F414525

General Info

Members Datasets Scaffolds Average Seq Length
340 211 680 275

Family's Representative Sequence

Representative Sequence 3300050507|nmdc:mga05p37_357658_c1|nmdc:mga05p37_357658_c1_74_973
Length 299
Sequence MEVRSAYRGAVTDRGGLVMEGAAAERAPLMFIHGAWLASGSWENFVEYFGRRGFPVSAPEWPRKEGKDVEELREGSDKIAGLGLTEIVDHYESEIRVLDEPPVLVGHSFGGLITELLLDRGLGRAGVAMSPAPPKGILVLPFSSLKVASSALAHPSRWHGVVPLTLEEFTYGFVNTFSAEDAKAAYEKYAVPETGQIFYEAGFANFHLHPPTEIHFKSDERAPLLIVGADKDHTVPASVAKKQYEKYEKSDVQTDYIEFEGRPHLMMAAEGWEEIAGAIETWIESTLARTAARQEGVSA

Samples

Sample ID Description Type Environment
1 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
2 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
7 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
8 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
11 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
12 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
13 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
14 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
15 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
16 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
17 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
18 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
19 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
20 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
21 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
22 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
23 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
24 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
25 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
26 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
27 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
28 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
29 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
30 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
31 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
32 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
33 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
34 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
35 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
36 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
37 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
38 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
39 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
40 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
41 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
42 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
43 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
44 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
45 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
46 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
47 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
48 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
49 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
50 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
51 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
52 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
53 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
54 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
55 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
56 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
57 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
58 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
59 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
60 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
61 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
62 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
63 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
64 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
65 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
66 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
67 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
68 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
69 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
97 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
98 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
99 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
100 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
101 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
102 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
103 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
104 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
105 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
106 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
107 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
108 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
109 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
110 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
111 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
112 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
113 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
114 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
115 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
116 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
117 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
118 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
119 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
120 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
121 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
122 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
123 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
124 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
125 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
126 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
127 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
128 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
129 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
130 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
131 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
132 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
133 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
134 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
135 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
136 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
137 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
138 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
139 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
140 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
141 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
142 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
143 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
144 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
145 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
146 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
147 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
148 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
149 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
150 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
151 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
152 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
153 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
154 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
155 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
156 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
157 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
158 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
159 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
160 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
161 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
162 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
163 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
164 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
165 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
166 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
167 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
168 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
169 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
170 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
171 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
172 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
173 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
174 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
175 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
176 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
177 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
178 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
179 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
180 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
181 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
182 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
183 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
184 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
185 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
186 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
187 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
188 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
189 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
190 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
191 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
192 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
193 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
194 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
195 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
196 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
197 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
198 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
199 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
200 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
201 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
202 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
203 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
204 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
205 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
206 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
207 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
208 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
209 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
210 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
211 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.41
Metatranscriptomes 0.59
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.29
Nodule 0
Rhizoplane 5
Rhizosphere 85.29
Stem 0
Stem Tuber 0
Unclassified 5.59

