F414725

General Info

Members Datasets Scaffolds Average Seq Length
341 187 682 147

Family's Representative Sequence

Representative Sequence 3300009148|Ga0105243_11621476|Ga0105243_116214761
Length 156
Sequence MRAVIQRVIRAAVEVDGKTIGQIRTGLVVLVGVAKGDTETDVTYLVEKIPALRIFSDEAGKMNRSLAELGGGLLAISQFTLLGDTRKGRRPGFDQAAAPDIARRLFDHFVTALRTTTDLTVATGLFGAHMKVELVNDGPVTFVLDSRHDGPHPPEQ

Samples

Sample ID Description Type Environment
1 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
19 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
20 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
21 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
22 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
23 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
24 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
25 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
26 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
27 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
28 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
29 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
30 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
31 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
32 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
33 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
34 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
35 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
36 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
37 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
38 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
39 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
40 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
41 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
42 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
43 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
44 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
45 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
46 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
47 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
48 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
49 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
50 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
51 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
52 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
53 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
54 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
56 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
57 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
58 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
59 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
60 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
61 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
63 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
64 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
65 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
66 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
67 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
68 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
69 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
70 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
71 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
72 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
73 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
74 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
111 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
113 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
114 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
115 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
116 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
117 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
118 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
119 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
120 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
121 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
122 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
123 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
124 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
125 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
