F414517
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 340 | 245 | 326 | 160 |
Family's Representative Sequence
| Representative Sequence | 3300049672|Ga0501239_017944|Ga0501239_017944_150_725 |
| Length | 182 |
| Sequence | MTSCFIFLFAYFHQHTSTISNYYISSTFAKKIMGLRIGLGVDFHQLAEGRELWIGGVLIPHHKGGVGHSDADVLLHAILGDIGVHFPDTDQQYKDIDSKILLQHTMQLIQREAYRLVNIDSTLCLQEPKIKPYILPMQQTIAGIAGVTIKDVSIKATTTEQMGFVGRKEGVVAYATVLLETI |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2818991442 | Chitinophaga pinensis 1204 | Isolate | Unclassified |
| 3 | 2818991460 | Chitinophaga polysaccharea 1209 | Isolate | Unclassified |
| 4 | 2821136567 | Chitinophaga sancti 1232 | Isolate | Unclassified |
| 5 | 2840677318 | Chitinophaga alhagiae T22 | Isolate | Unclassified |
| 6 | 2883068021 | Chitinophaga rhizosphaerae T16R-86 | Isolate | Rhizosphere |
| 7 | 2884791551 | Chitinophaga oryzae 1310 | Isolate | Unclassified |
| 8 | 2896085136 | Chitinophaga alhagiae T22 | Isolate | Unclassified |
| 9 | 2896109856 | Chitinophaga sp. SYP-B3965 | Isolate | Rhizosphere |
| 10 | 2904467357 | Chitinophaga sancti 3198 | Isolate | Unclassified |
| 11 | 2929177148 | Chitinophaga sp. R-72269 Hybrid assembly | Isolate | Unclassified |
| 12 | 2929921140 | Chitinophaga sp. R-72609 Hybrid assembly | Isolate | Unclassified |
| 13 | 2945977869 | Chitinophaga sp. W2I13 | Isolate | Rhizosphere |
| 14 | 2946013367 | Chitinophaga sp. W3I9 | Isolate | Rhizosphere |
| 15 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 16 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 17 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 18 | 3300002739 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA | Metagenome | Endosphere |
| 19 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 20 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 21 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 22 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 23 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 24 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 25 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 26 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 27 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 28 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 29 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 30 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 31 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 32 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 33 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 34 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 35 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 38 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 40 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 41 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 51 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 52 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 53 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 54 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 55 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 56 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 59 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 61 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 62 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 63 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 65 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 66 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 67 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 68 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 69 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 70 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 71 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 72 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 73 