575 Bacteria 1778
182 Ga0501039_0348902 3300049575 Bacteria 1163
183 Ga0501040_0000360 3300049576 Bacteria 26851
184 Ga0501040_0000794 3300049576 Bacteria 19617
185 Ga0501040_0033040 3300049576 Bacteria 3503
186 Ga0501040_0162617 3300049576 Bacteria 1578
187 Ga0501041_0000039 3300049577 Bacteria 44027
188 Ga0501041_0001199 3300049577 Bacteria 14174
189 Ga0501041_0034379 3300049577 Bacteria 3068
190 Ga0501041_0093628 3300049577 Bacteria 1855
191 Ga0501041_0209030 3300049577 Bacteria 1224
192 Ga0501041_0248149 3300049577 Bacteria 1119
193 Ga0501041_0271644 3300049577 Bacteria 1066
194 Ga0501042_0000561 3300049578 Bacteria 19667
195 Ga0501042_0003078 3300049578 Bacteria 10384
196 Ga0501042_0028966 3300049578 Bacteria 3905
197 Ga0501042_0160221 3300049578 Bacteria 1623
198 Ga0501042_0176011 3300049578 Bacteria 1543
199 Ga0501042_0177293 3300049578 Bacteria 1537
200 Ga0501042_0247879 3300049578 Bacteria 1285
201 Ga0501043_0000171 3300049579 Bacteria 58361
202 Ga0501043_0007052 3300049579 Bacteria 8944
203 Ga0501043_0019374 3300049579 Bacteria 5342
204 Ga0501043_0298003 3300049579 Bacteria 1233
205 Ga0501046_0000177 3300049580 Bacteria 65024
206 Ga0501046_0005729 3300049580 Bacteria 11086
207 Ga0501046_0069548 3300049580 Bacteria 2739
208 Ga0501046_0186786 3300049580 Bacteria 1547
209 Ga0501046_0241998 3300049580 Bacteria 1330
210 Ga0501047_0000481 3300049581 Bacteria 43439
211 Ga0501047_0054508 3300049581 Bacteria 3867
212 Ga0501048_0002189 3300049582 Bacteria 14872
213 Ga0501048_0007659 3300049582 Bacteria 8186
214 Ga0501048_0009092 3300049582 Bacteria 7477
215 Ga0501048_0026245 3300049582 Bacteria 4241
216 Ga0501048_0053044 3300049582 Bacteria 2885
217 Ga0501068_0000051 3300049584 Bacteria 45579
218 Ga0501068_0017525 3300049584 Bacteria 4144
219 Ga0501068_0018521 3300049584 Bacteria 4032
220 Ga0501068_0070347 3300049584 Bacteria 2134
221 Ga0501069_0005071 3300049585 Bacteria 6829
222 Ga0501069_0008554 3300049585 Bacteria 5381
223 Ga0501069_0066234 3300049585 Bacteria 2020
224 Ga0501070_0015679 3300049586 Bacteria 6370
225 Ga0501071_0000031 3300049587 Bacteria 47260
226 Ga0501071_0002390 3300049587 Bacteria 11371
227 Ga0501071_0019587 3300049587 Bacteria 4696
228 Ga0501071_0059776 3300049587 Bacteria 2758
229 Ga0501071_0120142 3300049587 Bacteria 1947
230 Ga0501071_0150180 3300049587 Bacteria 1738
231 Ga0501071_0170008 3300049587 Bacteria 1631
232 Ga0501072_0000342 3300049588 Bacteria 33158
233 Ga0501072_0006266 3300049588 Bacteria 9065
234 Ga0501072_0006436 3300049588 Bacteria 8943
235 Ga0501072_0038000 3300049588 Bacteria 3778
236 Ga0501072_0055194 3300049588 Bacteria 3131
237 Ga0501072_0136879 3300049588 Bacteria 1952
238 Ga0501072_0172196 3300049588 Bacteria 1727
239 Ga0501072_0260522 3300049588 Bacteria 1380
240 Ga0501073_0000337 3300049589 Bacteria 31624
241 Ga0501073_0028558 3300049589 Bacteria 3986
242 Ga0501074_0000054 3300049590 Bacteria 55953
243 Ga0501074_0028357 3300049590 Bacteria 4057