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga05p37_357658_c1 3300050507 Bacteria 1717
2 Ga0070676_10140642 3300005328 Bacteria 1536
3 Ga0070676_10366793 3300005328 Bacteria 994
4 Ga0070683_100081321 3300005329 Bacteria 3033
5 Ga0070683_100152979 3300005329 Bacteria 2187
6 Ga0070683_100166791 3300005329 Bacteria 2090
7 Ga0070680_100045784 3300005336 Bacteria 3557
8 Ga0070682_100046743 3300005337 Bacteria 2687
9 Ga0070682_100189150 3300005337 Bacteria 1444
10 Ga0070682_100200611 3300005337 Bacteria 1407
11 Ga0070691_10083048 3300005341 Bacteria 1571
12 Ga0070691_10112876 3300005341 Bacteria 1361
13 Ga0070661_100032533 3300005344 Bacteria 3776
14 Ga0070692_10185667 3300005345 Bacteria 1208
15 Ga0070668_100053349 3300005347 Bacteria 3118
16 Ga0070675_100393905 3300005354 Bacteria 1234
17 Ga0070671_100631356 3300005355 Bacteria 927
18 Ga0070674_100004613 3300005356 Bacteria 7874
19 Ga0070674_100243896 3300005356 Bacteria 1408
20 Ga0070674_100343776 3300005356 Unclassified 1203
21 Ga0070673_100072181 3300005364 Bacteria 2775
22 Ga0070659_100029752 3300005366 Bacteria 4221
23 Ga0070659_100055742 3300005366 Bacteria 3116
24 Ga0070659_100087314 3300005366 Bacteria 2497
25 Ga0070714_100172313 3300005435 Unclassified 1964
26 Ga0070713_100012666 3300005436 Bacteria 6197
27 Ga0070710_10013434 3300005437 Bacteria 4102
28 Ga0070711_100456277 3300005439 Unclassified 1047
29 Ga0070700_100416031 3300005441 Bacteria 1015
30 Ga0070694_100610786 3300005444 Bacteria 879
31 Ga0070678_100007145 3300005456 Bacteria 6603
32 Ga0070678_100201320 3300005456 Bacteria 1644
33 Ga0070678_100442519 3300005456 Bacteria 1137
34 Ga0070662_100088197 3300005457 Bacteria 2325
35 Ga0070681_10001960 3300005458 Bacteria 18610
36 Ga0068867_100378644 3300005459 Bacteria 1188
37 Ga0070706_100184944 3300005467 Bacteria 1947
38 Ga0070707_100103755 3300005468 Bacteria 2755
39 Ga0070707_100203518 3300005468 Bacteria 1929
40 Ga0070698_100117427 3300005471 Bacteria 2622
41 Ga0070684_100084702 3300005535 Bacteria 2810
42 Ga0070684_100106797 3300005535 Bacteria 2507
43 Ga0068853_100187335 3300005539 Bacteria 1879
44 Ga0070696_100124219 3300005546 Bacteria 1871
45 Ga0070704_100017372 3300005549 Bacteria 4575
46 Ga0070664_100496914 3300005564 Bacteria 1124
47 Ga0068857_100001657 3300005577 Bacteria 17868
48 Ga0068857_100463169 3300005577 Bacteria 1186
49 Ga0068856_100011442 3300005614 Bacteria 8609
50 Ga0068864_100497103 3300005618 Bacteria 1173
51 Ga0068861_100000835 3300005719 Bacteria 18614
52 Ga0068870_10141810 3300005840 Bacteria 1407
53 Ga0068858_100389029 3300005842 Bacteria 1339
54 Ga0068860_100210274 3300005843 Bacteria 1887
55 Ga0081539_10000181 3300005985 Bacteria 148250
56 Ga0070717_10009033 3300006028 Bacteria 7480
57 Ga0097621_100087855 3300006237 Bacteria 2597
58 Ga0075431_100166379 3300006847 Bacteria 2267
59 Ga0075433_10090977 3300006852 Bacteria 2697
60 Ga0075434_100002634 3300006871 Bacteria 15829
61 Ga0068865_100052443 3300006881 Bacteria 2827
62 Ga0068865_100379035 3300006881 Bacteria 1153
63 Ga0068865_100441071 3300006881 Unclassified 1075
64 Ga0068865_100532316 3300006881 Bacteria 984
65 Ga0075436_100001902 3300006914 Bacteria 14338
66 Ga0075435_100059901 3300007076 Bacteria 3086
67 Ga0111539_10781372 3300009094 Bacteria 1111
68 Ga0105245_10013772 3300009098 Bacteria 7043
69 Ga0105245_10052372 3300009098 Bacteria 3661
70 Ga0105245_10152762 3300009098 Bacteria 2184
71 Ga0105245_10206632 3300009098 Bacteria 1888
72 Ga0105245_10325457 3300009098 Bacteria 1516
73 Ga0114129_10049689 3300009147 Bacteria 5892
74 Ga0105243_10014915 3300009148 Bacteria 5881
75 Ga0105243_10028175 3300009148 Bacteria 4310
76 Ga0105243_10180158 3300009148 Bacteria 1837
77 Ga0105243_10440823 3300009148 Bacteria 1219
78 Ga0105242_10209072 3300009176 Bacteria 1738
79 Ga0105242_10264683 3300009176 Bacteria 1555
80 Ga0105242_10690794 3300009176 Unclassified 997
81 Ga0105249_10008908 3300009553 Bacteria 8763
82 Ga0105246_10384194 3300011119 Bacteria 1161
83 Ga0157369_10112428 3300013105 Bacteria 2893