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 74 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 76 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 77 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 100 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 101 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 102 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 103 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 104 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 105 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 106 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 107 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 108 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 109 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 110 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 111 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 112 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 158 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 159 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 160 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 161 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 162 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 163 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 164 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 165 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 166 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 167 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 168 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 169 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 170 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 171 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 172 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 173 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 174 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 175 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 176 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 177 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 178 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 179 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 180 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 181 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 182 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 183 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 184 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 185 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 186 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 187 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 192 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 193 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 194 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 195 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 196 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 197 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 198 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 199 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 200 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 201 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 202 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 203 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 204 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 205 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 206 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 207 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 208 | 3300049672 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought | Metagenome | Rhizosphere |
| 209 | 3300049681 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought | Metagenome | Rhizosphere |
| 210 | 3300049688 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought | Metagenome | Rhizosphere |
| 211 | 3300049703 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control | Metagenome | Rhizosphere |
| 212 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 213 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 214 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 215 | 3300049760 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control | Metagenome | Rhizosphere |
| 216 | 3300049763 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control | Metagenome | Rhizosphere |
| 217 | 3300049765 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought | Metagenome | Rhizosphere |
| 218 | 3300049776 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought | Metagenome | Rhizosphere |
| 219 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 220 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 221 | 3300049851 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought | Metagenome | Rhizosphere |
| 222 | 3300050005 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought | Metagenome | Rhizosphere |
| 223 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 224 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 225 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 226 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 227 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 228 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 229 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 230 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 231 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 232 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 233 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 234 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 235 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 236 | 3300053137 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere | Metagenome | Endosphere |
| 237 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 238 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 239 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 240 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 241 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 242 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 243 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 244 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 245 | 8003151029 | Chitinophaga sp. GbtcB8 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 95.88 |
| Metatranscriptomes | 0 |
| Isolates | 4.12 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 14.41 |
| Nodule | 0 |
| Rhizoplane | 0.88 |
| Rhizosphere | 76.76 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 7.94 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_3610923 | 2162886007 | Bacteria | 6168 |
| 2 | JGI24740J21852_10001947 | 3300001979 | Bacteria | 9449 |
| 3 | JGI24737J22298_10103610 | 3300001990 | Unclassified | 843 |
| 4 | JGI25154J39366_1000120 | 3300002738 | Bacteria | 63261 |
| 5 | JGI25158J39367_1012501 | 3300002739 | Bacteria | 1118 |
| 6 | JGI25157J39369_1003740 | 3300002741 | Bacteria | 2996 |
| 7 | JGI25153J46596_10000422 | 3300003215 | Bacteria | 27612 |
| 8 | rootH1_10065058 | 3300003316 | Bacteria | 4253 |
| 9 | rootH2_10072495 | 3300003320 | Bacteria | 22377 |
| 10 | rootH2_10099657 | 3300003320 | Bacteria | 1509 |
| 11 | rootH2_10190555 | 3300003320 | Bacteria | 1946 |
| 12 | rootL2_10029350 | 3300003322 | Bacteria | 7086 |
| 13 | rootL2_10316123 | 3300003322 | Bacteria | 1091 |
| 14 | rootH1_10002423 | 3300003323 | Bacteria | 14823 |
| 15 | rootH1_10396000 | 3300003323 | Bacteria | 1466 |
| 16 | JGI25160J50197_1001631 | 3300003354 | Bacteria | 11008 |
| 17 | JGI25160J50197_1011238 | 3300003354 | Bacteria | 3185 |
| 18 | Ga0055535_1003734 | 3300003761 | Bacteria | 4098 |
| 19 | Ga0055542_1004597 | 3300003762 | Bacteria | 3306 |