244 Ga0501074_0032315 3300049590 Bacteria 3792
245 Ga0501074_0043761 3300049590 Bacteria 3241
246 Ga0501075_0001395 3300049591 Bacteria 15720
247 Ga0501075_0002589 3300049591 Bacteria 12069
248 Ga0501075_0003712 3300049591 Bacteria 10256
249 Ga0501075_0050690 3300049591 Bacteria 3120
250 Ga0501075_0084690 3300049591 Bacteria 2401
251 Ga0501075_0086097 3300049591 Bacteria 2381
252 Ga0501076_0000484 3300049592 Bacteria 25088
253 Ga0501076_0001344 3300049592 Bacteria 16445
254 Ga0501076_0008181 3300049592 Bacteria 7656
255 Ga0501076_0024524 3300049592 Bacteria 4662
256 Ga0501076_0229500 3300049592 Bacteria 1517
257 Ga0501076_0305679 3300049592 Bacteria 1304
258 Ga0501077_0000419 3300049593 Bacteria 25710
259 Ga0501077_0002115 3300049593 Bacteria 11984
260 Ga0501077_0112283 3300049593 Bacteria 1727
261 Ga0501077_0160903 3300049593 Bacteria 1425
262 Ga0501077_0161137 3300049593 Bacteria 1424
263 Ga0501079_0000108 3300049741 Bacteria 42571
264 Ga0501079_0006514 3300049741 Bacteria 8771
265 Ga0501079_0006578 3300049741 Bacteria 8740
266 Ga0501079_0033785 3300049741 Bacteria 3935
267 Ga0501079_0039865 3300049741 Bacteria 3623
268 Ga0501079_0123940 3300049741 Bacteria 2010
269 Ga0501080_0000301 3300049742 Bacteria 37557
270 Ga0501080_0041375 3300049742 Bacteria 4294
271 Ga0501080_0181750 3300049742 Bacteria 1935
272 Ga0501081_0002439 3300049743 Bacteria 11741
273 Ga0501081_0003567 3300049743 Bacteria 9947
274 Ga0501081_0004466 3300049743 Bacteria 8973
275 Ga0501081_0021420 3300049743 Bacteria 4313
276 Ga0501081_0111729 3300049743 Bacteria 1939
277 Ga0501081_0177950 3300049743 Bacteria 1537
278 Ga0501081_0189966 3300049743 Bacteria 1487
279 Ga0501083_0010252 3300049744 Bacteria 6602
280 Ga0501083_0024263 3300049744 Bacteria 4202
281 Ga0501083_0138339 3300049744 Bacteria 1595
282 Ga0501035_0000457 3300049822 Bacteria 45780
283 Ga0501035_0040754 3300049822 Bacteria 4194
284 Ga0501035_0076839 3300049822 Bacteria 2952
285 Ga0501035_0181455 3300049822 Bacteria 1813
286 Ga0501044_0003357 3300049823 Bacteria 18050
287 Ga0501044_0051571 3300049823 Bacteria 4241
288 Ga0501045_0000050 3300049824 Bacteria 51884
289 Ga0501045_0001208 3300049824 Bacteria 17196
290 Ga0501045_0002154 3300049824 Bacteria 13333
291 Ga0501045_0028719 3300049824 Bacteria 4013
292 Ga0501045_0057663 3300049824 Bacteria 2842
293 Ga0501045_0260504 3300049824 Bacteria 1291
294 nmdc:mga00v17_74091_c1 3300050491 Bacteria 2115
295 nmdc:mga0yw44_125858_c1 3300050492 Bacteria 1655
296 nmdc:mga04h51_96775_c1 3300050495 Bacteria 1070
297 nmdc:mga05p37_213767_c1 3300050507 Bacteria 2330
298 nmdc:mga05p37_30786_c1 3300050507 Bacteria 6550
299 nmdc:mga05p37_44413_c1 3300050507 Bacteria 5467
300 nmdc:mga05p37_4768_c1 3300050507 Bacteria 15843
301 nmdc:mga09592_1338_c1 3300050508 Bacteria 19735
302 nmdc:mga09592_13435_c1 3300050508 Bacteria 6685
303 nmdc:mga09592_27840_c1 3300050508 Bacteria 4691
304 nmdc:mga0qj67_32576_c1 3300050509 Bacteria 4066