84 Ga0157378_10813522 3300013297 Bacteria 961
85 Ga0163162_10009946 3300013306 Bacteria 9251
86 Ga0163162_10154989 3300013306 Bacteria 2410
87 Ga0157372_10115513 3300013307 Bacteria 3077
88 Ga0157375_10581770 3300013308 Unclassified 1280
89 Ga0163163_10071910 3300014325 Unclassified 3447
90 Ga0157377_10033865 3300014745 Bacteria 2791
91 Ga0163161_10029804 3300017792 Bacteria 3879
92 Ga0163161_10060672 3300017792 Bacteria 2753
93 Ga0163161_10221372 3300017792 Bacteria 1465
94 Ga0206356_10962602 3300020070 Bacteria 1459
95 Ga0206353_10805187 3300020082 Bacteria 1175
96 Ga0213874_10004453 3300021377 Bacteria 3201
97 Ga0213874_10056242 3300021377 Bacteria 1221
98 Ga0213876_10019136 3300021384 Bacteria 3616
99 Ga0213876_10080431 3300021384 Bacteria 1723
100 Ga0213875_10010482 3300021388 Bacteria 4635
101 Ga0213875_10023513 3300021388 Bacteria 2943
102 Ga0213875_10056054 3300021388 Bacteria 1845
103 Ga0207688_10058215 3300025901 Bacteria 2174
104 Ga0207684_10075819 3300025910 Bacteria 2858
105 Ga0207684_10135439 3300025910 Bacteria 2115
106 Ga0207649_10037756 3300025920 Bacteria 2920
107 Ga0207681_10330540 3300025923 Bacteria 1215
108 Ga0207659_10235393 3300025926 Bacteria 1479
109 Ga0207687_10020351 3300025927 Bacteria 4401
110 Ga0207687_10169414 3300025927 Bacteria 1683
111 Ga0207700_10023336 3300025928 Bacteria 4263
112 Ga0207700_10181758 3300025928 Bacteria 1761
113 Ga0207700_10507460 3300025928 Bacteria 1068
114 Ga0207664_10076166 3300025929 Unclassified 2715
115 Ga0207690_10067414 3300025932 Bacteria 2455
116 Ga0207690_10078411 3300025932 Bacteria 2299
117 Ga0207690_10157660 3300025932 Bacteria 1689
118 Ga0207706_10030175 3300025933 Bacteria 4838
119 Ga0207706_10072522 3300025933 Bacteria 3028
120 Ga0207686_10248064 3300025934 Unclassified 1299
121 Ga0207686_10252721 3300025934 Bacteria 1289
122 Ga0207686_10287589 3300025934 Unclassified 1216
123 Ga0207686_10363790 3300025934 Bacteria 1093
124 Ga0207709_10025220 3300025935 Bacteria 3402
125 Ga0207709_10050973 3300025935 Bacteria 2534
126 Ga0207709_10101267 3300025935 Bacteria 1905
127 Ga0207669_10043259 3300025937 Bacteria 2637
128 Ga0207669_10174995 3300025937 Bacteria 1532
129 Ga0207704_10072274 3300025938 Bacteria 2192
130 Ga0207691_10060882 3300025940 Bacteria 3430
131 Ga0207661_10000559 3300025944 Bacteria 23755
132 Ga0207661_10029326 3300025944 Bacteria 4225
133 Ga0207661_10058807 3300025944 Bacteria 3095
134 Ga0207679_10022204 3300025945 Bacteria 4317
135 Ga0207679_10440132 3300025945 Bacteria 1154
136 Ga0207668_10272343 3300025972 Bacteria 1384
137 Ga0207668_10486155 3300025972 Bacteria 1060
138 Ga0207677_10089014 3300026023 Bacteria 2240
139 Ga0207703_10433149 3300026035 Bacteria 1226
140 Ga0207708_10056617 3300026075 Bacteria 2991
141 Ga0207708_10166475 3300026075 Bacteria 1743
142 Ga0207708_10737469 3300026075 Bacteria 845
143 Ga0207702_10155667 3300026078 Bacteria 2083
144 Ga0207648_10453347 3300026089 Bacteria 1168
145 Ga0207674_10001033 3300026116 Bacteria 36285
146 Ga0207674_10061148 3300026116 Bacteria 3806
147 Ga0207675_100000592 3300026118 Bacteria 35478
148 Ga0207683_10149806 3300026121 Bacteria 2105
149 Ga0207683_10193480 3300026121 Bacteria 1847
150 Ga0207683_10356681 3300026121 Bacteria 1343
151 Ga0268266_10327243 3300028379 Bacteria 1436
152 Ga0307406_10311342 3300031901 Bacteria 1214
153 Ga0307416_100328463 3300032002 Bacteria 1536
154 Ga0307411_10342286 3300032005 Bacteria 1216
155 Ga0373958_0005203 3300034819 Bacteria 1964
156 Ga0373929_0022029 3300035085 Bacteria 1298
157 Ga0373949_0001721 3300035090 Bacteria 6056
158 Ga0373932_0004659 3300035112 Bacteria 3238
159 Ga0373941_0006952 3300035115 Bacteria 2748
160 Ga0373943_0007393 3300035170 Bacteria 4933
161 Ga0373946_0057173 3300035171 Bacteria 1649
162 Ga0373942_0006527 3300035207 Bacteria 2696
163 Ga0373961_0002366 3300035241 Bacteria 4919
164 Ga0373962_0004429 3300035242 Bacteria 3393
165 Ga0373931_0104822 3300035691 Bacteria 1595
166 Ga0373935_0027878 3300035692 Bacteria 3490