| 20 | Ga0055528_1000265 | 3300003790 | Bacteria | 44369 |
| 21 | Ga0055530_10000655 | 3300003791 | Bacteria | 29639 |
| 22 | Ga0055531_10014870 | 3300003794 | Bacteria | 3475 |
| 23 | Ga0055543_1032645 | 3300004625 | Bacteria | 904 |
| 24 | Ga0065165_1000358 | 3300005262 | Bacteria | 75013 |
| 25 | Ga0065704_10073113 | 3300005289 | Bacteria | 7572 |
| 26 | Ga0065712_10261466 | 3300005290 | Bacteria | 936 |
| 27 | Ga0070658_10018958 | 3300005327 | Bacteria | 5512 |
| 28 | Ga0070658_10151646 | 3300005327 | Unclassified | 1941 |
| 29 | Ga0070676_10068512 | 3300005328 | Bacteria | 2124 |
| 30 | Ga0070683_100006814 | 3300005329 | Bacteria | 9600 |
| 31 | Ga0070683_100309834 | 3300005329 | Unclassified | 1502 |
| 32 | Ga0070670_100032939 | 3300005331 | Bacteria | 4465 |
| 33 | Ga0070670_100041306 | 3300005331 | Unclassified | 3965 |
| 34 | Ga0070670_100062625 | 3300005331 | Bacteria | 3193 |
| 35 | Ga0070670_100277470 | 3300005331 | Bacteria | 1463 |
| 36 | Ga0070670_100595117 | 3300005331 | Unclassified | 989 |
| 37 | Ga0070670_101757374 | 3300005331 | Bacteria | 571 |
| 38 | Ga0070682_100000005 | 3300005337 | Bacteria | 386439 |
| 39 | Ga0068868_100029098 | 3300005338 | Bacteria | 4230 |
| 40 | Ga0068868_100098391 | 3300005338 | Bacteria | 2365 |
| 41 | Ga0068868_100129508 | 3300005338 | Unclassified | 2064 |
| 42 | Ga0070660_100359503 | 3300005339 | Unclassified | 1200 |
| 43 | Ga0070661_100213236 | 3300005344 | Unclassified | 1479 |
| 44 | Ga0070668_100004850 | 3300005347 | Bacteria | 9964 |
| 45 | Ga0070674_100008123 | 3300005356 | Bacteria | 6225 |
| 46 | Ga0070674_101012317 | 3300005356 | Bacteria | 729 |
| 47 | Ga0070673_100006246 | 3300005364 | Bacteria | 7725 |
| 48 | Ga0070659_100717235 | 3300005366 | Bacteria | 866 |
| 49 | Ga0070667_100001526 | 3300005367 | Bacteria | 20725 |
| 50 | Ga0070667_100014795 | 3300005367 | Bacteria | 6446 |
| 51 | Ga0070678_100002885 | 3300005456 | Bacteria | 9515 |
| 52 | Ga0070662_100551709 | 3300005457 | Bacteria | 966 |
| 53 | Ga0068867_100015179 | 3300005459 | Bacteria | 5463 |
| 54 | Ga0068867_100660406 | 3300005459 | Bacteria | 918 |
| 55 | Ga0070685_10204454 | 3300005466 | Bacteria | 1285 |
| 56 | Ga0070706_100931072 | 3300005467 | Unclassified | 802 |
| 57 | Ga0070679_100673923 | 3300005530 | Unclassified | 977 |
| 58 | Ga0070684_100003131 | 3300005535 | Bacteria | 12344 |
| 59 | Ga0068853_100006785 | 3300005539 | Bacteria | 9126 |
| 60 | Ga0070672_100039346 | 3300005543 | Unclassified | 3621 |
| 61 | Ga0070665_100021234 | 3300005548 | Bacteria | 6528 |
| 62 | Ga0070665_100022763 | 3300005548 | Bacteria | 6308 |
| 63 | Ga0068855_102342979 | 3300005563 | Bacteria | 534 |
| 64 | Ga0070664_100017491 | 3300005564 | Bacteria | 5887 |
| 65 | Ga0068857_100023699 | 3300005577 | Bacteria | 5404 |
| 66 | Ga0068854_100037198 | 3300005578 | Bacteria | 3415 |
| 67 | Ga0068854_100853371 | 3300005578 | Unclassified | 797 |
| 68 | Ga0068856_101362063 | 3300005614 | Bacteria | 724 |
| 69 | Ga0070702_100117687 | 3300005615 | Unclassified | 1658 |
| 70 | Ga0068852_100011047 | 3300005616 | Bacteria | 6778 |
| 71 | Ga0068852_100692071 | 3300005616 | Bacteria | 1029 |
| 72 | Ga0068852_100942887 | 3300005616 | Bacteria | 881 |
| 73 | Ga0068852_102028684 | 3300005616 | Unclassified | 597 |
| 74 | Ga0068859_100011263 | 3300005617 | Bacteria | 8999 |
| 75 | Ga0068859_100245036 | 3300005617 | Unclassified | 1882 |
| 76 | Ga0068866_10013528 | 3300005718 | Bacteria | 3583 |
| 77 | Ga0068866_10081266 | 3300005718 | Bacteria | 1740 |
| 78 | Ga0068861_100070804 | 3300005719 | Bacteria | 2701 |
| 79 | Ga0068861_100128151 | 3300005719 | Bacteria | 2056 |
| 80 | Ga0068861_100304787 | 3300005719 | Bacteria | 1381 |
| 81 | Ga0068851_10003573 | 3300005834 | Bacteria | 6925 |
| 82 | Ga0068870_10012475 | 3300005840 | Bacteria | 3973 |
| 83 | Ga0068863_100217854 | 3300005841 | Bacteria | 1838 |