305 nmdc:mga0qj67_36197_c1 3300050509 Bacteria 3861
306 nmdc:mga06r32_555117_c1 3300050510 Bacteria 1122
307 nmdc:mga06r32_604259_c1 3300050510 Bacteria 1068
308 nmdc:mga06r32_93369_c1 3300050510 Bacteria 2943
309 nmdc:mga08y16_27673_c1 3300050511 Bacteria 5973
310 nmdc:mga08y16_74305_c1 3300050511 Bacteria 3542
311 nmdc:mga08y16_7680_c1 3300050511 Bacteria 11288
312 nmdc:mga08y16_79773_c1 3300050511 Bacteria 3412
313 Ga0495655_0052828 3300053083 Bacteria 1082
314 Ga0500578_0038048 3300053086 Bacteria 3090
315 Ga0500569_009763 3300053109 Bacteria 2239
316 Ga0500628_000923 3300053129 Bacteria 5168
317 Ga0500652_001399 3300053131 Bacteria 7519
318 Ga0500658_0003900 3300053134 Bacteria 5611
319 Ga0500561_0000259 3300053137 Bacteria 9203
320 Ga0500600_0006818 3300053149 Bacteria 6837
321 Ga0500616_0061114 3300053153 Bacteria 1951
322 Ga0500633_0001657 3300053160 Bacteria 4312
323 Ga0500634_0018361 3300053161 Bacteria 3755
324 Ga0500587_000889 3300053739 Bacteria 3979
325 Ga0501084_0000974 3300054114 Bacteria 22204
326 Ga0501084_0005021 3300054114 Bacteria 10821
327 Ga0501084_0006237 3300054114 Bacteria 9805
328 Ga0501084_0008033 3300054114 Bacteria 8689
329 Ga0501084_0103786 3300054114 Bacteria 2388
330 Ga0501084_0118139 3300054114 Bacteria 2229
331 Ga0501082_0007202 3300060353 Bacteria 9587
332 Ga0501082_0024802 3300060353 Bacteria 5168
333 Ga0501082_0026750 3300060353 Bacteria 4971
334 Ga0501082_0072292 3300060353 Bacteria 2971
335 Ga0501082_0085618 3300060353 Bacteria 2718
336 Ga0501082_0176369 3300060353 Bacteria 1858
337 Ga0530510_0000188 3300061734 Bacteria 37875
338 Ga0530510_0001091 3300061734 Bacteria 17991
339 Ga0530510_0001362 3300061734 Bacteria 16331
340 Ga0530510_0003123 3300061734 Bacteria 11363
341 Ga0530510_0116250 3300061734 Bacteria 1961
342 Ga0450918_022074
343 JGI24738J21930_10029897
344 JGI25407J50210_10022077
345 Ga0070683_100037277
346 Ga0070683_100049997
347 Ga0070683_100380584
348 Ga0070659_100194588
349 Ga0070713_100042569
350 Ga0070701_10167198
351 Ga0070694_100064121
352 Ga0070678_100253245
353 Ga0070684_100004099
354 Ga0070684_100007333
355 Ga0070684_100059378
356 Ga0070684_100121855
357 Ga0070665_100121015
358 Ga0070664_100174842
359 Ga0070664_100442146
360 Ga0068857_100015680
361 Ga0068857_100025562
362 Ga0068857_100037490
363 Ga0068870_10030150
364 Ga0081455_10000399
365 Ga0081455_10002965
366 Ga0081455_10007487
367 Ga0081455_10009750
368 Ga0081455_10079304
369 Ga0081455_10093453
370 Ga0081455_10239614
371 Ga0081538_10000720
372 Ga0081538_10000983
373 Ga0081538_10007677
374 Ga0081538_10010960
375 Ga0081538_10013034
376 Ga0081538_10022668
377 Ga0081538_10032411
378 Ga0081538_10088172
379 Ga0081538_10093141
380 Ga0081538_10098493
381 Ga0081538_10117334
382 Ga0070717_10013755
383 Ga0075365_10013101
384 Ga0075365_10164002
385 Ga0075364_10012451
386 Ga0075432_10079095
387 Ga0075367_10096928
388 Ga0075428_100027384
389 Ga0075428_100059679
390 Ga0075430_100023817