126 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
127 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
128 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
129 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
130 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
131 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
132 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
133 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
134 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
135 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
136 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
137 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
138 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
139 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
140 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
141 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
142 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
143 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
144 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
145 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
146 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
147 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
148 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
149 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
150 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
151 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
152 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
153 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
154 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
155 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
156 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
157 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
158 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
159 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
160 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
161 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
162 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
163 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
164 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
165 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
166 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
167 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
168 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
169 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
170 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
171 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
172 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
173 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
174 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
175 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
176 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
177 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
178 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
179 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
180 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
181 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
182 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
183 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
184 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
185 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
186 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
187 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 5.28
Rhizosphere 93.84
Stem 0
Stem Tuber 0
Unclassified 25.81

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105243_11621476 3300009148 Unclassified 674
2 Ga0065712_10433050 3300005290 Bacteria 650
3 Ga0065712_10563947 3300005290 Bacteria 610
4 Ga0070690_100059076 3300005330 Bacteria 2464
5 Ga0070670_100022601 3300005331 Bacteria 5412
6 Ga0068869_100089817 3300005334 Bacteria 2308
7 Ga0068869_100432831 3300005334 Unclassified 1087
8 Ga0070666_10011267 3300005335 Bacteria 5610
9 Ga0068868_100104915 3300005338 Bacteria 2291
10 Ga0070689_100024786 3300005340 Bacteria 4503
11 Ga0070687_100722974 3300005343 Unclassified 698
12 Ga0070668_100833170 3300005347 Unclassified 821
13 Ga0070669_100309747 3300005353 Unclassified 1272
14 Ga0070669_101245071 3300005353 Bacteria 643
15 Ga0070669_101717077 3300005353 Bacteria 547