| 84 | Ga0068860_100006905 | 3300005843 | Bacteria | 11383 |
| 85 | Ga0068860_100473360 | 3300005843 | Bacteria | 1248 |
| 86 | Ga0068860_100994793 | 3300005843 | Unclassified | 856 |
| 87 | Ga0068862_100152614 | 3300005844 | Bacteria | 2057 |
| 88 | Ga0068862_100929871 | 3300005844 | Bacteria | 856 |
| 89 | Ga0075366_10026135 | 3300006195 | Bacteria | 3418 |
| 90 | Ga0075366_10148069 | 3300006195 | Bacteria | 1421 |
| 91 | Ga0097621_100094414 | 3300006237 | Bacteria | 2508 |
| 92 | Ga0068871_100018344 | 3300006358 | Bacteria | 5315 |
| 93 | Ga0068871_100181046 | 3300006358 | Bacteria | 1811 |
| 94 | Ga0075431_100013446 | 3300006847 | Bacteria | 8267 |
| 95 | Ga0097620_100011263 | 3300006931 | Bacteria | 8999 |
| 96 | Ga0097620_100245047 | 3300006931 | Unclassified | 1882 |
| 97 | Ga0105240_10127038 | 3300009093 | Bacteria | 3062 |
| 98 | Ga0111539_10033493 | 3300009094 | Bacteria | 6237 |
| 99 | Ga0111539_10687291 | 3300009094 | Bacteria | 1191 |
| 100 | Ga0105245_10147615 | 3300009098 | Bacteria | 2220 |
| 101 | Ga0105245_10308399 | 3300009098 | Bacteria | 1555 |
| 102 | Ga0105247_10340959 | 3300009101 | Bacteria | 1051 |
| 103 | Ga0114129_10018475 | 3300009147 | Bacteria | 9930 |
| 104 | Ga0105242_10086023 | 3300009176 | Bacteria | 2637 |
| 105 | Ga0105242_10276808 | 3300009176 | Unclassified | 1522 |
| 106 | Ga0105242_10330544 | 3300009176 | Unclassified | 1401 |
| 107 | Ga0105237_10020646 | 3300009545 | Bacteria | 6785 |
| 108 | Ga0105237_10543453 | 3300009545 | Bacteria | 1168 |
| 109 | Ga0105238_11128726 | 3300009551 | Bacteria | 807 |
| 110 | Ga0105249_10173535 | 3300009553 | Bacteria | 2092 |
| 111 | Ga0105239_10006591 | 3300010375 | Bacteria | 13447 |
| 112 | Ga0105239_10142996 | 3300010375 | Bacteria | 2667 |
| 113 | Ga0105239_10208786 | 3300010375 | Bacteria | 2188 |
| 114 | Ga0105246_10014849 | 3300011119 | Bacteria | 4906 |
| 115 | Ga0157373_10147460 | 3300013100 | Bacteria | 1655 |
| 116 | Ga0157371_10059406 | 3300013102 | Bacteria | 2710 |
| 117 | Ga0157371_10249182 | 3300013102 | Bacteria | 1278 |
| 118 | Ga0157370_10145464 | 3300013104 | Bacteria | 2207 |
| 119 | Ga0157370_10228186 | 3300013104 | Unclassified | 1724 |
| 120 | Ga0157374_10074926 | 3300013296 | Unclassified | 3197 |
| 121 | Ga0157374_10260974 | 3300013296 | Unclassified | 1706 |
| 122 | Ga0157374_10298438 | 3300013296 | Bacteria | 1594 |
| 123 | Ga0157378_10007680 | 3300013297 | Bacteria | 9410 |
| 124 | Ga0157378_10068606 | 3300013297 | Bacteria | 3180 |
| 125 | Ga0157372_10101387 | 3300013307 | Bacteria | 3286 |
| 126 | Ga0157372_10174278 | 3300013307 | Bacteria | 2489 |
| 127 | Ga0157372_10218084 | 3300013307 | Bacteria | 2211 |
| 128 | Ga0157372_10227334 | 3300013307 | Bacteria | 2163 |
| 129 | Ga0157372_10668995 | 3300013307 | Bacteria | 1209 |
| 130 | Ga0157375_10019980 | 3300013308 | Bacteria | 6108 |
| 131 | Ga0157375_11024613 | 3300013308 | Bacteria | 964 |
| 132 | Ga0157375_12073041 | 3300013308 | Unclassified | 677 |
| 133 | Ga0163163_10043941 | 3300014325 | Bacteria | 4382 |
| 134 | Ga0157377_10022208 | 3300014745 | Bacteria | 3347 |
| 135 | Ga0157379_10237763 | 3300014968 | Bacteria | 1652 |
| 136 | Ga0209436_103986 | 3300025208 | Bacteria | 3739 |
| 137 | Ga0209258_100032 | 3300025242 | Bacteria | 452764 |
| 138 | Ga0209646_1000050 | 3300025246 | Bacteria | 296599 |
| 139 | Ga0209026_1000452 | 3300025250 | Bacteria | 32703 |
| 140 | Ga0209148_1000223 | 3300025254 | Bacteria | 93490 |
| 141 | Ga0209673_1000042 | 3300025273 | Bacteria | 300704 |
| 142 | Ga0209130_1001696 | 3300025284 | Bacteria | 13322 |
| 143 | Ga0209675_1037632 | 3300025291 | Bacteria | 1085 |
| 144 | Ga0209564_1028614 | 3300025295 | Bacteria | 1776 |
| 145 | Ga0209758_1027512 | 3300025297 | Bacteria | 2427 |
| 146 | Ga0209050_1000295 | 3300025298 | Bacteria | 104889 |
| 147 | Ga0207426_1000660 | 3300025302 | Bacteria | 42245 |
| 148 | Ga0207426_1000711 | 3300025302 | Bacteria | 38972 |