167 Ga0373947_0000780 3300035725 Bacteria 19144
168 Ga0373947_0232388 3300035725 Bacteria 1215
169 Ga0373925_0000924 3300037068 Bacteria 26761
170 Ga0395899_0005141 3300037312 Bacteria 10174
171 Ga0395899_0007029 3300037312 Bacteria 8707
172 Ga0395899_0013324 3300037312 Bacteria 6290
173 Ga0395899_0099782 3300037312 Bacteria 2097
174 Ga0395900_0003447 3300037418 Bacteria 17104
175 Ga0395900_0004715 3300037418 Bacteria 14377
176 Ga0395900_0011014 3300037418 Bacteria 9243
177 Ga0395900_0011579 3300037418 Bacteria 9027
178 Ga0395900_0015336 3300037418 Bacteria 7811
179 Ga0395900_0022487 3300037418 Bacteria 6449
180 Ga0395900_0197409 3300037418 Bacteria 2038
181 Ga0395900_0198954 3300037418 Bacteria 2028
182 Ga0395900_0416665 3300037418 Bacteria 1305
183 Ga0395900_0468911 3300037418 Bacteria 1213
184 Ga0395898_0011274 3300037466 Bacteria 9297
185 Ga0395898_0017567 3300037466 Bacteria 7299
186 Ga0395898_0021925 3300037466 Bacteria 6470
187 Ga0395898_0024689 3300037466 Bacteria 6062
188 Ga0395898_0195314 3300037466 Bacteria 1933
189 Ga0395898_0708376 3300037466 Bacteria 948
190 Ga0395905_0003868 3300037471 Bacteria 15794
191 Ga0395905_0004184 3300037471 Bacteria 15093
192 Ga0395905_0050118 3300037471 Unclassified 3913
193 Ga0395905_0105980 3300037471 Unclassified 2640
194 Ga0395905_0401358 3300037471 Bacteria 1266
195 Ga0436364_0007301 3300037853 Bacteria 10203
196 Ga0436364_0026045 3300037853 Bacteria 3317
197 Ga0436364_0093103 3300037853 Bacteria 3577
198 Ga0436364_0192635 3300037853 Bacteria 13734
199 Ga0436364_0728155 3300037853 Plasmid 3920
200 Ga0436364_1012505 3300037853 Bacteria 1130
201 Ga0436364_1496630 3300037853 Bacteria 1182
202 Ga0395901_0003723 3300038443 Bacteria 15366
203 Ga0395901_0006489 3300038443 Bacteria 11840
204 Ga0395901_0014879 3300038443 Bacteria 7904
205 Ga0395901_0028085 3300038443 Bacteria 5787
206 Ga0395901_0093909 3300038443 Bacteria 3141
207 Ga0395901_0105831 3300038443 Bacteria 2953
208 Ga0395901_0145359 3300038443 Bacteria 2492
209 Ga0395901_0159786 3300038443 Bacteria 2367
210 Ga0436365_0119491 3300039437 Bacteria 8052
211 Ga0436365_0323151 3300039437 Bacteria 6051
212 Ga0436365_0390484 3300039437 Bacteria 5269
213 Ga0436365_0477793 3300039437 Bacteria 15327
214 Ga0436365_0538483 3300039437 Unclassified 1403
215 Ga0436365_0908940 3300039437 Bacteria 1825
216 Ga0436365_0931037 3300039437 Bacteria 5821
217 Ga0436363_0008252 3300039450 Bacteria 9170
218 Ga0436363_0239178 3300039450 Bacteria 1260
219 Ga0436363_0494400 3300039450 Bacteria 9448
220 Ga0436363_0608118 3300039450 Bacteria 10682
221 Ga0436363_0776166 3300039450 Bacteria 4001
222 Ga0436363_0780168 3300039450 Bacteria 2835
223 Ga0436363_1596444 3300039450 Bacteria 6245
224 Ga0436362_0312591 3300039453 Bacteria 2347
225 Ga0436362_1284982 3300039453 Plasmid 3137
226 Ga0451833_0868211 3300041491 Bacteria 1041
227 Ga0451837_1796655 3300041494 Bacteria 1373
228 Ga0451853_2958999 3300041512 Bacteria 1317
229 Ga0451853_3358201 3300041512 Bacteria 1678
230 Ga0466961_0118277 3300044693 Unclassified 1665
231 Ga0466968_0105541 3300044735 Bacteria 1262
232 Ga0466970_0134624 3300044765 Bacteria 1359
233 Ga0466960_0096194 3300044901 Unclassified 1518
234 Ga0466958_0074434 3300045836 Bacteria 2081
235 Ga0495592_0103515 3300046454 Bacteria 2025
236 Ga0495629_0063794 3300046459 Bacteria 2572
237 Ga0495641_0000988 3300046461 Bacteria 24404
238 Ga0495641_0008081 3300046461 Bacteria 6467
239 Ga0495653_0028629 3300046463 Bacteria 4453
240 Ga0495580_0005188 3300046472 Bacteria 10826
241 Ga0495582_0016020 3300046473 Bacteria 4110
242 Ga0495582_0033717 3300046473 Bacteria 2815
243 Ga0495639_0000185 3300046475 Bacteria 33068
244 Ga0495662_0011995 3300046476 Bacteria 4236
245 Ga0495585_0195460 3300046492 Bacteria 1033
246 Ga0495596_0100036 3300046500 Bacteria 1126
247 Ga0495628_0144046 3300046516 Bacteria 1817
248 Ga0495630_0001166 3300046517 Bacteria 18157
249 Ga0495630_0042931 3300046517 Bacteria 3377
250 Ga0495666_0004199 3300046526 Bacteria 7265
251 Ga0495652_0091500 3300046529 Bacteria 2486