16 Ga0070675_100000400 3300005354 Bacteria 29488
17 Ga0070675_100001077 3300005354 Bacteria 19690
18 Ga0070675_100036370 3300005354 Bacteria 4007
19 Ga0070675_100044083 3300005354 Bacteria 3648
20 Ga0070675_100088413 3300005354 Bacteria 2592
21 Ga0070671_100185070 3300005355 Unclassified 1764
22 Ga0070674_100134663 3300005356 Bacteria 1847
23 Ga0070673_100644255 3300005364 Bacteria 969
24 Ga0070688_100012231 3300005365 Bacteria 4804
25 Ga0070688_100410393 3300005365 Unclassified 1004
26 Ga0070667_100023461 3300005367 Bacteria 5118
27 Ga0070711_100176614 3300005439 Bacteria 1632
28 Ga0070708_100322442 3300005445 Bacteria 1455
29 Ga0070708_100444968 3300005445 Archaea 1222
30 Ga0070678_100683235 3300005456 Unclassified 923
31 Ga0070662_100128886 3300005457 Bacteria 1948
32 Ga0070662_100933724 3300005457 Unclassified 741
33 Ga0070706_100000726 3300005467 Bacteria 37119
34 Ga0070706_100028585 3300005467 Bacteria 5134
35 Ga0070707_100002044 3300005468 Bacteria 19321
36 Ga0070707_100003517 3300005468 Bacteria 14789
37 Ga0070707_100232067 3300005468 Bacteria 1796
38 Ga0070698_100005841 3300005471 Bacteria 13450
39 Ga0070698_100235695 3300005471 Bacteria 1763
40 Ga0070699_100003619 3300005518 Bacteria 13660
41 Ga0070699_100624145 3300005518 Bacteria 983
42 Ga0070699_100699030 3300005518 Bacteria 926
43 Ga0070699_101087062 3300005518 Unclassified 734
44 Ga0070679_100127673 3300005530 Bacteria 2524
45 Ga0070672_100139989 3300005543 Unclassified 1995
46 Ga0070672_100511184 3300005543 Unclassified 1040
47 Ga0070686_100445512 3300005544 Unclassified 994
48 Ga0070695_100451465 3300005545 Bacteria 985
49 Ga0070696_100135863 3300005546 Bacteria 1793
50 Ga0070696_100323570 3300005546 Bacteria 1187
51 Ga0070664_100031348 3300005564 Bacteria 4441
52 Ga0068857_100390019 3300005577 Bacteria 1294
53 Ga0070702_100058165 3300005615 Bacteria 2239
54 Ga0068859_100001352 3300005617 Bacteria 25017
55 Ga0068859_100004087 3300005617 Bacteria 14884
56 Ga0068859_101902723 3300005617 Unclassified 657
57 Ga0068864_100187493 3300005618 Unclassified 1894
58 Ga0068864_100431503 3300005618 Bacteria 1257
59 Ga0068861_100241929 3300005719 Unclassified 1535
60 Ga0068861_100638436 3300005719 Bacteria 982
61 Ga0068863_100004238 3300005841 Bacteria 14162
62 Ga0068858_100013778 3300005842 Bacteria 7633
63 Ga0068860_100009915 3300005843 Bacteria 9444
64 Ga0068862_101390096 3300005844 Unclassified 705
65 Ga0081455_10146974 3300005937 Bacteria 1822
66 Ga0070715_10012490 3300006163 Bacteria 3093
67 Ga0070712_100418460 3300006175 Bacteria 1110
68 Ga0070712_100477161 3300006175 Bacteria 1042
69 Ga0097621_100003955 3300006237 Bacteria 10266
70 Ga0068871_100003012 3300006358 Bacteria 11563
71 Ga0075428_100150257 3300006844 Unclassified 2530
72 Ga0075428_102104476 3300006844 Unclassified 584
73 Ga0075430_100067630 3300006846 Bacteria 2999
74 Ga0075430_100190419 3300006846 Bacteria 1705
75 Ga0075431_100029292 3300006847 Bacteria 5665
76 Ga0075431_100123263 3300006847 Bacteria 2674
77 Ga0075431_100223096 3300006847 Unclassified 1922
78 Ga0075431_100274743 3300006847 Bacteria 1707
79 Ga0075431_100413510 3300006847 Bacteria 1349
80 Ga0075431_100664656 3300006847 Bacteria 1021
81 Ga0075433_10078098 3300006852 Bacteria 2917
82 Ga0075433_10116776 3300006852 Unclassified 2367
83 Ga0075434_100004696 3300006871 Bacteria 12345
84 Ga0075434_100037990 3300006871 Unclassified 4768
85 Ga0075434_100297485 3300006871 Unclassified 1634
86 Ga0075434_100808420 3300006871 Bacteria 954
87 Ga0075434_101157239 3300006871 Unclassified 786
88 Ga0075429_100309931 3300006880 Bacteria 1382
89 Ga0075429_100831973 3300006880 Bacteria 808
90 Ga0075429_101199354 3300006880 Unclassified 662
91 Ga0075429_101226514 3300006880 Unclassified 654
92 Ga0068865_100095285 3300006881 Unclassified 2168
93 Ga0075436_100221450 3300006914 Bacteria 1343
94 Ga0097620_100001352 3300006931 Bacteria 25017
95 Ga0097620_100004087 3300006931 Bacteria 14884
96 Ga0097620_101903021 3300006931 Unclassified 657
97 Ga0075435_100014937 3300007076 Bacteria 5824
98 Ga0075435_100444348 3300007076 Unclassified 1118
99 Ga0099794_10477550 3300007265 Bacteria 655
100 Ga0099795_10217351 3300007788 Bacteria 812
101 Ga0105240_10164878 3300009093 Bacteria 2629
102 Ga0111539_10000073 3300009094 Bacteria 100413
103 Ga0111539_10018318 3300009094 Bacteria 8674
104 Ga0111539_10021451 3300009094 Bacteria 7948