| 149 | Ga0207426_1002632 | 3300025302 | Bacteria | 11101 |
| 150 | Ga0207426_1013950 | 3300025302 | Bacteria | 2961 |
| 151 | Ga0209257_1000128 | 3300025304 | Bacteria | 214268 |
| 152 | Ga0207642_10009339 | 3300025899 | Bacteria | 3408 |
| 153 | Ga0207642_10088579 | 3300025899 | Bacteria | 1523 |
| 154 | Ga0207710_10384297 | 3300025900 | Unclassified | 719 |
| 155 | Ga0207688_10036549 | 3300025901 | Bacteria | 2722 |
| 156 | Ga0207647_10007550 | 3300025904 | Bacteria | 7844 |
| 157 | Ga0207645_10002126 | 3300025907 | Bacteria | 15860 |
| 158 | Ga0207643_10004467 | 3300025908 | Bacteria | 7518 |
| 159 | Ga0207705_10285263 | 3300025909 | Bacteria | 1264 |
| 160 | Ga0207705_10300657 | 3300025909 | Unclassified | 1231 |
| 161 | Ga0207654_10208996 | 3300025911 | Unclassified | 1289 |
| 162 | Ga0207695_10015588 | 3300025913 | Bacteria | 8940 |
| 163 | Ga0207671_10001129 | 3300025914 | Bacteria | 32133 |
| 164 | Ga0207671_10102665 | 3300025914 | Bacteria | 2167 |
| 165 | Ga0207660_10305071 | 3300025917 | Unclassified | 1268 |
| 166 | Ga0207649_10108579 | 3300025920 | Unclassified | 1850 |
| 167 | Ga0207652_10730504 | 3300025921 | Unclassified | 882 |
| 168 | Ga0207681_10085963 | 3300025923 | Bacteria | 2233 |
| 169 | Ga0207650_10001228 | 3300025925 | Bacteria | 18739 |
| 170 | Ga0207650_10045458 | 3300025925 | Bacteria | 3230 |
| 171 | Ga0207650_10066200 | 3300025925 | Unclassified | 2709 |
| 172 | Ga0207650_10101410 | 3300025925 | Bacteria | 2216 |
| 173 | Ga0207650_10323171 | 3300025925 | Bacteria | 1264 |
| 174 | Ga0207659_10053090 | 3300025926 | Bacteria | 2890 |
| 175 | Ga0207687_10179944 | 3300025927 | Bacteria | 1637 |
| 176 | Ga0207690_10194876 | 3300025932 | Bacteria | 1535 |
| 177 | Ga0207686_10164773 | 3300025934 | Bacteria | 1557 |
| 178 | Ga0207686_10268647 | 3300025934 | Unclassified | 1254 |
| 179 | Ga0207669_10004979 | 3300025937 | Bacteria | 5910 |
| 180 | Ga0207669_10244739 | 3300025937 | Bacteria | 1331 |
| 181 | Ga0207704_10036390 | 3300025938 | Bacteria | 2832 |
| 182 | Ga0207691_10002936 | 3300025940 | Bacteria | 16636 |
| 183 | Ga0207691_10049700 | 3300025940 | Unclassified | 3842 |
| 184 | Ga0207689_10001010 | 3300025942 | Bacteria | 27038 |
| 185 | Ga0207689_10010642 | 3300025942 | Bacteria | 7917 |
| 186 | Ga0207661_10012555 | 3300025944 | Bacteria | 6161 |
| 187 | Ga0207661_10314733 | 3300025944 | Unclassified | 1406 |
| 188 | Ga0207679_10119746 | 3300025945 | Unclassified | 2093 |
| 189 | Ga0207651_10164456 | 3300025960 | Bacteria | 1743 |
| 190 | Ga0207651_10733192 | 3300025960 | Bacteria | 872 |
| 191 | Ga0207651_10927719 | 3300025960 | Bacteria | 776 |
| 192 | Ga0207712_10023143 | 3300025961 | Bacteria | 4097 |
| 193 | Ga0207668_10012948 | 3300025972 | Bacteria | 5124 |
| 194 | Ga0207640_10125507 | 3300025981 | Bacteria | 1847 |
| 195 | Ga0207658_10981864 | 3300025986 | Bacteria | 770 |
| 196 | Ga0207677_10002608 | 3300026023 | Bacteria | 9484 |
| 197 | Ga0207677_10064920 | 3300026023 | Unclassified | 2545 |
| 198 | Ga0207677_10643218 | 3300026023 | Bacteria | 935 |
| 199 | Ga0207703_12153036 | 3300026035 | Bacteria | 534 |
| 200 | Ga0207639_10180791 | 3300026041 | Bacteria | 1794 |
| 201 | Ga0207639_10429440 | 3300026041 | Bacteria | 1196 |
| 202 | Ga0207708_11005862 | 3300026075 | Bacteria | 724 |
| 203 | Ga0207702_11956251 | 3300026078 | Bacteria | 577 |
| 204 | Ga0207641_10008719 | 3300026088 | Bacteria | 8377 |
| 205 | Ga0207641_10635331 | 3300026088 | Bacteria | 1048 |
| 206 | Ga0207648_10001709 | 3300026089 | Bacteria | 24030 |
| 207 | Ga0207648_10083368 | 3300026089 | Bacteria | 2788 |
| 208 | Ga0207676_10028232 | 3300026095 | Bacteria | 4190 |
| 209 | Ga0207674_10029729 | 3300026116 | Bacteria | 5750 |
| 210 | Ga0207675_100019273 | 3300026118 | Bacteria | 6364 |
| 211 | Ga0207675_100183365 | 3300026118 | Bacteria | 2005 |
| 212 | Ga0207675_100192395 | 3300026118 | Bacteria | 1957 |