252 Ga0495665_0000433 3300046531 Bacteria 21230
253 Ga0495640_0001987 3300046533 Bacteria 16309
254 Ga0495645_0221850 3300046543 Bacteria 1271
255 Ga0495646_0168363 3300046680 Bacteria 1209
256 Ga0495647_0022121 3300046681 Bacteria 2295
257 Ga0495658_0000972 3300046683 Bacteria 15217
258 Ga0495658_0018127 3300046683 Bacteria 3653
259 Ga0495613_0063073 3300046689 Bacteria 2711
260 Ga0495613_0104050 3300046689 Bacteria 2050
261 Ga0495624_0009311 3300046690 Bacteria 6805
262 Ga0495670_0154566 3300046691 Unclassified 1204
263 Ga0495589_0058773 3300046794 Bacteria 1891
264 Ga0495581_0001632 3300047315 Bacteria 12510
265 Ga0495581_0006700 3300047315 Bacteria 6677
266 Ga0495674_0205297 3300047319 Bacteria 1633
267 Ga0495676_0017513 3300047321 Bacteria 6333
268 Ga0495676_0022041 3300047321 Bacteria 5551
269 Ga0495676_0085845 3300047321 Bacteria 2370
270 Ga0495680_0009715 3300047322 Bacteria 8635
271 Ga0495593_0000503 3300047673 Bacteria 22089
272 Ga0495614_0000171 3300048089 Bacteria 24006
273 Ga0495614_0057877 3300048089 Bacteria 1664
274 Ga0496100_0156383 3300048903 Bacteria 1630
275 Ga0496104_0417415 3300048907 Bacteria 1254
276 Ga0496104_0511727 3300048907 Bacteria 1112
277 Ga0496106_0368140 3300048909 Bacteria 1155
278 Ga0496108_0101112 3300048911 Bacteria 2459
279 Ga0496109_0005697 3300048912 Bacteria 10428
280 Ga0496109_0177008 3300048912 Unclassified 2003
281 Ga0496109_0288480 3300048912 Bacteria 1547
282 Ga0496110_0020011 3300048913 Bacteria 5643
283 Ga0496110_0607071 3300048913 Bacteria 992
284 Ga0496111_0002529 3300048914 Bacteria 11030
285 Ga0496111_0168489 3300048914 Bacteria 1627
286 Ga0496112_0000132 3300048915 Bacteria 46537
287 Ga0496112_0030813 3300048915 Bacteria 5196
288 Ga0496113_0020661 3300048916 Bacteria 4635
289 Ga0496113_0041264 3300048916 Bacteria 3404
290 Ga0496114_0048549 3300048917 Bacteria 3531
291 Ga0501031_0002959 3300049568 Bacteria 10867
292 Ga0501032_0015927 3300049569 Bacteria 5295
293 Ga0501034_0133454 3300049571 Bacteria 2465
294 Ga0501036_0000308 3300049572 Bacteria 34013
295 Ga0501037_0010925 3300049573 Bacteria 6673
296 Ga0501038_0039243 3300049574 Bacteria 4142
297 Ga0501039_0005652 3300049575 Bacteria 9469
298 Ga0501040_0006766 3300049576 Bacteria 7436
299 Ga0501041_0029105 3300049577 Bacteria 3332
300 Ga0501042_0001435 3300049578 Bacteria 14027
301 Ga0501042_0180815 3300049578 Unclassified 1521
302 Ga0501043_0010000 3300049579 Bacteria 7441
303 Ga0501046_0004588 3300049580 Bacteria 12473
304 Ga0501047_0001908 3300049581 Bacteria 20042
305 Ga0501068_0001237 3300049584 Bacteria 13560
306 Ga0501069_0004675 3300049585 Bacteria 7074
307 Ga0501070_0001291 3300049586 Bacteria 22481
308 Ga0501071_0469948 3300049587 Bacteria 963
309 Ga0501072_0000387 3300049588 Bacteria 31559
310 Ga0501073_0000148 3300049589 Bacteria 46653
311 Ga0501074_0004135 3300049590 Bacteria 10354
312 Ga0501075_0003671 3300049591 Bacteria 10295
313 Ga0501076_0000937 3300049592 Bacteria 19025
314 Ga0501077_0005954 3300049593 Bacteria 7445
315 Ga0501077_0013638 3300049593 Bacteria 5095
316 Ga0501079_0022675 3300049741 Bacteria 4816
317 Ga0501079_0549137 3300049741 Bacteria 908
318 Ga0501080_0001415 3300049742 Bacteria 20114
319 Ga0501081_0003256 3300049743 Bacteria 10338
320 Ga0501083_0000209 3300049744 Bacteria 38057
321 Ga0501035_0003290 3300049822 Bacteria 15492
322 Ga0501045_0002829 3300049824 Bacteria 11847
323 Ga0501045_0149498 3300049824 Bacteria 1737
324 nmdc:mga05p37_260350_c1 3300050507 Bacteria 2076
325 nmdc:mga05p37_90310_c1 3300050507 Bacteria 3775
326 nmdc:mga09592_199136_c1 3300050508 Bacteria 1734
327 nmdc:mga06r32_88639_c1 3300050510 Bacteria 3020
328 nmdc:mga08y16_306680_c1 3300050511 Bacteria 1635
329 nmdc:mga08y16_679174_c1 3300050511 Bacteria 1031
330 nmdc:mga0n895_22837_c1 3300050512 Bacteria 5868
331 nmdc:mga0rr50_121076_c1 3300050513 Bacteria 2083
332 nmdc:mga08x19_72795_c1 3300050514 Bacteria 2242
333 Ga0495601_0130316 3300053077 Bacteria 1637
334 Ga0495612_0017611 3300053078 Bacteria 2859