105 Ga0111539_10031255 3300009094 Bacteria 6469
106 Ga0111539_10034142 3300009094 Bacteria 6171
107 Ga0111539_10078178 3300009094 Bacteria 3893
108 Ga0111539_10191705 3300009094 Bacteria 2385
109 Ga0111539_11048605 3300009094 Bacteria 948
110 Ga0111539_11903044 3300009094 Bacteria 690
111 Ga0105245_10027589 3300009098 Bacteria 5003
112 Ga0114129_10000340 3300009147 Bacteria 54409
113 Ga0114129_10001496 3300009147 Bacteria 31625
114 Ga0114129_10070909 3300009147 Bacteria 4859
115 Ga0114129_10093885 3300009147 Bacteria 4155
116 Ga0114129_10120875 3300009147 Unclassified 3606
117 Ga0114129_10145540 3300009147 Unclassified 3246
118 Ga0114129_10239672 3300009147 Bacteria 2438
119 Ga0114129_10810300 3300009147 Unclassified 1194
120 Ga0114129_11823695 3300009147 Bacteria 739
121 Ga0105248_10004501 3300009177 Bacteria 15422
122 Ga0105248_10643227 3300009177 Bacteria 1197
123 Ga0105237_10332123 3300009545 Bacteria 1524
124 Ga0105249_10032958 3300009553 Bacteria 4688
125 Ga0105249_10171058 3300009553 Bacteria 2107
126 Ga0105249_10484647 3300009553 Unclassified 1280
127 Ga0099796_10115152 3300010159 Unclassified 1027
128 Ga0157374_10095470 3300013296 Bacteria 2843
129 Ga0163162_11574089 3300013306 Unclassified 749
130 Ga0157375_10003018 3300013308 Bacteria 14612
131 Ga0163163_10008439 3300014325 Bacteria 9152
132 Ga0163163_10037329 3300014325 Bacteria 4726
133 Ga0157380_10013745 3300014326 Bacteria 5910
134 Ga0157377_10755354 3300014745 Unclassified 712
135 Ga0157377_10771482 3300014745 Unclassified 706
136 Ga0157379_10000620 3300014968 Bacteria 28692
137 Ga0157376_10017820 3300014969 Bacteria 5427
138 Ga0207692_10151207 3300025898 Bacteria 1330
139 Ga0207688_10164498 3300025901 Unclassified 1317
140 Ga0207680_10021273 3300025903 Bacteria 3508
141 Ga0207685_10033764 3300025905 Bacteria 1852
142 Ga0207645_10945147 3300025907 Unclassified 585
143 Ga0207684_10000356 3300025910 Bacteria 62652
144 Ga0207684_10001592 3300025910 Bacteria 24129
145 Ga0207695_10023445 3300025913 Bacteria 6973
146 Ga0207671_10156277 3300025914 Bacteria 1764
147 Ga0207662_10115507 3300025918 Unclassified 1678
148 Ga0207646_10000834 3300025922 Bacteria 40111
149 Ga0207646_10001115 3300025922 Bacteria 34264
150 Ga0207681_10034111 3300025923 Bacteria 3344
151 Ga0207681_10309198 3300025923 Unclassified 1253
152 Ga0207650_10026829 3300025925 Bacteria 4115
153 Ga0207659_10001297 3300025926 Bacteria 14939
154 Ga0207659_10002364 3300025926 Bacteria 11234
155 Ga0207659_10016230 3300025926 Unclassified 4843
156 Ga0207659_10044365 3300025926 Bacteria 3128
157 Ga0207659_10395608 3300025926 Bacteria 1155
158 Ga0207700_10549926 3300025928 Bacteria 1025
159 Ga0207644_10011675 3300025931 Bacteria 5818
160 Ga0207706_10180375 3300025933 Bacteria 1854
161 Ga0207670_10082438 3300025936 Bacteria 2254
162 Ga0207670_10810514 3300025936 Unclassified 780
163 Ga0207669_10500622 3300025937 Unclassified 972
164 Ga0207669_10737080 3300025937 Bacteria 813
165 Ga0207704_10151209 3300025938 Bacteria 1638
166 Ga0207665_10232933 3300025939 Bacteria 1354
167 Ga0207691_10065001 3300025940 Bacteria 3303
168 Ga0207691_10854893 3300025940 Unclassified 763
169 Ga0207711_10004796 3300025941 Bacteria 11479
170 Ga0207679_10020723 3300025945 Bacteria 4441
171 Ga0207651_10144965 3300025960 Bacteria 1840
172 Ga0207651_10281570 3300025960 Unclassified 1374
173 Ga0207651_10591467 3300025960 Bacteria 969
174 Ga0207668_10865715 3300025972 Unclassified 803
175 Ga0207640_11219977 3300025981 Unclassified 669
176 Ga0207658_10024475 3300025986 Bacteria 4226
177 Ga0207677_10097065 3300026023 Bacteria 2158
178 Ga0207677_10699206 3300026023 Unclassified 899
179 Ga0207703_10067390 3300026035 Unclassified 2946
180 Ga0207639_10037335 3300026041 Bacteria 3608
181 Ga0207641_10002809 3300026088 Bacteria 15846
182 Ga0207648_10853971 3300026089 Bacteria 849
183 Ga0207676_10065505 3300026095 Bacteria 2893
184 Ga0207676_10194667 3300026095 Unclassified 1787
185 Ga0207674_11181989 3300026116 Unclassified 734
186 Ga0207675_100157020 3300026118 Bacteria 2168
187 Ga0207675_100752614 3300026118 Bacteria 986
188 Ga0209588_1000911 3300027671 Bacteria 7525
189 Ga0207428_10007724 3300027907 Bacteria 9782
190 Ga0207428_10012394 3300027907 Bacteria 7491
191 Ga0207428_10147853 3300027907 Bacteria 1790
192 Ga0268264_10004879 3300028381 Bacteria 11365
193 Ga0265334_10004685 3300028573 Bacteria 6029
194 Ga0265331_10097513 3300031250 Bacteria 1355