| 213 | Ga0207683_10808797 | 3300026121 | Archaea | 870 |
| 214 | Ga0207698_11206307 | 3300026142 | Unclassified | 771 |
| 215 | Ga0268266_10014957 | 3300028379 | Bacteria | 6662 |
| 216 | Ga0268266_10164744 | 3300028379 | Bacteria | 2007 |
| 217 | Ga0268265_10558504 | 3300028380 | Bacteria | 1088 |
| 218 | Ga0268265_10637050 | 3300028380 | Bacteria | 1023 |
| 219 | Ga0268264_10003067 | 3300028381 | Bacteria | 14469 |
| 220 | Ga0268264_10527559 | 3300028381 | Bacteria | 1155 |
| 221 | Ga0307517_10284854 | 3300028786 | Bacteria | 939 |
| 222 | Ga0265327_10031108 | 3300031251 | Bacteria | 3005 |
| 223 | Ga0307405_10208831 | 3300031731 | Bacteria | 1424 |
| 224 | Ga0307405_10809796 | 3300031731 | Bacteria | 785 |
| 225 | Ga0316577_10243439 | 3300031733 | Bacteria | 1017 |
| 226 | Ga0307413_10216277 | 3300031824 | Bacteria | 1396 |
| 227 | Ga0307410_10192084 | 3300031852 | Bacteria | 1553 |
| 228 | Ga0307412_10202271 | 3300031911 | Bacteria | 1509 |
| 229 | Ga0307409_100236796 | 3300031995 | Bacteria | 1659 |
| 230 | Ga0307510_10000401 | 3300033180 | Bacteria | 41063 |
| 231 | Ga0316574_0294233 | 3300035398 | Bacteria | 1033 |
| 232 | Ga0316584_0060826 | 3300036712 | Bacteria | 2829 |
| 233 | Ga0395900_0171549 | 3300037418 | Bacteria | 2208 |
| 234 | Ga0395905_0011381 | 3300037471 | Bacteria | 8595 |
| 235 | Ga0395905_0169084 | 3300037471 | Bacteria | 2053 |
| 236 | Ga0395901_0298076 | 3300038443 | Bacteria | 1672 |
| 237 | Ga0439465_0058971 | 3300041413 | Unclassified | 1269 |
| 238 | Ga0451795_0332560 | 3300041456 | Bacteria | 643 |
| 239 | Ga0451807_2269776 | 3300041486 | Unclassified | 776 |
| 240 | Ga0451843_0036126 | 3300041509 | Bacteria | 609 |
| 241 | Ga0439431_0002637 | 3300041997 | Bacteria | 3951 |
| 242 | Ga0439445_0003527 | 3300042004 | Bacteria | 3509 |
| 243 | Ga0439449_0053517 | 3300042007 | Bacteria | 1492 |
| 244 | Ga0439457_018940 | 3300042014 | Bacteria | 1529 |
| 245 | Ga0451577_0000240 | 3300042876 | Bacteria | 108418 |
| 246 | Ga0466972_0021809 | 3300044658 | Bacteria | 3191 |
| 247 | Ga0453683_0169822 | 3300044673 | Bacteria | 1381 |
| 248 | Ga0453683_0328621 | 3300044673 | Bacteria | 980 |
| 249 | Ga0453683_0568043 | 3300044673 | Bacteria | 738 |
| 250 | Ga0466965_0023426 | 3300044683 | Bacteria | 2982 |
| 251 | Ga0466961_0203425 | 3300044693 | Unclassified | 1224 |
| 252 | Ga0453684_0029937 | 3300044712 | Bacteria | 7709 |
| 253 | Ga0453684_0255441 | 3300044712 | Bacteria | 2010 |
| 254 | Ga0453684_0448624 | 3300044712 | Bacteria | 1436 |
| 255 | Ga0453684_1208332 | 3300044712 | Bacteria | 793 |
| 256 | Ga0466968_0080160 | 3300044735 | Bacteria | 1433 |
| 257 | Ga0466959_0004513 | 3300045049 | Bacteria | 9333 |
| 258 | Ga0495627_004119 | 3300046453 | Bacteria | 6176 |
| 259 | Ga0495633_0001243 | 3300046558 | Bacteria | 20376 |
| 260 | Ga0495668_0041672 | 3300046616 | Bacteria | 2557 |
| 261 | Ga0495625_0325970 | 3300046660 | Bacteria | 977 |
| 262 | Ga0495625_0526534 | 3300046660 | Bacteria | 719 |
| 263 | Ga0496101_0022413 | 3300048904 | Bacteria | 4348 |
| 264 | Ga0496121_0000051 | 3300048924 | Bacteria | 315378 |
| 265 | Ga0496126_0005896 | 3300048929 | Bacteria | 13821 |
| 266 | Ga0501032_0022312 | 3300049569 | Bacteria | 4389 |
| 267 | Ga0501033_0145643 | 3300049570 | Bacteria | 1711 |
| 268 | Ga0501033_0413207 | 3300049570 | Bacteria | 940 |
| 269 | Ga0501034_0142183 | 3300049571 | Unclassified | 2378 |
| 270 | Ga0501036_0023942 | 3300049572 | Bacteria | 5147 |
| 271 | Ga0501037_0039451 | 3300049573 | Bacteria | 3476 |
| 272 | Ga0501037_0201019 | 3300049573 | Bacteria | 1408 |
| 273 | Ga0501038_0037041 | 3300049574 | Unclassified | 4279 |
| 274 | Ga0501039_0059426 | 3300049575 | Bacteria | 2961 |
| 275 | Ga0501043_0010068 | 3300049579 | Bacteria | 7413 |
| 276 | Ga0501046_0046484 | 3300049580 | Unclassified | 3445 |
| 277 | Ga0501047_0091505 | 3300049581 | Bacteria | 2920 |
| 278 | Ga0501047_0239840 | 3300049581 | Unclassified | 1664 |