335 Ga0495619_0070767 3300053085 Bacteria 2333
336 Ga0500566_0003277 3300053094 Bacteria 9670
337 Ga0501084_0285166 3300054114 Bacteria 1394
338 Ga0501082_0037123 3300060353 Bacteria 4198
339 Ga0501082_0444573 3300060353 Unclassified 1132
340 Ga0530510_0006040 3300061734 Bacteria 8406
341 nmdc:mga05p37_357658_c1
342 Ga0070676_10140642
343 Ga0070676_10366793
344 Ga0070683_100081321
345 Ga0070683_100152979
346 Ga0070683_100166791
347 Ga0070680_100045784
348 Ga0070682_100046743
349 Ga0070682_100189150
350 Ga0070682_100200611
351 Ga0070691_10083048
352 Ga0070691_10112876
353 Ga0070661_100032533
354 Ga0070692_10185667
355 Ga0070668_100053349
356 Ga0070675_100393905
357 Ga0070671_100631356
358 Ga0070674_100004613
359 Ga0070674_100243896
360 Ga0070674_100343776
361 Ga0070673_100072181
362 Ga0070659_100029752
363 Ga0070659_100055742
364 Ga0070659_100087314
365 Ga0070714_100172313
366 Ga0070713_100012666
367 Ga0070710_10013434
368 Ga0070711_100456277
369 Ga0070700_100416031
370 Ga0070694_100610786
371 Ga0070678_100007145
372 Ga0070678_100201320
373 Ga0070678_100442519
374 Ga0070662_100088197
375 Ga0070681_10001960
376 Ga0068867_100378644
377 Ga0070706_100184944
378 Ga0070707_100103755
379 Ga0070707_100203518
380 Ga0070698_100117427
381 Ga0070684_100084702
382 Ga0070684_100106797
383 Ga0068853_100187335
384 Ga0070696_100124219
385 Ga0070704_100017372
386 Ga0070664_100496914
387 Ga0068857_100001657
388 Ga0068857_100463169
389 Ga0068856_100011442
390 Ga0068864_100497103
391 Ga0068861_100000835
392 Ga0068870_10141810
393 Ga0068858_100389029
394 Ga0068860_100210274
395 Ga0081539_10000181
396 Ga0070717_10009033
397 Ga0097621_100087855
398 Ga0075431_100166379
399 Ga0075433_10090977
400 Ga0075434_100002634
401 Ga0068865_100052443
402 Ga0068865_100379035
403 Ga0068865_100441071
404 Ga0068865_100532316
405 Ga0075436_100001902
406 Ga0075435_100059901
407 Ga0111539_10781372
408 Ga0105245_10013772
409 Ga0105245_10052372
410 Ga0105245_10152762
411 Ga0105245_10206632
412 Ga0105245_10325457
413 Ga0114129_10049689
414 Ga0105243_10014915
415 Ga0105243_10028175
416 Ga0105243_10180158
417 Ga0105243_10440823
418 Ga0105242_10209072
419 Ga0105242_10264683
420 Ga0105242_10690794
421 Ga0105249_10008908
422 Ga0105246_10384194
423 Ga0157369_10112428
424 Ga0157378_10813522
425 Ga0163162_10009946
426 Ga0163162_10154989
427 Ga0157372_10115513
428 Ga0157375_10581770
429 Ga0163163_10071910
430 Ga0157377_10033865
431 Ga0163161_10029804
432 Ga0163161_10060672
433 Ga0163161_10221372
434 Ga0206356_10962602
435 Ga0206353_10805187
436 Ga0213874_10004453
437 Ga0213874_10056242
438 Ga0213876_10019136
439 Ga0213876_10080431
440 Ga0213875_10010482
441 Ga0213875_10023513
442 Ga0213875_10056054
443 Ga0207688_10058215
444 Ga0207684_10075819
445 Ga0207684_10135439
446 Ga0207649_10037756
447 Ga0207681_10330540
448 Ga0207659_10235393
449 Ga0207687_10020351
450 Ga0207687_10169414
451 Ga0207700_10023336
452 Ga0207700_10181758
453 Ga0207700_10507460
454 Ga0207664_10076166
455 Ga0207690_10067414
456 Ga0207690_10078411
457 Ga0207690_10157660
458 Ga0207706_10030175
459 Ga0207706_10072522
460 Ga0207686_10248064
461 Ga0207686_10252721
462 Ga0207686_10287589
463 Ga0207686_10363790
464 Ga0207709_10025220
465 Ga0207709_10050973
466 Ga0207709_10101267
467 Ga0207669_10043259
468 Ga0207669_10174995
469 Ga0207704_10072274
470 Ga0207691_10060882
471 Ga0207661_10000559
472 Ga0207661_10029326
473 Ga0207661_10058807
474 Ga0207679_10022204
475 Ga0207679_10440132
476 Ga0207668_10272343
477 Ga0207668_10486155
478 Ga0207677_10089014
479 Ga0207703_10433149
480 Ga0207708_10056617
481 Ga0207708_10166475
482 Ga0207708_10737469
483 Ga0207702_10155667
484 Ga0207648_10453347
485 Ga0207674_10001033
486 Ga0207674_10061148
487 Ga0207675_100000592
488 Ga0207683_10149806
489 Ga0207683_10193480
490 Ga0207683_10356681
491 Ga0268266_10327243
492 Ga0307406_10311342
493 Ga0307416_100328463
494 Ga0307411_10342286
495 Ga0373958_0005203
496 Ga0373929_0022029
497 Ga0373949_0001721
498 Ga0373932_0004659
499 Ga0373941_0006952
500 Ga0373943_0007393