195 Ga0316575_10008383 3300031665 Bacteria 3763
196 Ga0316576_10072308 3300031727 Bacteria 2545
197 Ga0316576_10076224 3300031727 Bacteria 2481
198 Ga0316576_10091627 3300031727 Bacteria 2265
199 Ga0316576_10108641 3300031727 Unclassified 2078
200 Ga0316576_10577397 3300031727 Unclassified 822
201 Ga0316576_10711686 3300031727 Unclassified 727
202 Ga0316578_10005511 3300031728 Bacteria 6147
203 Ga0316578_10498094 3300031728 Bacteria 718
204 Ga0316577_10018359 3300031733 Unclassified 3868
205 Ga0316583_10136817 3300032133 Bacteria 854
206 Ga0373926_0084136 3300035083 Bacteria 1179
207 Ga0373923_0401640 3300035111 Unclassified 660
208 Ga0373960_0096306 3300035121 Unclassified 953
209 Ga0373943_0204281 3300035170 Unclassified 1095
210 Ga0373955_0806067 3300035172 Unclassified 577
211 Ga0373962_0268241 3300035242 Unclassified 597
212 Ga0316574_0027252 3300035398 Bacteria 3441
213 Ga0316574_0106442 3300035398 Bacteria 1797
214 Ga0316574_0653708 3300035398 Unclassified 647
215 Ga0373927_0168420 3300035695 Unclassified 1436
216 Ga0373937_0613115 3300036401 Unclassified 1033
217 Ga0316582_0024450 3300036647 Unclassified 3615
218 Ga0316582_0035958 3300036647 Bacteria 3062
219 Ga0316584_0069821 3300036712 Bacteria 2634
220 Ga0316584_0633565 3300036712 Bacteria 738
221 Ga0316584_0968252 3300036712 Bacteria 570
222 Ga0395898_0310315 3300037466 Bacteria 1505
223 Ga0400489_01250 3300039093 Bacteria 15441
224 Ga0436360_0425250 3300039438 Bacteria 624
225 Ga0436360_0688957 3300039438 Bacteria 825
226 Ga0436363_1517795 3300039450 Unclassified 664
227 Ga0436362_0765908 3300039453 Bacteria 629
228 Ga0451853_2841472 3300041512 Unclassified 655
229 Ga0451576_0003045 3300045051 Bacteria 23611
230 Ga0495640_0103958 3300046533 Bacteria 1862
231 Ga0495658_0026768 3300046683 Bacteria 3095
232 Ga0495636_0067822 3300047318 Bacteria 1518
233 Ga0495636_0210009 3300047318 Bacteria 891
234 Ga0495680_0060606 3300047322 Bacteria 2916
235 Ga0496100_0116412 3300048903 Bacteria 1865
236 Ga0496102_0025536 3300048905 Bacteria 5260
237 Ga0496103_0032278 3300048906 Bacteria 3195
238 Ga0496103_0181403 3300048906 Unclassified 1353
239 Ga0496104_0030955 3300048907 Bacteria 4974
240 Ga0496105_0036235 3300048908 Bacteria 4063
241 Ga0496106_0137963 3300048909 Bacteria 1917
242 Ga0496107_0278525 3300048910 Unclassified 1245
243 Ga0496107_0486695 3300048910 Bacteria 915
244 Ga0496108_0024948 3300048911 Bacteria 4925
245 Ga0496108_0431671 3300048911 Unclassified 1151
246 Ga0496109_0039404 3300048912 Bacteria 4276
247 Ga0496110_0088681 3300048913 Bacteria 2763
248 Ga0496110_0358197 3300048913 Unclassified 1329
249 Ga0496111_0028983 3300048914 Bacteria 3927
250 Ga0496113_0056235 3300048916 Bacteria 2953
251 Ga0496114_0010188 3300048917 Bacteria 7479
252 Ga0496115_0042734 3300048918 Bacteria 3612
253 Ga0501034_0006597 3300049571 Bacteria 12452
254 Ga0501034_0042850 3300049571 Bacteria 4581
255 Ga0501034_0225356 3300049571 Bacteria 1825
256 Ga0501034_0258379 3300049571 Bacteria 1685
257 Ga0501036_0023193 3300049572 Bacteria 5225
258 Ga0501036_0060875 3300049572 Bacteria 3197
259 Ga0501038_0002512 3300049574 Bacteria 17092
260 Ga0501038_0044494 3300049574 Bacteria 3856
261 Ga0501039_0037590 3300049575 Bacteria 3737
262 Ga0501039_0120973 3300049575 Bacteria 2051
263 Ga0501039_0170403 3300049575 Bacteria 1712
264 Ga0501043_0012026 3300049579 Bacteria 6770
265 Ga0501043_0038523 3300049579 Bacteria 3758
266 Ga0501043_1018759 3300049579 Bacteria 588
267 Ga0501046_0004033 3300049580 Bacteria 13399
268 Ga0501046_0634045 3300049580 Bacteria 756
269 Ga0501047_0000522 3300049581 Bacteria 41607
270 Ga0501047_0009876 3300049581 Bacteria 9021
271 Ga0501047_0060186 3300049581 Bacteria 3665
272 Ga0501048_0069297 3300049582 Bacteria 2491
273 Ga0501067_0154953 3300049583 Bacteria 1276
274 Ga0501067_0318975 3300049583 Bacteria 865
275 Ga0501068_0037956 3300049584 Bacteria 2884
276 Ga0501068_0308921 3300049584 Bacteria 1013
277 Ga0501069_0013909 3300049585 Bacteria 4297
278 Ga0501069_0036022 3300049585 Bacteria 2727
279 Ga0501072_0231370 3300049588 Bacteria 1472
280 Ga0501072_0635592 3300049588 Bacteria 841
281 Ga0501073_0030894 3300049589 Bacteria 3824
282 Ga0501073_0040225 3300049589 Bacteria 3310
283 Ga0501073_0047571 3300049589 Bacteria 3014
284 Ga0501074_0221806 3300049590 Bacteria 1346
285 Ga0501076_0574429 3300049592 Unclassified 930
286 Ga0501077_0632606 3300049593 Unclassified 687
