F414517

General Info

Members Datasets Scaffolds Average Seq Length
340 245 326 160

Family's Representative Sequence

Representative Sequence 3300049672|Ga0501239_017944|Ga0501239_017944_150_725
Length 182
Sequence MTSCFIFLFAYFHQHTSTISNYYISSTFAKKIMGLRIGLGVDFHQLAEGRELWIGGVLIPHHKGGVGHSDADVLLHAILGDIGVHFPDTDQQYKDIDSKILLQHTMQLIQREAYRLVNIDSTLCLQEPKIKPYILPMQQTIAGIAGVTIKDVSIKATTTEQMGFVGRKEGVVAYATVLLETI

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2818991442 Chitinophaga pinensis 1204 Isolate Unclassified
3 2818991460 Chitinophaga polysaccharea 1209 Isolate Unclassified
4 2821136567 Chitinophaga sancti 1232 Isolate Unclassified
5 2840677318 Chitinophaga alhagiae T22 Isolate Unclassified
6 2883068021 Chitinophaga rhizosphaerae T16R-86 Isolate Rhizosphere
7 2884791551 Chitinophaga oryzae 1310 Isolate Unclassified
8 2896085136 Chitinophaga alhagiae T22 Isolate Unclassified
9 2896109856 Chitinophaga sp. SYP-B3965 Isolate Rhizosphere
10 2904467357 Chitinophaga sancti 3198 Isolate Unclassified
11 2929177148 Chitinophaga sp. R-72269 Hybrid assembly Isolate Unclassified
12 2929921140 Chitinophaga sp. R-72609 Hybrid assembly Isolate Unclassified
13 2945977869 Chitinophaga sp. W2I13 Isolate Rhizosphere
14 2946013367 Chitinophaga sp. W3I9 Isolate Rhizosphere
15 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
16 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
17 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
18 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
19 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
20 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
21 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
22 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
23 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
24 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
25 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
26 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
27 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
28 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
29 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
30 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
31 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
32 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
33 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
34 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
35 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
36 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
37 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
38 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
39 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
40 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
41 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
42 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
43 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
44 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
45 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
46 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
47 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
48 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
49 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
50 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
51 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
52 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
53 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
54 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
55 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
56 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
57 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
58 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
59 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
60 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
61 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
62 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
63 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
64 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
65 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
66 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
67 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
68 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
69 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
70 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
71 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
72 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
73 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
74 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
76 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
77 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
78 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
79 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
81 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
82 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
83 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
84 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
85 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
86 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
87 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
88 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
89 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
90 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
91 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
92 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
93 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
94 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
95 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
96 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
97 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
98 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
99 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
100 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
101 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
102 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
103 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
104 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
105 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
106 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
107 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
108 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
109 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
110 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
111 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
112 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
158 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
159 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
160 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
161 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
162 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
163 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
164 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
165 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
166 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
167 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
168 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
169 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
170 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
171 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
172 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
173 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
174 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
175 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
176 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
177 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
178 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
179 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
180 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
181 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
182 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
183 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
184 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
185 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
186 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
187 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
188 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
189 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
190 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
191 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
192 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
193 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
194 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
195 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
196 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
197 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
198 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
199 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
200 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
201 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
202 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
203 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
204 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
205 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
206 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
207 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
208 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
209 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
210 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
211 3300049703 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control Metagenome Rhizosphere
212 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
213 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
214 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
215 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
216 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
217 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
218 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
219 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
220 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
221 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
222 3300050005 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought Metagenome Rhizosphere
223 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
224 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
225 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
226 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
227 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
228 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
229 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
230 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
231 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
232 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
233 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
234 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
235 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
236 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
237 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
238 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
239 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
240 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
241 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
242 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
243 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
244 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
245 8003151029 Chitinophaga sp. GbtcB8 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 95.88
Metatranscriptomes 0
Isolates 4.12

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 14.41
Nodule 0
Rhizoplane 0.88
Rhizosphere 76.76
Stem 0
Stem Tuber 0
Unclassified 7.94