501 Ga0373946_0057173
502 Ga0373942_0006527
503 Ga0373961_0002366
504 Ga0373962_0004429
505 Ga0373931_0104822
506 Ga0373935_0027878
507 Ga0373947_0000780
508 Ga0373947_0232388
509 Ga0373925_0000924
510 Ga0395899_0005141
511 Ga0395899_0007029
512 Ga0395899_0013324
513 Ga0395899_0099782
514 Ga0395900_0003447
515 Ga0395900_0004715
516 Ga0395900_0011014
517 Ga0395900_0011579
518 Ga0395900_0015336
519 Ga0395900_0022487
520 Ga0395900_0197409
521 Ga0395900_0198954
522 Ga0395900_0416665
523 Ga0395900_0468911
524 Ga0395898_0011274
525 Ga0395898_0017567
526 Ga0395898_0021925
527 Ga0395898_0024689
528 Ga0395898_0195314
529 Ga0395898_0708376
530 Ga0395905_0003868
531 Ga0395905_0004184
532 Ga0395905_0050118
533 Ga0395905_0105980
534 Ga0395905_0401358
535 Ga0436364_0007301
536 Ga0436364_0026045
537 Ga0436364_0093103
538 Ga0436364_0192635
539 Ga0436364_0728155
540 Ga0436364_1012505
541 Ga0436364_1496630
542 Ga0395901_0003723
543 Ga0395901_0006489
544 Ga0395901_0014879
545 Ga0395901_0028085
546 Ga0395901_0093909
547 Ga0395901_0105831
548 Ga0395901_0145359
549 Ga0395901_0159786
550 Ga0436365_0119491
551 Ga0436365_0323151
552 Ga0436365_0390484
553 Ga0436365_0477793
554 Ga0436365_0538483
555 Ga0436365_0908940
556 Ga0436365_0931037
557 Ga0436363_0008252
558 Ga0436363_0239178
559 Ga0436363_0494400
560 Ga0436363_0608118
561 Ga0436363_0776166
562 Ga0436363_0780168
563 Ga0436363_1596444
564 Ga0436362_0312591
565 Ga0436362_1284982
566 Ga0451833_0868211
567 Ga0451837_1796655
568 Ga0451853_2958999
569 Ga0451853_3358201
570 Ga0466961_0118277
571 Ga0466968_0105541
572 Ga0466970_0134624
573 Ga0466960_0096194
574 Ga0466958_0074434
575 Ga0495592_0103515
576 Ga0495629_0063794
577 Ga0495641_0000988
578 Ga0495641_0008081
579 Ga0495653_0028629
580 Ga0495580_0005188
581 Ga0495582_0016020
582 Ga0495582_0033717
583 Ga0495639_0000185
584 Ga0495662_0011995
585 Ga0495585_0195460
586 Ga0495596_0100036
587 Ga0495628_0144046
588 Ga0495630_0001166
589 Ga0495630_0042931
590 Ga0495666_0004199
591 Ga0495652_0091500
592 Ga0495665_0000433
593 Ga0495640_0001987
594 Ga0495645_0221850
595 Ga0495646_0168363
596 Ga0495647_0022121
597 Ga0495658_0000972
598 Ga0495658_0018127
599 Ga0495613_0063073
600 Ga0495613_0104050
601 Ga0495624_0009311
602 Ga0495670_0154566
603 Ga0495589_0058773
604 Ga0495581_0001632
605 Ga0495581_0006700
606 Ga0495674_0205297
607 Ga0495676_0017513
608 Ga0495676_0022041
609 Ga0495676_0085845
610 Ga0495680_0009715
611 Ga0495593_0000503
612 Ga0495614_0000171
613 Ga0495614_0057877
614 Ga0496100_0156383
615 Ga0496104_0417415
616 Ga0496104_0511727
617 Ga0496106_0368140
618 Ga0496108_0101112
619 Ga0496109_0005697
620 Ga0496109_0177008
621 Ga0496109_0288480
622 Ga0496110_0020011
623 Ga0496110_0607071
624 Ga0496111_0002529
625 Ga0496111_0168489
626 Ga0496112_0000132
627 Ga0496112_0030813
628 Ga0496113_0020661
629 Ga0496113_0041264
630 Ga0496114_0048549
631 Ga0501031_0002959
632 Ga0501032_0015927
633 Ga0501034_0133454
634 Ga0501036_0000308
635 Ga0501037_0010925
636 Ga0501038_0039243
637 Ga0501039_0005652
638 Ga0501040_0006766
639 Ga0501041_0029105
640 Ga0501042_0001435
641 Ga0501042_0180815
642 Ga0501043_0010000
643 Ga0501046_0004588
644 Ga0501047_0001908
645 Ga0501068_0001237
646 Ga0501069_0004675
647 Ga0501070_0001291
648 Ga0501071_0469948
649 Ga0501072_0000387
650 Ga0501073_0000148
651 Ga0501074_0004135
652 Ga0501075_0003671
653 Ga0501076_0000937
654 Ga0501077_0005954
655 Ga0501077_0013638
656 Ga0501079_0022675
657 Ga0501079_0549137
658 Ga0501080_0001415
659 Ga0501081_0003256
660 Ga0501083_0000209
661 Ga0501035_0003290
662 Ga0501045_0002829
663 Ga0501045_0149498
664 nmdc:mga05p37_260350_c1
665 nmdc:mga05p37_90310_c1
666 nmdc:mga09592_199136_c1
667 nmdc:mga06r32_88639_c1
668 nmdc:mga08y16_306680_c1
669 nmdc:mga08y16_679174_c1
670 nmdc:mga0n895_22837_c1
671 nmdc:mga0rr50_121076_c1
672 nmdc:mga08x19_72795_c1
673 Ga0495601_0130316
674 Ga0495612_0017611
675 Ga0495619_0070767
676 Ga0500566_0003277
677 Ga0501084_0285166
678 Ga0501082_0037123
679 Ga0501082_0444573
680 Ga0530510_0006040