287 Ga0501079_0232469 3300049741 Bacteria 1440
288 Ga0501080_0008411 3300049742 Bacteria 9346
289 Ga0501083_0143190 3300049744 Bacteria 1565
290 Ga0501083_0161580 3300049744 Bacteria 1465
291 Ga0501035_0048300 3300049822 Bacteria 3817
292 Ga0501035_0730427 3300049822 Bacteria 796
293 Ga0501044_0001854 3300049823 Bacteria 24549
294 Ga0501044_0277850 3300049823 Bacteria 1609
295 Ga0501045_0050725 3300049824 Bacteria 3028
296 nmdc:mga05p37_1227713_c1 3300050507 Unclassified 772
297 nmdc:mga05p37_1694468_c1 3300050507 Unclassified 617
298 nmdc:mga05p37_206483_c1 3300050507 Bacteria 2376
299 nmdc:mga05p37_248024_c1 3300050507 Bacteria 2137
300 nmdc:mga05p37_45264_c1 3300050507 Bacteria 5414
301 nmdc:mga05p37_53453_c1 3300050507 Bacteria 4967
302 nmdc:mga05p37_59574_c1 3300050507 Unclassified 4702
303 nmdc:mga09592_1048619_c1 3300050508 Unclassified 680
304 nmdc:mga09592_191527_c1 3300050508 Unclassified 1770
305 nmdc:mga09592_270613_c1 3300050508 Bacteria 1473
306 nmdc:mga09592_434961_c1 3300050508 Bacteria 1132
307 nmdc:mga09592_681180_c1 3300050508 Bacteria 876
308 nmdc:mga0qj67_871880_c1 3300050509 Bacteria 710
309 nmdc:mga0qj67_97620_c1 3300050509 Bacteria 2366
310 nmdc:mga06r32_196136_c1 3300050510 Bacteria 2006
311 nmdc:mga06r32_215611_c1 3300050510 Bacteria 1354
312 nmdc:mga06r32_609399_c1 3300050510 Unclassified 1062
313 nmdc:mga06r32_705798_c1 3300050510 Unclassified 974
314 nmdc:mga06r32_92943_c1 3300050510 Bacteria 2950
315 nmdc:mga08y16_125524_c1 3300050511 Bacteria 2670
316 nmdc:mga08y16_20830_c1 3300050511 Bacteria 6922
317 nmdc:mga08y16_221934_c1 3300050511 Unclassified 1956
318 nmdc:mga08y16_24193_c1 3300050511 Bacteria 6410
319 nmdc:mga08y16_24317_c1 3300050511 Bacteria 6395
320 nmdc:mga08y16_516843_c1 3300050511 Bacteria 1211
321 nmdc:mga08y16_893473_c1 3300050511 Bacteria 875
322 nmdc:mga0n895_13419_c1 3300050512 Bacteria 7389
323 nmdc:mga0n895_1365286_c1 3300050512 Unclassified 678
324 nmdc:mga0n895_1485478_c1 3300050512 Unclassified 644
325 nmdc:mga0n895_266690_c1 3300050512 Unclassified 1737
326 nmdc:mga0n895_29705_c1 3300050512 Bacteria 5217
327 nmdc:mga0n895_4215_c1 3300050512 Bacteria 11753
328 nmdc:mga0n895_650389_c1 3300050512 Unclassified 1053
329 nmdc:mga0rr50_295369_c1 3300050513 Unclassified 1354
330 nmdc:mga0rr50_31524_c1 3300050513 Unclassified 3765
331 nmdc:mga0rr50_352320_c1 3300050513 Bacteria 1238
332 nmdc:mga0rr50_61361_c1 3300050513 Bacteria 2832
333 nmdc:mga0rr50_961860_c1 3300050513 Unclassified 728
334 nmdc:mga08x19_351033_c1 3300050514 Bacteria 1030
335 nmdc:mga0a205_19676_c1 3300050515 Bacteria 6369
336 nmdc:mga0a205_221158_c2 3300050515 Bacteria 1488
337 nmdc:mga0a205_67227_c1 3300050515 Bacteria 3462
338 Ga0501084_0002167 3300054114 Bacteria 15728
339 Ga0501084_0076147 3300054114 Bacteria 2812
340 Ga0501082_0008529 3300060353 Bacteria 8837
341 Ga0501082_0292734 3300060353 Bacteria 1417
342 Ga0105243_11621476
343 Ga0065712_10433050
344 Ga0065712_10563947
345 Ga0070690_100059076
346 Ga0070670_100022601
347 Ga0068869_100089817
348 Ga0068869_100432831
349 Ga0070666_10011267
350 Ga0068868_100104915
351 Ga0070689_100024786
352 Ga0070687_100722974
353 Ga0070668_100833170
354 Ga0070669_100309747
355 Ga0070669_101245071
356 Ga0070669_101717077
357 Ga0070675_100000400
358 Ga0070675_100001077
359 Ga0070675_100036370
360 Ga0070675_100044083
361 Ga0070675_100088413
362 Ga0070671_100185070
363 Ga0070674_100134663
364 Ga0070673_100644255
365 Ga0070688_100012231
366 Ga0070688_100410393
367 Ga0070667_100023461
368 Ga0070711_100176614
369 Ga0070708_100322442
370 Ga0070708_100444968
371 Ga0070678_100683235
372 Ga0070662_100128886
373 Ga0070662_100933724
374 Ga0070706_100000726
375 Ga0070706_100028585
376 Ga0070707_100002044
377 Ga0070707_100003517
378 Ga0070707_100232067
379 Ga0070698_100005841
380 Ga0070698_100235695
381 Ga0070699_100003619
382 Ga0070699_100624145
383 Ga0070699_100699030
384 Ga0070699_101087062
385 Ga0070679_100127673
386 Ga0070672_100139989
387 Ga0070672_100511184
388 Ga0070686_100445512
389 Ga0070695_100451465
390 Ga0070696_100135863
391 Ga0070696_100323570
392 Ga0070664_100031348
393 Ga0068857_100390019
394 Ga0070702_100058165
395 Ga0068859_100001352
396 Ga0068859_100004087
397 Ga0068859_101902723
398 Ga0068864_100187493
399 Ga0068864_100431503
400 Ga0068861_100241929
401 Ga0068861_100638436
402 Ga0068863_100004238
403 Ga0068858_100013778
404 Ga0068860_100009915