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_3610923 2162886007 Bacteria 6168
2 JGI24740J21852_10001947 3300001979 Bacteria 9449
3 JGI24737J22298_10103610 3300001990 Unclassified 843
4 JGI25154J39366_1000120 3300002738 Bacteria 63261
5 JGI25158J39367_1012501 3300002739 Bacteria 1118
6 JGI25157J39369_1003740 3300002741 Bacteria 2996
7 JGI25153J46596_10000422 3300003215 Bacteria 27612
8 rootH1_10065058 3300003316 Bacteria 4253
9 rootH2_10072495 3300003320 Bacteria 22377
10 rootH2_10099657 3300003320 Bacteria 1509
11 rootH2_10190555 3300003320 Bacteria 1946
12 rootL2_10029350 3300003322 Bacteria 7086
13 rootL2_10316123 3300003322 Bacteria 1091
14 rootH1_10002423 3300003323 Bacteria 14823
15 rootH1_10396000 3300003323 Bacteria 1466
16 JGI25160J50197_1001631 3300003354 Bacteria 11008
17 JGI25160J50197_1011238 3300003354 Bacteria 3185
18 Ga0055535_1003734 3300003761 Bacteria 4098
19 Ga0055542_1004597 3300003762 Bacteria 3306
20 Ga0055528_1000265 3300003790 Bacteria 44369
21 Ga0055530_10000655 3300003791 Bacteria 29639
22 Ga0055531_10014870 3300003794 Bacteria 3475
23 Ga0055543_1032645 3300004625 Bacteria 904
24 Ga0065165_1000358 3300005262 Bacteria 75013
25 Ga0065704_10073113 3300005289 Bacteria 7572
26 Ga0065712_10261466 3300005290 Bacteria 936
27 Ga0070658_10018958 3300005327 Bacteria 5512
28 Ga0070658_10151646 3300005327 Unclassified 1941
29 Ga0070676_10068512 3300005328 Bacteria 2124
30 Ga0070683_100006814 3300005329 Bacteria 9600
31 Ga0070683_100309834 3300005329 Unclassified 1502
32 Ga0070670_100032939 3300005331 Bacteria 4465
33 Ga0070670_100041306 3300005331 Unclassified 3965
34 Ga0070670_100062625 3300005331 Bacteria 3193
35 Ga0070670_100277470 3300005331 Bacteria 1463
36 Ga0070670_100595117 3300005331 Unclassified 989
37 Ga0070670_101757374 3300005331 Bacteria 571
38 Ga0070682_100000005 3300005337 Bacteria 386439
39 Ga0068868_100029098 3300005338 Bacteria 4230
40 Ga0068868_100098391 3300005338 Bacteria 2365
41 Ga0068868_100129508 3300005338 Unclassified 2064
42 Ga0070660_100359503 3300005339 Unclassified 1200
43 Ga0070661_100213236 3300005344 Unclassified 1479
44 Ga0070668_100004850 3300005347 Bacteria 9964
45 Ga0070674_100008123 3300005356 Bacteria 6225
46 Ga0070674_101012317 3300005356 Bacteria 729
47 Ga0070673_100006246 3300005364 Bacteria 7725
48 Ga0070659_100717235 3300005366 Bacteria 866
49 Ga0070667_100001526 3300005367 Bacteria 20725
50 Ga0070667_100014795 3300005367 Bacteria 6446
51 Ga0070678_100002885 3300005456 Bacteria 9515
52 Ga0070662_100551709 3300005457 Bacteria 966
53 Ga0068867_100015179 3300005459 Bacteria 5463
54 Ga0068867_100660406 3300005459 Bacteria 918
55 Ga0070685_10204454 3300005466 Bacteria 1285
56 Ga0070706_100931072 3300005467 Unclassified 802
57 Ga0070679_100673923 3300005530 Unclassified 977
58 Ga0070684_100003131 3300005535 Bacteria 12344
59 Ga0068853_100006785 3300005539 Bacteria 9126
60 Ga0070672_100039346 3300005543 Unclassified 3621
61 Ga0070665_100021234 3300005548 Bacteria 6528
62 Ga0070665_100022763 3300005548 Bacteria 6308
63 Ga0068855_102342979 3300005563 Bacteria 534
64 Ga0070664_100017491 3300005564 Bacteria 5887
65 Ga0068857_100023699 3300005577 Bacteria 5404
66 Ga0068854_100037198 3300005578 Bacteria 3415
67 Ga0068854_100853371 3300005578 Unclassified 797
68 Ga0068856_101362063 3300005614 Bacteria 724
69 Ga0070702_100117687 3300005615 Unclassified 1658
70 Ga0068852_100011047 3300005616 Bacteria 6778
71 Ga0068852_100692071 3300005616 Bacteria 1029
72 Ga0068852_100942887 3300005616 Bacteria 881
73 Ga0068852_102028684 3300005616 Unclassified 597
74 Ga0068859_100011263 3300005617 Bacteria 8999
75 Ga0068859_100245036 3300005617 Unclassified 1882
76 Ga0068866_10013528 3300005718 Bacteria 3583
77 Ga0068866_10081266 3300005718 Bacteria 1740
78 Ga0068861_100070804 3300005719 Bacteria 2701
79 Ga0068861_100128151 3300005719 Bacteria 2056
80 Ga0068861_100304787 3300005719 Bacteria 1381
81 Ga0068851_10003573 3300005834 Bacteria 6925
82 Ga0068870_10012475 3300005840 Bacteria 3973
83 Ga0068863_100217854 3300005841 Bacteria 1838
84 Ga0068860_100006905 3300005843 Bacteria 11383
85 Ga0068860_100473360 3300005843 Bacteria 1248
86 Ga0068860_100994793 3300005843 Unclassified 856
87 Ga0068862_100152614 3300005844 Bacteria 2057
88 Ga0068862_100929871 3300005844 Bacteria 856
89 Ga0075366_10026135 3300006195 Bacteria 3418
90 Ga0075366_10148069 3300006195 Bacteria 1421
91 Ga0097621_100094414 3300006237 Bacteria 2508
92 Ga0068871_100018344 3300006358 Bacteria 5315
93 Ga0068871_100181046 3300006358 Bacteria 1811
94 Ga0075431_100013446 3300006847 Bacteria 8267
95 Ga0097620_100011263 3300006931 Bacteria 8999
96 Ga0097620_100245047 3300006931 Unclassified 1882
97 Ga0105240_10127038 3300009093 Bacteria 3062
98 Ga0111539_10033493 3300009094 Bacteria 6237
99 Ga0111539_10687291 3300009094 Bacteria 1191
100 Ga0105245_10147615 3300009098 Bacteria 2220
101 Ga0105245_10308399 3300009098 Bacteria 1555
102 Ga0105247_10340959 3300009101 Bacteria 1051
103 Ga0114129_10018475 3300009147 Bacteria 9930
104 Ga0105242_10086023 3300009176 Bacteria 2637
105 Ga0105242_10276808 3300009176 Unclassified 1522
106 Ga0105242_10330544 3300009176 Unclassified 1401
107 Ga0105237_10020646 3300009545 Bacteria 6785
108 Ga0105237_10543453 3300009545 Bacteria 1168