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12697

Abhydrolase_6

Alpha/beta hydrolase family

29

278

0.57

Structural Annotation

Top 5 Hits

ID Description Score Start End
6tj2-assembly1.cif.gz_C extracellular alpha/beta-hydrolase from paenibacillus species shares structural and functional homology to tobacco salicylic acid binding protein 2 0.7783 4 255
4lhe-assembly2.cif.gz_B crystal structure of closed form of monoacylglycerol lipase 0.7646 2 263
4ke6-assembly1.cif.gz_A crystal structure d196n mutant of monoglyceride lipase from bacillus sp. h257 in complex with 1-rac-lauroyl glycerol 0.7632 2 262
3rli-assembly1.cif.gz_A crystal structure of monoacylglycerol lipase from bacillus sp. h257 in complex with pmsf 0.7567 2 262
5hk8-assembly1.cif.gz_D crystal structure of a methylesterase protein mes16 from arabidopsis 0.7562 4 260
ID Description Score Start End Superfamily
af_Q54QE7_5_233_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.7871 1 261 3.40.50.1820
af_Q54QE7_5_233_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.7778 1 261 3.40.50.1820
af_Q8IL54_9_192_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.7654 1 92 3.40.50.1820
af_K7M2X6_107_217_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.7613 185 262 3.40.50.1820
5xksF00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.747 2 265 3.40.50.1820
ID Description Score Start End GO Terms
AF-A0A656TUV4-F1-model_v4 deleted 0.9813 1 89
AF-A0A537Y7H9-F1-model_v4 Alpha/beta hydrolase 0.9762 2 177 GO:0016787
AF-A0A537ZSG7-F1-model_v4 Alpha/beta fold hydrolase 0.9746 2 265 GO:0016787
AF-A0A6H1NGW6-F1-model_v4 Alpha/beta hydrolase 0.9737 2 175 GO:0016787
AF-A0A521RYH9-F1-model_v4 Alpha/beta hydrolase 0.9726 3 158 GO:0016787

Map