405 Ga0068862_101390096
406 Ga0081455_10146974
407 Ga0070715_10012490
408 Ga0070712_100418460
409 Ga0070712_100477161
410 Ga0097621_100003955
411 Ga0068871_100003012
412 Ga0075428_100150257
413 Ga0075428_102104476
414 Ga0075430_100067630
415 Ga0075430_100190419
416 Ga0075431_100029292
417 Ga0075431_100123263
418 Ga0075431_100223096
419 Ga0075431_100274743
420 Ga0075431_100413510
421 Ga0075431_100664656
422 Ga0075433_10078098
423 Ga0075433_10116776
424 Ga0075434_100004696
425 Ga0075434_100037990
426 Ga0075434_100297485
427 Ga0075434_100808420
428 Ga0075434_101157239
429 Ga0075429_100309931
430 Ga0075429_100831973
431 Ga0075429_101199354
432 Ga0075429_101226514
433 Ga0068865_100095285
434 Ga0075436_100221450
435 Ga0097620_100001352
436 Ga0097620_100004087
437 Ga0097620_101903021
438 Ga0075435_100014937
439 Ga0075435_100444348
440 Ga0099794_10477550
441 Ga0099795_10217351
442 Ga0105240_10164878
443 Ga0111539_10000073
444 Ga0111539_10018318
445 Ga0111539_10021451
446 Ga0111539_10031255
447 Ga0111539_10034142
448 Ga0111539_10078178
449 Ga0111539_10191705
450 Ga0111539_11048605
451 Ga0111539_11903044
452 Ga0105245_10027589
453 Ga0114129_10000340
454 Ga0114129_10001496
455 Ga0114129_10070909
456 Ga0114129_10093885
457 Ga0114129_10120875
458 Ga0114129_10145540
459 Ga0114129_10239672
460 Ga0114129_10810300
461 Ga0114129_11823695
462 Ga0105248_10004501
463 Ga0105248_10643227
464 Ga0105237_10332123
465 Ga0105249_10032958
466 Ga0105249_10171058
467 Ga0105249_10484647
468 Ga0099796_10115152
469 Ga0157374_10095470
470 Ga0163162_11574089
471 Ga0157375_10003018
472 Ga0163163_10008439
473 Ga0163163_10037329
474 Ga0157380_10013745
475 Ga0157377_10755354
476 Ga0157377_10771482
477 Ga0157379_10000620
478 Ga0157376_10017820
479 Ga0207692_10151207
480 Ga0207688_10164498
481 Ga0207680_10021273
482 Ga0207685_10033764
483 Ga0207645_10945147
484 Ga0207684_10000356
485 Ga0207684_10001592
486 Ga0207695_10023445
487 Ga0207671_10156277
488 Ga0207662_10115507
489 Ga0207646_10000834
490 Ga0207646_10001115
491 Ga0207681_10034111
492 Ga0207681_10309198
493 Ga0207650_10026829
494 Ga0207659_10001297
495 Ga0207659_10002364
496 Ga0207659_10016230
497 Ga0207659_10044365
498 Ga0207659_10395608
499 Ga0207700_10549926
500 Ga0207644_10011675
501 Ga0207706_10180375
502 Ga0207670_10082438
503 Ga0207670_10810514
504 Ga0207669_10500622
505 Ga0207669_10737080
506 Ga0207704_10151209
507 Ga0207665_10232933
508 Ga0207691_10065001
509 Ga0207691_10854893
510 Ga0207711_10004796
511 Ga0207679_10020723
512 Ga0207651_10144965
513 Ga0207651_10281570
514 Ga0207651_10591467
515 Ga0207668_10865715
516 Ga0207640_11219977
517 Ga0207658_10024475
518 Ga0207677_10097065
519 Ga0207677_10699206
520 Ga0207703_10067390
521 Ga0207639_10037335
522 Ga0207641_10002809
523 Ga0207648_10853971
524 Ga0207676_10065505
525 Ga0207676_10194667
526 Ga0207674_11181989
527 Ga0207675_100157020
528 Ga0207675_100752614
529 Ga0209588_1000911
530 Ga0207428_10007724
531 Ga0207428_10012394
532 Ga0207428_10147853
533 Ga0268264_10004879
534 Ga0265334_10004685
535 Ga0265331_10097513
536 Ga0316575_10008383
537 Ga0316576_10072308
538 Ga0316576_10076224
539 Ga0316576_10091627
540 Ga0316576_10108641
541 Ga0316576_10577397
542 Ga0316576_10711686
543 Ga0316578_10005511
544 Ga0316578_10498094
545 Ga0316577_10018359
546 Ga0316583_10136817
547 Ga0373926_0084136
548 Ga0373923_0401640
549 Ga0373960_0096306
550 Ga0373943_0204281
551 Ga0373955_0806067
552 Ga0373962_0268241
553 Ga0316574_0027252
554 Ga0316574_0106442
555 Ga0316574_0653708
556 Ga0373927_0168420
557 Ga0373937_0613115
558 Ga0316582_0024450
559 Ga0316582_0035958
560 Ga0316584_0069821
561 Ga0316584_0633565
562 Ga0316584_0968252
563 Ga0395898_0310315
564 Ga0400489_01250
565 Ga0436360_0425250
566 Ga0436360_0688957
567 Ga0436363_1517795
568 Ga0436362_0765908
569 Ga0451853_2841472
570 Ga0451576_0003045
571 Ga0495640_0103958
572 Ga0495658_0026768
573 Ga0495636_0067822
574 Ga0495636_0210009
575 Ga0495680_0060606
576 Ga0496100_0116412
577 Ga0496102_0025536
578 Ga0496103_0032278
579 Ga0496103_0181403
580 Ga0496104_0030955
581 Ga0496105_0036235
582 Ga0496106_0137963
583 Ga0496107_0278525
584 Ga0496107_0486695
585 Ga0496108_0024948
586 Ga0496108_0431671
587 Ga0496109_0039404
588 Ga0496110_0088681
589 Ga0496110_0358197
590 Ga0496111_0028983
591 Ga0496113_0056235
592 Ga0496114_0010188
593 Ga0496115_0042734
594 Ga0501034_0006597
595 Ga0501034_0042850
596 Ga0501034_0225356