109 Ga0105238_11128726 3300009551 Bacteria 807
110 Ga0105249_10173535 3300009553 Bacteria 2092
111 Ga0105239_10006591 3300010375 Bacteria 13447
112 Ga0105239_10142996 3300010375 Bacteria 2667
113 Ga0105239_10208786 3300010375 Bacteria 2188
114 Ga0105246_10014849 3300011119 Bacteria 4906
115 Ga0157373_10147460 3300013100 Bacteria 1655
116 Ga0157371_10059406 3300013102 Bacteria 2710
117 Ga0157371_10249182 3300013102 Bacteria 1278
118 Ga0157370_10145464 3300013104 Bacteria 2207
119 Ga0157370_10228186 3300013104 Unclassified 1724
120 Ga0157374_10074926 3300013296 Unclassified 3197
121 Ga0157374_10260974 3300013296 Unclassified 1706
122 Ga0157374_10298438 3300013296 Bacteria 1594
123 Ga0157378_10007680 3300013297 Bacteria 9410
124 Ga0157378_10068606 3300013297 Bacteria 3180
125 Ga0157372_10101387 3300013307 Bacteria 3286
126 Ga0157372_10174278 3300013307 Bacteria 2489
127 Ga0157372_10218084 3300013307 Bacteria 2211
128 Ga0157372_10227334 3300013307 Bacteria 2163
129 Ga0157372_10668995 3300013307 Bacteria 1209
130 Ga0157375_10019980 3300013308 Bacteria 6108
131 Ga0157375_11024613 3300013308 Bacteria 964
132 Ga0157375_12073041 3300013308 Unclassified 677
133 Ga0163163_10043941 3300014325 Bacteria 4382
134 Ga0157377_10022208 3300014745 Bacteria 3347
135 Ga0157379_10237763 3300014968 Bacteria 1652
136 Ga0209436_103986 3300025208 Bacteria 3739
137 Ga0209258_100032 3300025242 Bacteria 452764
138 Ga0209646_1000050 3300025246 Bacteria 296599
139 Ga0209026_1000452 3300025250 Bacteria 32703
140 Ga0209148_1000223 3300025254 Bacteria 93490
141 Ga0209673_1000042 3300025273 Bacteria 300704
142 Ga0209130_1001696 3300025284 Bacteria 13322
143 Ga0209675_1037632 3300025291 Bacteria 1085
144 Ga0209564_1028614 3300025295 Bacteria 1776
145 Ga0209758_1027512 3300025297 Bacteria 2427
146 Ga0209050_1000295 3300025298 Bacteria 104889
147 Ga0207426_1000660 3300025302 Bacteria 42245
148 Ga0207426_1000711 3300025302 Bacteria 38972
149 Ga0207426_1002632 3300025302 Bacteria 11101
150 Ga0207426_1013950 3300025302 Bacteria 2961
151 Ga0209257_1000128 3300025304 Bacteria 214268
152 Ga0207642_10009339 3300025899 Bacteria 3408
153 Ga0207642_10088579 3300025899 Bacteria 1523
154 Ga0207710_10384297 3300025900 Unclassified 719
155 Ga0207688_10036549 3300025901 Bacteria 2722
156 Ga0207647_10007550 3300025904 Bacteria 7844
157 Ga0207645_10002126 3300025907 Bacteria 15860
158 Ga0207643_10004467 3300025908 Bacteria 7518
159 Ga0207705_10285263 3300025909 Bacteria 1264
160 Ga0207705_10300657 3300025909 Unclassified 1231
161 Ga0207654_10208996 3300025911 Unclassified 1289
162 Ga0207695_10015588 3300025913 Bacteria 8940
163 Ga0207671_10001129 3300025914 Bacteria 32133
164 Ga0207671_10102665 3300025914 Bacteria 2167
165 Ga0207660_10305071 3300025917 Unclassified 1268
166 Ga0207649_10108579 3300025920 Unclassified 1850
167 Ga0207652_10730504 3300025921 Unclassified 882
168 Ga0207681_10085963 3300025923 Bacteria 2233
169 Ga0207650_10001228 3300025925 Bacteria 18739
170 Ga0207650_10045458 3300025925 Bacteria 3230
171 Ga0207650_10066200 3300025925 Unclassified 2709
172 Ga0207650_10101410 3300025925 Bacteria 2216
173 Ga0207650_10323171 3300025925 Bacteria 1264
174 Ga0207659_10053090 3300025926 Bacteria 2890
175 Ga0207687_10179944 3300025927 Bacteria 1637
176 Ga0207690_10194876 3300025932 Bacteria 1535
177 Ga0207686_10164773 3300025934 Bacteria 1557
178 Ga0207686_10268647 3300025934 Unclassified 1254
179 Ga0207669_10004979 3300025937 Bacteria 5910
180 Ga0207669_10244739 3300025937 Bacteria 1331
181 Ga0207704_10036390 3300025938 Bacteria 2832
182 Ga0207691_10002936 3300025940 Bacteria 16636
183 Ga0207691_10049700 3300025940 Unclassified 3842
184 Ga0207689_10001010 3300025942 Bacteria 27038
185 Ga0207689_10010642 3300025942 Bacteria 7917
186 Ga0207661_10012555 3300025944 Bacteria 6161
187 Ga0207661_10314733 3300025944 Unclassified 1406
188 Ga0207679_10119746 3300025945 Unclassified 2093
189 Ga0207651_10164456 3300025960 Bacteria 1743
190 Ga0207651_10733192 3300025960 Bacteria 872
191 Ga0207651_10927719 3300025960 Bacteria 776
192 Ga0207712_10023143 3300025961 Bacteria 4097
193 Ga0207668_10012948 3300025972 Bacteria 5124
194 Ga0207640_10125507 3300025981 Bacteria 1847
195 Ga0207658_10981864 3300025986 Bacteria 770
196 Ga0207677_10002608 3300026023 Bacteria 9484
197 Ga0207677_10064920 3300026023 Unclassified 2545
198 Ga0207677_10643218 3300026023 Bacteria 935
199 Ga0207703_12153036 3300026035 Bacteria 534
200 Ga0207639_10180791 3300026041 Bacteria 1794
201 Ga0207639_10429440 3300026041 Bacteria 1196
202 Ga0207708_11005862 3300026075 Bacteria 724
203 Ga0207702_11956251 3300026078 Bacteria 577
204 Ga0207641_10008719 3300026088 Bacteria 8377
205 Ga0207641_10635331 3300026088 Bacteria 1048
206 Ga0207648_10001709 3300026089 Bacteria 24030
207 Ga0207648_10083368 3300026089 Bacteria 2788
208 Ga0207676_10028232 3300026095 Bacteria 4190
209 Ga0207674_10029729 3300026116 Bacteria 5750
210 Ga0207675_100019273 3300026118 Bacteria 6364
211 Ga0207675_100183365 3300026118 Bacteria 2005
212 Ga0207675_100192395 3300026118 Bacteria 1957
213 Ga0207683_10808797 3300026121 Archaea 870
214 Ga0207698_11206307 3300026142 Unclassified 771
215 Ga0268266_10014957 3300028379 Bacteria 6662
216 Ga0268266_10164744 3300028379 Bacteria 2007