391 Ga0075430_100039973
392 Ga0075431_100017689
393 Ga0075431_100027589
394 Ga0075431_100524405
395 Ga0075431_100649765
396 Ga0075433_10018670
397 Ga0075429_100011934
398 Ga0075429_100018912
399 Ga0075429_100035929
400 Ga0111539_10005512
401 Ga0111539_10012190
402 Ga0111539_10064195
403 Ga0111539_10121390
404 Ga0114129_10005096
405 Ga0114129_10010166
406 Ga0114129_10088499
407 Ga0114129_10106795
408 Ga0114129_10548663
409 Ga0105243_10679446
410 Ga0105242_10499624
411 Ga0105246_10016995
412 Ga0105246_10369300
413 Ga0105246_10381050
414 Ga0206350_11452709
415 Ga0207688_10009309
416 Ga0207645_10217229
417 Ga0207643_10035887
418 Ga0207643_10281191
419 Ga0207691_10231595
420 Ga0207661_10017844
421 Ga0207679_10040594
422 Ga0207679_10398480
423 Ga0207648_10569108
424 Ga0207674_10003106
425 Ga0207674_10011988
426 Ga0207674_10061662
427 Ga0207674_10084740
428 Ga0207675_100668893
429 Ga0207683_10171668
430 Ga0207428_10001728
431 Ga0207428_10042239
432 Ga0207428_10066793
433 Ga0207428_10219754
434 Ga0307517_10011196
435 Ga0307511_10142220
436 Ga0307508_10015830
437 Ga0307514_10072581
438 Ga0307516_10103499
439 Ga0307518_10051511
440 Ga0373941_0020357
441 Ga0373956_0196029
442 Ga0373927_0104971
443 Ga0395899_0000921
444 Ga0395899_0001079
445 Ga0395899_0032670
446 Ga0395899_0055380
447 Ga0395899_0282669
448 Ga0395900_0006041
449 Ga0395900_0007576
450 Ga0395900_0008888
451 Ga0395900_0009902
452 Ga0395900_0009922
453 Ga0395898_0005065
454 Ga0395898_0008666
455 Ga0395898_0034416
456 Ga0395898_0044072
457 Ga0395905_0009171
458 Ga0395905_0055067
459 Ga0395905_0073225
460 Ga0395905_0394977
461 Ga0395901_0006587
462 Ga0395901_0009366
463 Ga0395901_0040308
464 Ga0395901_0091429
465 Ga0395901_0191118
466 Ga0450907_018960
467 Ga0451576_0156023
468 Ga0466967_0605398
469 Ga0495603_0048488
470 Ga0495629_0142718
471 Ga0495638_0029568
472 Ga0495641_0067931
473 Ga0495582_0112908
474 Ga0495584_0064529
475 Ga0495620_0110479
476 Ga0495643_0007596
477 Ga0495633_0041533
478 Ga0495668_0172446
479 Ga0495611_0192762
480 Ga0495659_0040187
481 Ga0495670_0008889
482 Ga0495589_0035168
483 Ga0495660_0018165
484 Ga0495683_0026510
485 Ga0495687_010276
486 Ga0495685_000854
487 Ga0495681_0003359
488 Ga0495626_0081119
489 Ga0496106_0200741
490 Ga0496109_0096455
491 Ga0496109_0096889
492 Ga0496109_0482667
493 Ga0496113_0065861
494 Ga0496114_0086864
495 Ga0501031_0010048
496 Ga0501031_0030048
497 Ga0501031_0123735
498 Ga0501031_0346635
499 Ga0501032_0000274
500 Ga0501032_0017206
501 Ga0501032_0071633
502 Ga0501033_0000629
503 Ga0501033_0010887
504 Ga0501033_0040264
505 Ga0501034_0015643
506 Ga0501034_0022195
507 Ga0501036_0000296
508 Ga0501036_0002824
509 Ga0501036_0019714
510 Ga0501036_0054916
511 Ga0501036_0268609
512 Ga0501036_0409849
513 Ga0501037_0000379
514 Ga0501037_0074849
515 Ga0501038_0000186
516 Ga0501038_0167433
517 Ga0501038_0176297
518 Ga0501039_0000141
519 Ga0501039_0003753
520 Ga0501039_0017225
521 Ga0501039_0085328
522 Ga0501039_0158527