597 Ga0501034_0258379
598 Ga0501036_0023193
599 Ga0501036_0060875
600 Ga0501038_0002512
601 Ga0501038_0044494
602 Ga0501039_0037590
603 Ga0501039_0120973
604 Ga0501039_0170403
605 Ga0501043_0012026
606 Ga0501043_0038523
607 Ga0501043_1018759
608 Ga0501046_0004033
609 Ga0501046_0634045
610 Ga0501047_0000522
611 Ga0501047_0009876
612 Ga0501047_0060186
613 Ga0501048_0069297
614 Ga0501067_0154953
615 Ga0501067_0318975
616 Ga0501068_0037956
617 Ga0501068_0308921
618 Ga0501069_0013909
619 Ga0501069_0036022
620 Ga0501072_0231370
621 Ga0501072_0635592
622 Ga0501073_0030894
623 Ga0501073_0040225
624 Ga0501073_0047571
625 Ga0501074_0221806
626 Ga0501076_0574429
627 Ga0501077_0632606
628 Ga0501079_0232469
629 Ga0501080_0008411
630 Ga0501083_0143190
631 Ga0501083_0161580
632 Ga0501035_0048300
633 Ga0501035_0730427
634 Ga0501044_0001854
635 Ga0501044_0277850
636 Ga0501045_0050725
637 nmdc:mga05p37_1227713_c1
638 nmdc:mga05p37_1694468_c1
639 nmdc:mga05p37_206483_c1
640 nmdc:mga05p37_248024_c1
641 nmdc:mga05p37_45264_c1
642 nmdc:mga05p37_53453_c1
643 nmdc:mga05p37_59574_c1
644 nmdc:mga09592_1048619_c1
645 nmdc:mga09592_191527_c1
646 nmdc:mga09592_270613_c1
647 nmdc:mga09592_434961_c1
648 nmdc:mga09592_681180_c1
649 nmdc:mga0qj67_871880_c1
650 nmdc:mga0qj67_97620_c1
651 nmdc:mga06r32_196136_c1
652 nmdc:mga06r32_215611_c1
653 nmdc:mga06r32_609399_c1
654 nmdc:mga06r32_705798_c1
655 nmdc:mga06r32_92943_c1
656 nmdc:mga08y16_125524_c1
657 nmdc:mga08y16_20830_c1
658 nmdc:mga08y16_221934_c1
659 nmdc:mga08y16_24193_c1
660 nmdc:mga08y16_24317_c1
661 nmdc:mga08y16_516843_c1
662 nmdc:mga08y16_893473_c1
663 nmdc:mga0n895_13419_c1
664 nmdc:mga0n895_1365286_c1
665 nmdc:mga0n895_1485478_c1
666 nmdc:mga0n895_266690_c1
667 nmdc:mga0n895_29705_c1
668 nmdc:mga0n895_4215_c1
669 nmdc:mga0n895_650389_c1
670 nmdc:mga0rr50_295369_c1
671 nmdc:mga0rr50_31524_c1
672 nmdc:mga0rr50_352320_c1
673 nmdc:mga0rr50_61361_c1
674 nmdc:mga0rr50_961860_c1
675 nmdc:mga08x19_351033_c1
676 nmdc:mga0a205_19676_c1
677 nmdc:mga0a205_221158_c2
678 nmdc:mga0a205_67227_c1
679 Ga0501084_0002167
680 Ga0501084_0076147
681 Ga0501082_0008529
682 Ga0501082_0292734

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02580

Tyr_Deacylase

D-Tyr-tRNA(Tyr) deacylase

2

145

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
2dbo-assembly1.cif.gz_A-2 crystal structure of d-tyr-trna(tyr) deacylase from aquifex aeolicus 0.9799 1 145
1jke-assembly1.cif.gz_A d-tyr trnatyr deacylase from escherichia coli 0.979 1 144
1j7g-assembly1.cif.gz_A-2 structure of yihz from haemophilus influenzae (hi0670), a d-tyr-trna(tyr) deacylase 0.9778 1 144
3knf-assembly2.cif.gz_D crystal structure of d-tyr-trna(tyr) deacylase from plasmodium falciparum 0.9667 1 145
1jke-assembly1.cif.gz_A d-tyr trnatyr deacylase from escherichia coli 0.9658 1 144
ID Description Score Start End Superfamily
2dboA00 Alpha Beta;3-Layer(bba) Sandwich;D-tyrosyl-trna(Tyr) Deacylase; Chain: A;;D-tyrosyl-tRNA(Tyr) deacylase 0.9799 1 145 3.50.80.10
af_O14274_1_149_3.50.80.10 Alpha Beta;3-Layer(bba) Sandwich;D-tyrosyl-trna(Tyr) Deacylase; Chain: A;;D-tyrosyl-tRNA(Tyr) deacylase 0.9794 1 147 3.50.80.10
af_Q2FXU2_1_149_3.50.80.10 Alpha Beta;3-Layer(bba) Sandwich;D-tyrosyl-trna(Tyr) Deacylase; Chain: A;;D-tyrosyl-tRNA(Tyr) deacylase 0.9787 1 144 3.50.80.10
1j7gA00 Alpha Beta;3-Layer(bba) Sandwich;D-tyrosyl-trna(Tyr) Deacylase; Chain: A;;D-tyrosyl-tRNA(Tyr) deacylase 0.9778 1 144 3.50.80.10
af_Q07648_1_150_3.50.80.10 Alpha Beta;3-Layer(bba) Sandwich;D-tyrosyl-trna(Tyr) Deacylase; Chain: A;;D-tyrosyl-tRNA(Tyr) deacylase 0.975 1 145 3.50.80.10
ID Description Score Start End GO Terms
AF-A0A7C4XL70-F1-model_v4 D-aminoacyl-tRNA deacylase (DTD) (EC 3.1.1.96) (Gly-tRNA(Ala) deacylase) (EC 3.1.1.-) 0.9964 1 144 GO:0000049
GO:0005737
GO:0019478
GO:0043908
GO:0051500
GO:0106026
AF-A0A418SHC7-F1-model_v4 D-aminoacyl-tRNA deacylase (EC 3.1.1.96) 0.9964 30 144 GO:0005737
GO:0051500
AF-F8F3E1-F1-model_v4 D-aminoacyl-tRNA deacylase (DTD) (EC 3.1.1.96) (Gly-tRNA(Ala) deacylase) (EC 3.1.1.-) 0.9956 1 145 GO:0000049
GO:0005737
GO:0019478
GO:0043908
GO:0051500
GO:0106026
AF-A0A3D1WK63-F1-model_v4 D-aminoacyl-tRNA deacylase (DTD) (EC 3.1.1.96) (Gly-tRNA(Ala) deacylase) (EC 3.1.1.-) 0.9956 1 143 GO:0000049
GO:0005737
GO:0019478
GO:0043908
GO:0051500
GO:0106026
AF-A0A1F8TNJ3-F1-model_v4 D-tyrosyl-tRNA(Tyr) deacylase 0.9954 10 145 GO:0005737
GO:0051500

Map