217 Ga0268265_10558504 3300028380 Bacteria 1088
218 Ga0268265_10637050 3300028380 Bacteria 1023
219 Ga0268264_10003067 3300028381 Bacteria 14469
220 Ga0268264_10527559 3300028381 Bacteria 1155
221 Ga0307517_10284854 3300028786 Bacteria 939
222 Ga0265327_10031108 3300031251 Bacteria 3005
223 Ga0307405_10208831 3300031731 Bacteria 1424
224 Ga0307405_10809796 3300031731 Bacteria 785
225 Ga0316577_10243439 3300031733 Bacteria 1017
226 Ga0307413_10216277 3300031824 Bacteria 1396
227 Ga0307410_10192084 3300031852 Bacteria 1553
228 Ga0307412_10202271 3300031911 Bacteria 1509
229 Ga0307409_100236796 3300031995 Bacteria 1659
230 Ga0307510_10000401 3300033180 Bacteria 41063
231 Ga0316574_0294233 3300035398 Bacteria 1033
232 Ga0316584_0060826 3300036712 Bacteria 2829
233 Ga0395900_0171549 3300037418 Bacteria 2208
234 Ga0395905_0011381 3300037471 Bacteria 8595
235 Ga0395905_0169084 3300037471 Bacteria 2053
236 Ga0395901_0298076 3300038443 Bacteria 1672
237 Ga0439465_0058971 3300041413 Unclassified 1269
238 Ga0451795_0332560 3300041456 Bacteria 643
239 Ga0451807_2269776 3300041486 Unclassified 776
240 Ga0451843_0036126 3300041509 Bacteria 609
241 Ga0439431_0002637 3300041997 Bacteria 3951
242 Ga0439445_0003527 3300042004 Bacteria 3509
243 Ga0439449_0053517 3300042007 Bacteria 1492
244 Ga0439457_018940 3300042014 Bacteria 1529
245 Ga0451577_0000240 3300042876 Bacteria 108418
246 Ga0466972_0021809 3300044658 Bacteria 3191
247 Ga0453683_0169822 3300044673 Bacteria 1381
248 Ga0453683_0328621 3300044673 Bacteria 980
249 Ga0453683_0568043 3300044673 Bacteria 738
250 Ga0466965_0023426 3300044683 Bacteria 2982
251 Ga0466961_0203425 3300044693 Unclassified 1224
252 Ga0453684_0029937 3300044712 Bacteria 7709
253 Ga0453684_0255441 3300044712 Bacteria 2010
254 Ga0453684_0448624 3300044712 Bacteria 1436
255 Ga0453684_1208332 3300044712 Bacteria 793
256 Ga0466968_0080160 3300044735 Bacteria 1433
257 Ga0466959_0004513 3300045049 Bacteria 9333
258 Ga0495627_004119 3300046453 Bacteria 6176
259 Ga0495633_0001243 3300046558 Bacteria 20376
260 Ga0495668_0041672 3300046616 Bacteria 2557
261 Ga0495625_0325970 3300046660 Bacteria 977
262 Ga0495625_0526534 3300046660 Bacteria 719
263 Ga0496101_0022413 3300048904 Bacteria 4348
264 Ga0496121_0000051 3300048924 Bacteria 315378
265 Ga0496126_0005896 3300048929 Bacteria 13821
266 Ga0501032_0022312 3300049569 Bacteria 4389
267 Ga0501033_0145643 3300049570 Bacteria 1711
268 Ga0501033_0413207 3300049570 Bacteria 940
269 Ga0501034_0142183 3300049571 Unclassified 2378
270 Ga0501036_0023942 3300049572 Bacteria 5147
271 Ga0501037_0039451 3300049573 Bacteria 3476
272 Ga0501037_0201019 3300049573 Bacteria 1408
273 Ga0501038_0037041 3300049574 Unclassified 4279
274 Ga0501039_0059426 3300049575 Bacteria 2961
275 Ga0501043_0010068 3300049579 Bacteria 7413
276 Ga0501046_0046484 3300049580 Unclassified 3445
277 Ga0501047_0091505 3300049581 Bacteria 2920
278 Ga0501047_0239840 3300049581 Unclassified 1664
279 Ga0501072_0315053 3300049588 Bacteria 1243
280 Ga0501202_000577 3300049652 Bacteria 5338
281 Ga0501223_007291 3300049663 Bacteria 2266
282 Ga0501227_083259 3300049665 Bacteria 840
283 Ga0501239_017944 3300049672 Bacteria 846
284 Ga0501251_005113 3300049681 Bacteria 1380
285 Ga0501259_002651 3300049688 Unclassified 2880
286 Ga0501219_000126 3300049703 Bacteria 13435
287 Ga0501221_044813 3300049704 Bacteria 978
288 Ga0501225_0015487 3300049705 Bacteria 2122
289 Ga0501241_000783 3300049758 Bacteria 6723
290 Ga0501241_003146 3300049758 Bacteria 3143
291 Ga0501263_062256 3300049760 Bacteria 587
292 Ga0501266_017521 3300049763 Bacteria 958
293 Ga0501268_003163 3300049765 Bacteria 2233
294 Ga0501280_012414 3300049776 Bacteria 1197
295 Ga0501035_0041746 3300049822 Bacteria 4141
296 Ga0501044_0293803 3300049823 Bacteria 1556
297 Ga0501044_0299283 3300049823 Bacteria 1538
298 Ga0501044_1091568 3300049823 Bacteria 667
299 Ga0501212_014533 3300049851 Bacteria 1166
300 Ga0501284_00005 3300050005 Bacteria 164758
301 nmdc:mga0k408_182275_c1 3300050493 Bacteria 1252
302 nmdc:mga05p37_88667_c1 3300050507 Bacteria 3812
303 nmdc:mga06r32_208939_c1 3300050510 Bacteria 1940
304 nmdc:mga06r32_580415_c1 3300050510 Bacteria 1093
305 nmdc:mga08y16_213176_c1 3300050511 Unclassified 2000
306 Ga0500644_0000032 3300053088 Bacteria 85851
307 Ga0500646_0001105 3300053090 Bacteria 7328
308 Ga0500651_0155053 3300053093 Bacteria 1373
309 Ga0500651_0190057 3300053093 Bacteria 1216
310 Ga0500566_0135851 3300053094 Bacteria 1310
311 Ga0500557_096078 3300053105 Bacteria 983
312 Ga0500569_000364 3300053109 Bacteria 7349
313 Ga0500607_025592 3300053121 Bacteria 3283
314 Ga0500658_0141745 3300053134 Bacteria 1078
315 Ga0500559_0048529 3300053136 Bacteria 1867
316 Ga0500559_0269560 3300053136 Bacteria 801
317 Ga0500561_0011464 3300053137 Bacteria 1864
318 Ga0500568_0016742 3300053139 Bacteria 3249
319 Ga0500577_0006784 3300053142 Bacteria 3177
320 Ga0500590_024983 3300053148 Bacteria 3102
321 Ga0500616_0147583 3300053153 Bacteria 1092
322 Ga0500622_0000093 3300053156 Bacteria 92537
323 Ga0500622_0001270 3300053156 Bacteria 20604
324 Ga0500633_0026298 3300053160 Bacteria 1830
325 Ga0500634_0137496 3300053161 Bacteria 1162
326 Ga0500636_0009300 3300053177 Bacteria 5706