523 Ga0501039_0348902
524 Ga0501040_0000360
525 Ga0501040_0000794
526 Ga0501040_0033040
527 Ga0501040_0162617
528 Ga0501041_0000039
529 Ga0501041_0001199
530 Ga0501041_0034379
531 Ga0501041_0093628
532 Ga0501041_0209030
533 Ga0501041_0248149
534 Ga0501041_0271644
535 Ga0501042_0000561
536 Ga0501042_0003078
537 Ga0501042_0028966
538 Ga0501042_0160221
539 Ga0501042_0176011
540 Ga0501042_0177293
541 Ga0501042_0247879
542 Ga0501043_0000171
543 Ga0501043_0007052
544 Ga0501043_0019374
545 Ga0501043_0298003
546 Ga0501046_0000177
547 Ga0501046_0005729
548 Ga0501046_0069548
549 Ga0501046_0186786
550 Ga0501046_0241998
551 Ga0501047_0000481
552 Ga0501047_0054508
553 Ga0501048_0002189
554 Ga0501048_0007659
555 Ga0501048_0009092
556 Ga0501048_0026245
557 Ga0501048_0053044
558 Ga0501068_0000051
559 Ga0501068_0017525
560 Ga0501068_0018521
561 Ga0501068_0070347
562 Ga0501069_0005071
563 Ga0501069_0008554
564 Ga0501069_0066234
565 Ga0501070_0015679
566 Ga0501071_0000031
567 Ga0501071_0002390
568 Ga0501071_0019587
569 Ga0501071_0059776
570 Ga0501071_0120142
571 Ga0501071_0150180
572 Ga0501071_0170008
573 Ga0501072_0000342
574 Ga0501072_0006266
575 Ga0501072_0006436
576 Ga0501072_0038000
577 Ga0501072_0055194
578 Ga0501072_0136879
579 Ga0501072_0172196
580 Ga0501072_0260522
581 Ga0501073_0000337
582 Ga0501073_0028558
583 Ga0501074_0000054
584 Ga0501074_0028357
585 Ga0501074_0032315
586 Ga0501074_0043761
587 Ga0501075_0001395
588 Ga0501075_0002589
589 Ga0501075_0003712
590 Ga0501075_0050690
591 Ga0501075_0084690
592 Ga0501075_0086097
593 Ga0501076_0000484
594 Ga0501076_0001344
595 Ga0501076_0008181
596 Ga0501076_0024524
597 Ga0501076_0229500
598 Ga0501076_0305679
599 Ga0501077_0000419
600 Ga0501077_0002115
601 Ga0501077_0112283
602 Ga0501077_0160903
603 Ga0501077_0161137
604 Ga0501079_0000108
605 Ga0501079_0006514
606 Ga0501079_0006578
607 Ga0501079_0033785
608 Ga0501079_0039865
609 Ga0501079_0123940
610 Ga0501080_0000301
611 Ga0501080_0041375
612 Ga0501080_0181750
613 Ga0501081_0002439
614 Ga0501081_0003567
615 Ga0501081_0004466
616 Ga0501081_0021420
617 Ga0501081_0111729
618 Ga0501081_0177950
619 Ga0501081_0189966
620 Ga0501083_0010252
621 Ga0501083_0024263
622 Ga0501083_0138339
623 Ga0501035_0000457
624 Ga0501035_0040754
625 Ga0501035_0076839
626 Ga0501035_0181455
627 Ga0501044_0003357
628 Ga0501044_0051571
629 Ga0501045_0000050
630 Ga0501045_0001208
631 Ga0501045_0002154
632 Ga0501045_0028719
633 Ga0501045_0057663
634 Ga0501045_0260504
635 nmdc:mga00v17_74091_c1
636 nmdc:mga0yw44_125858_c1
637 nmdc:mga04h51_96775_c1
638 nmdc:mga05p37_213767_c1
639 nmdc:mga05p37_30786_c1
640 nmdc:mga05p37_44413_c1
641 nmdc:mga05p37_4768_c1
642 nmdc:mga09592_1338_c1
643 nmdc:mga09592_13435_c1
644 nmdc:mga09592_27840_c1
645 nmdc:mga0qj67_32576_c1
646 nmdc:mga0qj67_36197_c1
647 nmdc:mga06r32_555117_c1
648 nmdc:mga06r32_604259_c1
649 nmdc:mga06r32_93369_c1
650 nmdc:mga08y16_27673_c1
651 nmdc:mga08y16_74305_c1