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300044712 Ga0453684_0448624 Ga0453684_0448624_660_1139 146
2 3300005329 Ga0070683_100309834 Ga0070683_1003098342 147
3 3300005467 Ga0070706_100931072 Ga0070706_1009310721 147
4 3300005616 Ga0068852_100692071 Ga0068852_1006920711 147
5 3300013307 Ga0157372_10101387 Ga0157372_101013874 147
6 3300013307 Ga0157372_10227334 Ga0157372_102273342 147
7 3300013307 Ga0157372_10668995 Ga0157372_106689952 147
8 3300025944 Ga0207661_10314733 Ga0207661_103147332 147
9 3300025960 Ga0207651_10927719 Ga0207651_109277191 147
10 3300026075 Ga0207708_11005862 Ga0207708_110058621 147
11 3300031731 Ga0307405_10208831 Ga0307405_102088311 147
12 3300031824 Ga0307413_10216277 Ga0307413_102162772 147
13 3300037418 Ga0395900_0171549 Ga0395900_0171549_1399_1878 147
14 3300037471 Ga0395905_0011381 Ga0395905_0011381_3967_4446 147
15 3300037471 Ga0395905_0169084 Ga0395905_0169084_280_759 147
16 3300038443 Ga0395901_0298076 Ga0395901_0298076_77_556 147
17 3300049681 Ga0501251_005113 Ga0501251_005113_47_622 148
18 3300013102 Ga0157371_10249182 Ga0157371_102491822 150
19 3300049763 Ga0501266_017521 Ga0501266_017521_448_927 150
20 3300003320 rootH2_10190555 rootH2_101905552 151
21 3300009101 Ga0105247_10340959 Ga0105247_103409592 151
22 3300025900 Ga0207710_10384297 Ga0207710_103842971 151
23 3300031731 Ga0307405_10809796 Ga0307405_108097962 151
24 3300031852 Ga0307410_10192084 Ga0307410_101920841 151
25 3300031911 Ga0307412_10202271 Ga0307412_102022711 151
26 3300031995 Ga0307409_100236796 Ga0307409_1002367961 151
27 3300049652 Ga0501202_000577 Ga0501202_000577_2885_3364 151
28 3300049663 Ga0501223_007291 Ga0501223_007291_1138_1617 151
29 3300049665 Ga0501227_083259 Ga0501227_083259_79_558 151
30 3300049672 Ga0501239_017944 Ga0501239_017944_150_725 151
31 3300049688 Ga0501259_002651 Ga0501259_002651_1168_1743 151
32 3300049704 Ga0501221_044813 Ga0501221_044813_179_658 151
33 3300049765 Ga0501268_003163 Ga0501268_003163_1590_2165 151
34 3300049776 Ga0501280_012414 Ga0501280_012414_520_999 151
35 3300049851 Ga0501212_014533 Ga0501212_014533_113_592 151
36 iso_pu_bacteria 2818991442 2819577302 156
37 iso_pu_bacteria 2818991460 2819676451 156
38 iso_pu_bacteria 2821136567 2821140605 156
39 iso_pu_bacteria 2840677318 2840678295 156
40 iso_pu_bacteria 2883068021 2883071220 156
41 iso_pu_bacteria 2884791551 2884796282 156
42 iso_pu_bacteria 2896085136 2896086112 156
43 iso_pu_bacteria 2896109856 2896115321 156
44 iso_pu_bacteria 2904467357 2904473024 156
45 iso_pu_bacteria 2929177148 2929178200 156
46 iso_pu_bacteria 2929921140 2929922349 156
47 iso_pu_bacteria 2945977869 2945980562 156
48 iso_pu_bacteria 2946013367 2946013575 156
49 iso_pu_bacteria 8003151029 8003156767 156
50 3300009147 Ga0114129_10018475 Ga0114129_100184758 157
51 3300046660 Ga0495625_0325970 Ga0495625_0325970_48_530 157
52 3300005548 Ga0070665_100021234 Ga0070665_1000212343 158
53 3300005563 Ga0068855_102342979 Ga0068855_1023429791 158
54 3300005578 Ga0068854_100037198 Ga0068854_1000371983 158
55 3300005616 Ga0068852_102028684 Ga0068852_1020286841 158
56 3300009093 Ga0105240_10127038 Ga0105240_101270382 158
57 3300009094 Ga0111539_10687291 Ga0111539_106872911 158
58 3300009545 Ga0105237_10543453 Ga0105237_105434532 158
59 3300010375 Ga0105239_10208786 Ga0105239_102087861 158
60 3300025904 Ga0207647_10007550 Ga0207647_100075506 158
61 3300025913 Ga0207695_10015588 Ga0207695_1001558810 158
62 3300025914 Ga0207671_10001129 Ga0207671_100011295 158
63 3300025914 Ga0207671_10102665 Ga0207671_101026655 158
64 3300025981 Ga0207640_10125507 Ga0207640_101255072 158
65 3300026089 Ga0207648_10083368 Ga0207648_100833682 158
66 3300028379 Ga0268266_10014957 Ga0268266_100149578 158
67 3300028786 Ga0307517_10284854 Ga0307517_102848541 158
68 3300046616 Ga0495668_0041672 Ga0495668_0041672_313_789 158
69 3300049570 Ga0501033_0413207 Ga0501033_0413207_152_628 158
70 3300049703 Ga0501219_000126 Ga0501219_000126_3641_4117 158
71 3300049705 Ga0501225_0015487 Ga0501225_0015487_1264_1740 158
72 3300049758 Ga0501241_003146 Ga0501241_003146_2640_3116 158
73 3300049822 Ga0501035_0041746 Ga0501035_0041746_1071_1547 158
74 3300050005 Ga0501284_00005 Ga0501284_00005_29477_29953 158
75 3300053094 Ga0500566_0135851 Ga0500566_0135851_332_808 158
76 3300003322 rootL2_10316123 rootL2_103161232 159
77 3300003323 rootH1_10396000 rootH1_103960003 159
78 3300005290 Ga0065712_10261466 Ga0065712_102614662 159
79 3300005327 Ga0070658_10151646 Ga0070658_101516463 159
80 3300005328 Ga0070676_10068512 Ga0070676_100685121 159
81 3300005329 Ga0070683_100006814 Ga0070683_1000068145 159
82 3300005331 Ga0070670_100032939 Ga0070670_1000329393 159
83 3300005331 Ga0070670_100041306 Ga0070670_1000413064 159
84 3300005331 Ga0070670_100062625 Ga0070670_1000626252 159
85 3300005331 Ga0070670_100277470 Ga0070670_1002774702 159
86 3300005331 Ga0070670_100595117 Ga0070670_1005951172 159
87 3300005331 Ga0070670_101757374 Ga0070670_1017573741 159
88 3300005337 Ga0070682_100000005 Ga0070682_100000005106 159
89 3300005338 Ga0068868_100029098 Ga0068868_1000290983 159
90 3300005338 Ga0068868_100098391 Ga0068868_1000983912 159
91 3300005338 Ga0068868_100129508 Ga0068868_1001295083 159
92 3300005339 Ga0070660_100359503 Ga0070660_1003595032 159
93 3300005344 Ga0070661_100213236 Ga0070661_1002132363 159
94 3300005347 Ga0070668_100004850 Ga0070668_1000048509 159
95 3300005356 Ga0070674_100008123 Ga0070674_1000081233 159
96 3300005356 Ga0070674_101012317 Ga0070674_1010123171 159
97 3300005364 Ga0070673_100006246 Ga0070673_1000062467 159
98 3300005367 Ga0070667_100001526 Ga0070667_1000015269 159
99 3300005367 Ga0070667_100014795 Ga0070667_1000147952 159
100 3300005456 Ga0070678_100002885 Ga0070678_1000028852 159
101 3300005457 Ga0070662_100551709 Ga0070662_1005517091 159
102 3300005459 Ga0068867_100015179 Ga0068867_1000151792 159
103 3300005459 Ga0068867_100660406 Ga0068867_1006604062 159
104 3300005466 Ga0070685_10204454 Ga0070685_102044541 159
105 3300005530 Ga0070679_100673923 Ga0070679_1006739232 159
106 3300005535 Ga0070684_100003131 Ga0070684_1000031318 159
107 3300005539 Ga0068853_100006785 Ga0068853_1000067859 159
108 3300005543 Ga0070672_100039346 Ga0070672_1000393464 159
109 3300005548 Ga0070665_100022763 Ga0070665_1000227634 159
110 3300005564 Ga0070664_100017491 Ga0070664_1000174913 159
111 3300005578 Ga0068854_100853371 Ga0068854_1008533712 159
112 3300005614 Ga0068856_101362063 Ga0068856_1013620632 159
113 3300005615 Ga0070702_100117687 Ga0070702_1001176873 159
114 3300005616 Ga0068852_100011047 Ga0068852_1000110472 159
115 3300005616 Ga0068852_100942887 Ga0068852_1009428872 159
116 3300005617 Ga0068859_100011263 Ga0068859_1000112634 159
117 3300005617 Ga0068859_100245036 Ga0068859_1002450362 159
118 3300005718 Ga0068866_10013528 Ga0068866_100135283 159
119 3300005718 Ga0068866_10081266 Ga0068866_100812662 159
120 3300005719 Ga0068861_100070804 Ga0068861_1000708043 159
121 3300005719 Ga0068861_100128151 Ga0068861_1001281512 159
122 3300005719 Ga0068861_100304787 Ga0068861_1003047872 159
123 3300005834 Ga0068851_10003573 Ga0068851_100035732 159
124 3300005840 Ga0068870_10012475 Ga0068870_100124754 159
125 3300005841 Ga0068863_100217854 Ga0068863_1002178541 159
126 3300005843 Ga0068860_100006905 Ga0068860_1000069054 159
127 3300005843 Ga0068860_100473360 Ga0068860_1004733602 159
128 3300005843 Ga0068860_100994793 Ga0068860_1009947931 159
129 3300005844 Ga0068862_100152614 Ga0068862_1001526142 159
130 3300005844 Ga0068862_100929871 Ga0068862_1009298712 159
131 3300006237 Ga0097621_100094414 Ga0097621_1000944143 159
132 3300006358 Ga0068871_100018344 Ga0068871_1000183444 159
133 3300006358 Ga0068871_100181046 Ga0068871_1001810462 159
134 3300006847 Ga0075431_100013446 Ga0075431_1000134462 159
135 3300006931 Ga0097620_100011263 Ga0097620_1000112634 159
136 3300006931 Ga0097620_100245047 Ga0097620_1002450473 159
137 3300009094 Ga0111539_10033493 Ga0111539_100334935 159
138 3300009098 Ga0105245_10147615 Ga0105245_101476152 159
139 3300009176 Ga0105242_10086023 Ga0105242_100860232 159
140 3300009176 Ga0105242_10276808 Ga0105242_102768082 159
141 3300009176 Ga0105242_10330544 Ga0105242_103305442 159
142 3300009551 Ga0105238_11128726 Ga0105238_111287261 159
143 3300009553 Ga0105249_10173535 Ga0105249_101735353 159
144 3300011119 Ga0105246_10014849 Ga0105246_100148492 159
145 3300013104 Ga0157370_10228186 Ga0157370_102281862 159
146 3300013296 Ga0157374_10074926 Ga0157374_100749262 159
147 3300013296 Ga0157374_10260974 Ga0157374_102609742 159
148 3300013296 Ga0157374_10298438 Ga0157374_102984382 159
149 3300013297 Ga0157378_10007680 Ga0157378_100076802 159
150 3300013297 Ga0157378_10068606 Ga0157378_100686061 159
151 3300013307 Ga0157372_10218084 Ga0157372_102180843 159
152 3300013308 Ga0157375_10019980 Ga0157375_100199805 159
153 3300013308 Ga0157375_11024613 Ga0157375_110246132 159
154 3300013308 Ga0157375_12073041 Ga0157375_120730412 159
155 3300014325 Ga0163163_10043941 Ga0163163_100439413 159
156 3300014745 Ga0157377_10022208 Ga0157377_100222083 159
157 3300014968 Ga0157379_10237763 Ga0157379_102377632 159
158 3300025899 Ga0207642_10009339 Ga0207642_100093394 159
159 3300025899 Ga0207642_10088579 Ga0207642_100885792 159
160 3300025901 Ga0207688_10036549 Ga0207688_100365494 159
161 3300025907 Ga0207645_10002126 Ga0207645_100021262 159
162 3300025908 Ga0207643_10004467 Ga0207643_100044677 159
163 3300025909 Ga0207705_10300657 Ga0207705_103006572 159
164 3300025911 Ga0207654_10208996 Ga0207654_102089962 159
165 3300025917 Ga0207660_10305071 Ga0207660_103050712 159
166 3300025920 Ga0207649_10108579 Ga0207649_101085793 159
167 3300025921 Ga0207652_10730504 Ga0207652_107305041 159
168 3300025923 Ga0207681_10085963 Ga0207681_100859632 159
169 3300025925 Ga0207650_10001228 Ga0207650_1000122810 159
170 3300025925 Ga0207650_10045458 Ga0207650_100454583 159
171 3300025925 Ga0207650_10066200 Ga0207650_100662002 159
172 3300025925 Ga0207650_10101410 Ga0207650_101014102 159
173 3300025925 Ga0207650_10323171 Ga0207650_103231712 159
174 3300025926 Ga0207659_10053090 Ga0207659_100530901 159
175 3300025927 Ga0207687_10179944 Ga0207687_101799441 159
176 3300025934 Ga0207686_10164773 Ga0207686_101647732 159
177 3300025934 Ga0207686_10268647 Ga0207686_102686472 159
178 3300025937 Ga0207669_10004979 Ga0207669_100049793 159
179 3300025937 Ga0207669_10244739 Ga0207669_102447392 159
180 3300025938 Ga0207704_10036390 Ga0207704_100363904 159
181 3300025940 Ga0207691_10002936 Ga0207691_1000293613 159
182 3300025940 Ga0207691_10049700 Ga0207691_100497004 159
183 3300025942 Ga0207689_10001010 Ga0207689_1000101028 159
184 3300025942 Ga0207689_10010642 Ga0207689_100106424 159
185 3300025944 Ga0207661_10012555 Ga0207661_100125553 159
186 3300025945 Ga0207679_10119746 Ga0207679_101197463 159
187 3300025960 Ga0207651_10164456 Ga0207651_101644562 159
188 3300025960 Ga0207651_10733192 Ga0207651_107331922 159
189 3300025961 Ga0207712_10023143 Ga0207712_100231433 159
190 3300025972 Ga0207668_10012948 Ga0207668_100129483 159
191 3300025986 Ga0207658_10981864 Ga0207658_109818641 159
192 3300026023 Ga0207677_10002608 Ga0207677_100026083 159
193 3300026023 Ga0207677_10064920 Ga0207677_100649202 159
194 3300026023 Ga0207677_10643218 Ga0207677_106432182 159
195 3300026035 Ga0207703_12153036 Ga0207703_121530361 159
196 3300026041 Ga0207639_10180791 Ga0207639_101807912 159
197 3300026041 Ga0207639_10429440 Ga0207639_104294402 159
198 3300026078 Ga0207702_11956251 Ga0207702_119562511 159
199 3300026088 Ga0207641_10008719 Ga0207641_100087194 159
200 3300026088 Ga0207641_10635331 Ga0207641_106353311 159
201 3300026089 Ga0207648_10001709 Ga0207648_100017092 159
202 3300026095 Ga0207676_10028232 Ga0207676_100282322 159
203 3300026118 Ga0207675_100019273 Ga0207675_1000192737 159
204 3300026118 Ga0207675_100183365 Ga0207675_1001833653 159
205 3300026118 Ga0207675_100192395 Ga0207675_1001923952 159
206 3300026121 Ga0207683_10808797 Ga0207683_108087971 159
207 3300026142 Ga0207698_11206307 Ga0207698_112063072 159
208 3300028379 Ga0268266_10164744 Ga0268266_101647441 159
209 3300028380 Ga0268265_10558504 Ga0268265_105585042 159
210 3300028380 Ga0268265_10637050 Ga0268265_106370501 159
211 3300028381 Ga0268264_10003067 Ga0268264_100030674 159
212 3300028381 Ga0268264_10527559 Ga0268264_105275592 159
213 3300031251 Ga0265327_10031108 Ga0265327_100311083 159
214 3300031733 Ga0316577_10243439 Ga0316577_102434392 159
215 3300033180 Ga0307510_10000401 Ga0307510_1000040130 159
216 3300035398 Ga0316574_0294233 Ga0316574_0294233_537_1016 159
217 3300036712 Ga0316584_0060826 Ga0316584_0060826_511_990 159
218 3300041413 Ga0439465_0058971 Ga0439465_0058971_78_557 159
219 3300041456 Ga0451795_0332560 Ga0451795_0332560_97_576 159
220 3300041486 Ga0451807_2269776 Ga0451807_2269776_230_715 159
221 3300041509 Ga0451843_0036126 Ga0451843_0036126_50_532 159
222 3300044673 Ga0453683_0169822 Ga0453683_0169822_457_945 159
223 3300044673 Ga0453683_0328621 Ga0453683_0328621_222_710 159
224 3300044673 Ga0453683_0568043 Ga0453683_0568043_113_601 159
225 3300044712 Ga0453684_0029937 Ga0453684_0029937_3471_3965 159
226 3300044712 Ga0453684_0255441 Ga0453684_0255441_1118_1606 159
227 3300044712 Ga0453684_1208332 Ga0453684_1208332_292_777 159
228 3300049760 Ga0501263_062256 Ga0501263_062256_32_511 159
229 3300050507 nmdc:mga05p37_88667_c1 nmdc:mga05p37_88667_c1_3274_3759 159
230 3300050510 nmdc:mga06r32_208939_c1 nmdc:mga06r32_208939_c1_837_1334 159