652 nmdc:mga08y16_7680_c1
653 nmdc:mga08y16_79773_c1
654 Ga0495655_0052828
655 Ga0500578_0038048
656 Ga0500569_009763
657 Ga0500628_000923
658 Ga0500652_001399
659 Ga0500658_0003900
660 Ga0500561_0000259
661 Ga0500600_0006818
662 Ga0500616_0061114
663 Ga0500633_0001657
664 Ga0500634_0018361
665 Ga0500587_000889
666 Ga0501084_0000974
667 Ga0501084_0005021
668 Ga0501084_0006237
669 Ga0501084_0008033
670 Ga0501084_0103786
671 Ga0501084_0118139
672 Ga0501082_0007202
673 Ga0501082_0024802
674 Ga0501082_0026750
675 Ga0501082_0072292
676 Ga0501082_0085618
677 Ga0501082_0176369
678 Ga0530510_0000188
679 Ga0530510_0001091
680 Ga0530510_0001362
681 Ga0530510_0003123
682 Ga0530510_0116250

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13230

GATase_4

Glutamine amidotransferases class-II

18

215

0.76

Structural Annotation

Top 5 Hits

ID Description Score Start End
3mdn-assembly1.cif.gz_B structure of glutamine aminotransferase class-ii domain protein (spo2029) from silicibacter pomeroyi 0.9452 2 275
3mdn-assembly1.cif.gz_C structure of glutamine aminotransferase class-ii domain protein (spo2029) from silicibacter pomeroyi 0.9427 2 275
3mdn-assembly1.cif.gz_B structure of glutamine aminotransferase class-ii domain protein (spo2029) from silicibacter pomeroyi 0.9409 2 275
3mdn-assembly1.cif.gz_A structure of glutamine aminotransferase class-ii domain protein (spo2029) from silicibacter pomeroyi 0.9405 2 275
3mdn-assembly1.cif.gz_D structure of glutamine aminotransferase class-ii domain protein (spo2029) from silicibacter pomeroyi 0.939 2 276
ID Description Score Start End Superfamily
3mdnB00 Alpha Beta;4-Layer Sandwich;Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1;Aminohydrolase, N-terminal nucleophile (Ntn) domain 0.9437 2 275 3.60.20.10
3mdnB00 Alpha Beta;4-Layer Sandwich;Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1;Aminohydrolase, N-terminal nucleophile (Ntn) domain 0.9394 2 275 3.60.20.10
4zfjA00 Alpha Beta;4-Layer Sandwich;Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1;Aminohydrolase, N-terminal nucleophile (Ntn) domain 0.8613 2 276 3.60.20.10
4zfjA00 Alpha Beta;4-Layer Sandwich;Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1;Aminohydrolase, N-terminal nucleophile (Ntn) domain 0.8578 2 276 3.60.20.10
af_C7G044_1_374_3.60.20.10 Alpha Beta;4-Layer Sandwich;Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1;Aminohydrolase, N-terminal nucleophile (Ntn) domain 0.8431 1 272 3.60.20.10
ID Description Score Start End GO Terms
AF-A0A7K2XZA7-F1-model_v4 Class II glutamine amidotransferase 0.9757 64 278 GO:0016740
AF-A0A529L1G1-F1-model_v4 Class II glutamine amidotransferase 0.9743 104 208 GO:0016740
AF-A0A098BJC0-F1-model_v4 Glutamine amidotransferase type-2 domain-containing protein 0.9736 112 276
AF-A0A7K2XZA7-F1-model_v4 Class II glutamine amidotransferase 0.9713 64 278 GO:0016740
AF-A0A4R9WVM0-F1-model_v4 Class II glutamine amidotransferase 0.9567 65 182 GO:0016740

Map