231 3300050510 nmdc:mga06r32_580415_c1 nmdc:mga06r32_580415_c1_457_951 159
232 3300050511 nmdc:mga08y16_213176_c1 nmdc:mga08y16_213176_c1_122_601 159
233 3300053088 Ga0500644_0000032 Ga0500644_0000032_55720_56199 159
234 3300053090 Ga0500646_0001105 Ga0500646_0001105_2581_3060 159
235 3300053093 Ga0500651_0190057 Ga0500651_0190057_438_917 159
236 3300053109 Ga0500569_000364 Ga0500569_000364_2821_3300 159
237 3300053134 Ga0500658_0141745 Ga0500658_0141745_387_866 159
238 3300053136 Ga0500559_0048529 Ga0500559_0048529_647_1126 159
239 3300053136 Ga0500559_0269560 Ga0500559_0269560_34_513 159
240 3300053137 Ga0500561_0011464 Ga0500561_0011464_913_1392 159
241 3300053142 Ga0500577_0006784 Ga0500577_0006784_342_821 159
242 3300053148 Ga0500590_024983 Ga0500590_024983_1099_1578 159
243 3300053153 Ga0500616_0147583 Ga0500616_0147583_502_984 159
244 3300053156 Ga0500622_0001270 Ga0500622_0001270_17328_17807 159
245 3300053160 Ga0500633_0026298 Ga0500633_0026298_537_1016 159
246 3300053161 Ga0500634_0137496 Ga0500634_0137496_473_952 159
247 3300053177 Ga0500636_0009300 Ga0500636_0009300_2610_3089 159
248 2162886007 SwRhRL2b_contig_3610923 SwRhRL2b_0749.00000850 160
249 3300001979 JGI24740J21852_10001947 JGI24740J21852_100019479 160
250 3300001990 JGI24737J22298_10103610 JGI24737J22298_101036102 160
251 3300002738 JGI25154J39366_1000120 JGI25154J39366_100012028 160
252 3300002739 JGI25158J39367_1012501 JGI25158J39367_10125012 160
253 3300002741 JGI25157J39369_1003740 JGI25157J39369_10037403 160
254 3300003215 JGI25153J46596_10000422 JGI25153J46596_100004225 160
255 3300003316 rootH1_10065058 rootH1_100650585 160
256 3300003320 rootH2_10072495 rootH2_1007249517 160
257 3300003320 rootH2_10099657 rootH2_100996572 160
258 3300003322 rootL2_10029350 rootL2_100293504 160
259 3300003323 rootH1_10002423 rootH1_100024235 160
260 3300003354 JGI25160J50197_1001631 JGI25160J50197_10016315 160
261 3300003354 JGI25160J50197_1011238 JGI25160J50197_10112383 160
262 3300003761 Ga0055535_1003734 Ga0055535_10037343 160
263 3300003762 Ga0055542_1004597 Ga0055542_10045972 160
264 3300003790 Ga0055528_1000265 Ga0055528_100026528 160
265 3300003791 Ga0055530_10000655 Ga0055530_1000065514 160
266 3300003794 Ga0055531_10014870 Ga0055531_100148703 160
267 3300004625 Ga0055543_1032645 Ga0055543_10326452 160
268 3300005262 Ga0065165_1000358 Ga0065165_100035811 160
269 3300005289 Ga0065704_10073113 Ga0065704_100731136 160
270 3300005327 Ga0070658_10018958 Ga0070658_100189585 160
271 3300005366 Ga0070659_100717235 Ga0070659_1007172352 160
272 3300005577 Ga0068857_100023699 Ga0068857_1000236992 160
273 3300006195 Ga0075366_10026135 Ga0075366_100261353 160
274 3300006195 Ga0075366_10148069 Ga0075366_101480692 160
275 3300009098 Ga0105245_10308399 Ga0105245_103083992 160
276 3300009545 Ga0105237_10020646 Ga0105237_100206464 160
277 3300010375 Ga0105239_10006591 Ga0105239_100065915 160
278 3300010375 Ga0105239_10142996 Ga0105239_101429962 160
279 3300013100 Ga0157373_10147460 Ga0157373_101474602 160
280 3300013102 Ga0157371_10059406 Ga0157371_100594062 160
281 3300013104 Ga0157370_10145464 Ga0157370_101454642 160
282 3300013307 Ga0157372_10174278 Ga0157372_101742783 160
283 3300025208 Ga0209436_103986 Ga0209436_1039863 160
284 3300025242 Ga0209258_100032 Ga0209258_10003299 160
285 3300025246 Ga0209646_1000050 Ga0209646_100005028 160
286 3300025250 Ga0209026_1000452 Ga0209026_100045223 160
287 3300025254 Ga0209148_1000223 Ga0209148_100022327 160
288 3300025273 Ga0209673_1000042 Ga0209673_1000042185 160
289 3300025284 Ga0209130_1001696 Ga0209130_10016969 160
290 3300025291 Ga0209675_1037632 Ga0209675_10376321 160
291 3300025295 Ga0209564_1028614 Ga0209564_10286142 160
292 3300025297 Ga0209758_1027512 Ga0209758_10275123 160
293 3300025298 Ga0209050_1000295 Ga0209050_100029529 160
294 3300025302 Ga0207426_1000660 Ga0207426_100066024 160
295 3300025302 Ga0207426_1000711 Ga0207426_100071123 160
296 3300025302 Ga0207426_1002632 Ga0207426_10026323 160
297 3300025302 Ga0207426_1013950 Ga0207426_10139501 160
298 3300025304 Ga0209257_1000128 Ga0209257_1000128150 160
299 3300025909 Ga0207705_10285263 Ga0207705_102852632 160
300 3300025932 Ga0207690_10194876 Ga0207690_101948762 160
301 3300026116 Ga0207674_10029729 Ga0207674_100297296 160
302 3300041997 Ga0439431_0002637 Ga0439431_0002637_2458_2940 160
303 3300042004 Ga0439445_0003527 Ga0439445_0003527_1588_2070 160
304 3300042007 Ga0439449_0053517 Ga0439449_0053517_140_631 160
305 3300042014 Ga0439457_018940 Ga0439457_018940_963_1445 160
306 3300042876 Ga0451577_0000240 Ga0451577_0000240_74079_74561 160
307 3300044658 Ga0466972_0021809 Ga0466972_0021809_1330_1818 160
308 3300044683 Ga0466965_0023426 Ga0466965_0023426_2441_2932 160
309 3300044693 Ga0466961_0203425 Ga0466961_0203425_433_921 160
310 3300044735 Ga0466968_0080160 Ga0466968_0080160_563_1051 160
311 3300045049 Ga0466959_0004513 Ga0466959_0004513_3933_4454 160
312 3300046453 Ga0495627_004119 Ga0495627_004119_3887_4369 160
313 3300046558 Ga0495633_0001243 Ga0495633_0001243_7628_8110 160
314 3300046660 Ga0495625_0526534 Ga0495625_0526534_50_535 160
315 3300048904 Ga0496101_0022413 Ga0496101_0022413_3803_4285 160
316 3300048924 Ga0496121_0000051 Ga0496121_0000051_27707_28189 160
317 3300048929 Ga0496126_0005896 Ga0496126_0005896_1514_1996 160
318 3300049569 Ga0501032_0022312 Ga0501032_0022312_73_588 160
319 3300049570 Ga0501033_0145643 Ga0501033_0145643_23_511 160
320 3300049571 Ga0501034_0142183 Ga0501034_0142183_331_846 160
321 3300049572 Ga0501036_0023942 Ga0501036_0023942_230_745 160
322 3300049573 Ga0501037_0039451 Ga0501037_0039451_538_1053 160
323 3300049573 Ga0501037_0201019 Ga0501037_0201019_662_1144 160
324 3300049574 Ga0501038_0037041 Ga0501038_0037041_1812_2327 160
325 3300049575 Ga0501039_0059426 Ga0501039_0059426_2060_2575 160
326 3300049579 Ga0501043_0010068 Ga0501043_0010068_4154_4669 160
327 3300049580 Ga0501046_0046484 Ga0501046_0046484_1782_2297 160
328 3300049581 Ga0501047_0091505 Ga0501047_0091505_1646_2128 160
329 3300049581 Ga0501047_0239840 Ga0501047_0239840_1044_1559 160
330 3300049588 Ga0501072_0315053 Ga0501072_0315053_240_755 160
331 3300049758 Ga0501241_000783 Ga0501241_000783_1906_2388 160
332 3300049823 Ga0501044_0293803 Ga0501044_0293803_119_607 160
333 3300049823 Ga0501044_0299283 Ga0501044_0299283_268_750 160
334 3300049823 Ga0501044_1091568 Ga0501044_1091568_73_588 160
335 3300050493 nmdc:mga0k408_182275_c1 nmdc:mga0k408_182275_c1_435_917 160
336 3300053093 Ga0500651_0155053 Ga0500651_0155053_290_772 160
337 3300053105 Ga0500557_096078 Ga0500557_096078_240_725 160
338 3300053121 Ga0500607_025592 Ga0500607_025592_2670_3161 160
339 3300053139 Ga0500568_0016742 Ga0500568_0016742_1140_1625 160
340 3300053156 Ga0500622_0000093 Ga0500622_0000093_86895_87377 160

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02542

YgbB

YgbB family

35

180

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
5iwx-assembly1.cif.gz_B crystal structure of 2-c-methyl-d-erythritol 2,4-cyclodiphosphate synthase from bacillus subtitis 0.9792 3 160
5iwx-assembly1.cif.gz_B crystal structure of 2-c-methyl-d-erythritol 2,4-cyclodiphosphate synthase from bacillus subtitis 0.9728 3 160
3iew-assembly1.cif.gz_A crystal structure of 2c-methyl-d-erythritol 2,4-cyclodiphosphate synthase from burkholderia pseudomallei with bound ctp and cdp 0.9661 4 160
5l12-assembly1.cif.gz_A crystal structure of 2c-methyl-d-erythritol 2,4-clycodiphosphate synthase from burkholderia pseudomallei double mutant 0.965 3 159
3k2x-assembly1.cif.gz_A crystal structure of 2c-methyl-d-erythritol 2,4-cyclodiphosphate synthase from burkholderia pseudomallei in complex with 5'-iodo-cytosine 0.9645 3 159
ID Description Score Start End Superfamily
af_B6TL41_66_225_3.30.1330.50 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase 0.9583 4 160 3.30.1330.50
1iv1B00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase 0.9439 5 157 3.30.1330.50
5b8fC00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase 0.9435 2 160 3.30.1330.50
1w55A02 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase 0.9393 3 160 3.30.1330.50
3t80F00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase 0.9354 3 159 3.30.1330.50
ID Description Score Start End GO Terms
AF-A0A7C3YSD8-F1-model_v4 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase (MECDP-synthase) (MECPP-synthase) (MECPS) (EC 4.6.1.12) 0.9778 5 160 GO:0008685
GO:0016114
GO:0019288
GO:0046872
AF-A0A1N6K225-F1-model_v4 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase (MECDP-synthase) (MECPP-synthase) (MECPS) (EC 4.6.1.12) 0.9732 1 160 GO:0008685
GO:0016114
GO:0019288
GO:0046872
AF-A0A1G3QRJ1-F1-model_v4 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase (MECDP-synthase) (MECPP-synthase) (MECPS) (EC 4.6.1.12) 0.9718 3 159 GO:0008685
GO:0016114
GO:0019288
GO:0046872
AF-A0A1F2RZ30-F1-model_v4 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase (MECDP-synthase) (MECPP-synthase) (MECPS) (EC 4.6.1.12) 0.9716 2 160 GO:0008685
GO:0016114
GO:0019288
GO:0046872
AF-Q1IVA8-F1-model_v4 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase (MECDP-synthase) (MECPP-synthase) (MECPS) (EC 4.6.1.12) 0.971 3 160 GO:0008685
GO:0016114
GO:0019288
GO:0046872

Feature Viewer

pLDDT pTM Quality
92.48 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map