| 279 | Ga0501072_0315053 | 3300049588 | Bacteria | 1243 |
| 280 | Ga0501202_000577 | 3300049652 | Bacteria | 5338 |
| 281 | Ga0501223_007291 | 3300049663 | Bacteria | 2266 |
| 282 | Ga0501227_083259 | 3300049665 | Bacteria | 840 |
| 283 | Ga0501239_017944 | 3300049672 | Bacteria | 846 |
| 284 | Ga0501251_005113 | 3300049681 | Bacteria | 1380 |
| 285 | Ga0501259_002651 | 3300049688 | Unclassified | 2880 |
| 286 | Ga0501219_000126 | 3300049703 | Bacteria | 13435 |
| 287 | Ga0501221_044813 | 3300049704 | Bacteria | 978 |
| 288 | Ga0501225_0015487 | 3300049705 | Bacteria | 2122 |
| 289 | Ga0501241_000783 | 3300049758 | Bacteria | 6723 |
| 290 | Ga0501241_003146 | 3300049758 | Bacteria | 3143 |
| 291 | Ga0501263_062256 | 3300049760 | Bacteria | 587 |
| 292 | Ga0501266_017521 | 3300049763 | Bacteria | 958 |
| 293 | Ga0501268_003163 | 3300049765 | Bacteria | 2233 |
| 294 | Ga0501280_012414 | 3300049776 | Bacteria | 1197 |
| 295 | Ga0501035_0041746 | 3300049822 | Bacteria | 4141 |
| 296 | Ga0501044_0293803 | 3300049823 | Bacteria | 1556 |
| 297 | Ga0501044_0299283 | 3300049823 | Bacteria | 1538 |
| 298 | Ga0501044_1091568 | 3300049823 | Bacteria | 667 |
| 299 | Ga0501212_014533 | 3300049851 | Bacteria | 1166 |
| 300 | Ga0501284_00005 | 3300050005 | Bacteria | 164758 |
| 301 | nmdc:mga0k408_182275_c1 | 3300050493 | Bacteria | 1252 |
| 302 | nmdc:mga05p37_88667_c1 | 3300050507 | Bacteria | 3812 |
| 303 | nmdc:mga06r32_208939_c1 | 3300050510 | Bacteria | 1940 |
| 304 | nmdc:mga06r32_580415_c1 | 3300050510 | Bacteria | 1093 |
| 305 | nmdc:mga08y16_213176_c1 | 3300050511 | Unclassified | 2000 |
| 306 | Ga0500644_0000032 | 3300053088 | Bacteria | 85851 |
| 307 | Ga0500646_0001105 | 3300053090 | Bacteria | 7328 |
| 308 | Ga0500651_0155053 | 3300053093 | Bacteria | 1373 |
| 309 | Ga0500651_0190057 | 3300053093 | Bacteria | 1216 |
| 310 | Ga0500566_0135851 | 3300053094 | Bacteria | 1310 |
| 311 | Ga0500557_096078 | 3300053105 | Bacteria | 983 |
| 312 | Ga0500569_000364 | 3300053109 | Bacteria | 7349 |
| 313 | Ga0500607_025592 | 3300053121 | Bacteria | 3283 |
| 314 | Ga0500658_0141745 | 3300053134 | Bacteria | 1078 |
| 315 | Ga0500559_0048529 | 3300053136 | Bacteria | 1867 |
| 316 | Ga0500559_0269560 | 3300053136 | Bacteria | 801 |
| 317 | Ga0500561_0011464 | 3300053137 | Bacteria | 1864 |
| 318 | Ga0500568_0016742 | 3300053139 | Bacteria | 3249 |
| 319 | Ga0500577_0006784 | 3300053142 | Bacteria | 3177 |
| 320 | Ga0500590_024983 | 3300053148 | Bacteria | 3102 |
| 321 | Ga0500616_0147583 | 3300053153 | Bacteria | 1092 |
| 322 | Ga0500622_0000093 | 3300053156 | Bacteria | 92537 |
| 323 | Ga0500622_0001270 | 3300053156 | Bacteria | 20604 |
| 324 | Ga0500633_0026298 | 3300053160 | Bacteria | 1830 |
| 325 | Ga0500634_0137496 | 3300053161 | Bacteria | 1162 |
| 326 | Ga0500636_0009300 | 3300053177 | Bacteria | 5706 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300044712 | Ga0453684_0448624 | Ga0453684_0448624_660_1139 | 146 |
| 2 | 3300005329 | Ga0070683_100309834 | Ga0070683_1003098342 | 147 |
| 3 | 3300005467 | Ga0070706_100931072 | Ga0070706_1009310721 | 147 |
| 4 | 3300005616 | Ga0068852_100692071 | Ga0068852_1006920711 | 147 |
| 5 | 3300013307 | Ga0157372_10101387 | Ga0157372_101013874 | 147 |
| 6 | 3300013307 | Ga0157372_10227334 | Ga0157372_102273342 | 147 |
| 7 | 3300013307 | Ga0157372_10668995 | Ga0157372_106689952 | 147 |
| 8 | 3300025944 | Ga0207661_10314733 | Ga0207661_103147332 | 147 |
| 9 | 3300025960 | Ga0207651_10927719 | Ga0207651_109277191 | 147 |
| 10 | 3300026075 | Ga0207708_11005862 | Ga0207708_110058621 | 147 |
| 11 | 3300031731 | Ga0307405_10208831 | Ga0307405_102088311 | 147 |
| 12 | 3300031824 | Ga0307413_10216277 | Ga0307413_102162772 | 147 |
| 13 | 3300037418 | Ga0395900_0171549 | Ga0395900_0171549_1399_1878 | 147 |
| 14 | 3300037471 | Ga0395905_0011381 | Ga0395905_0011381_3967_4446 | 147 |
| 15 | 3300037471 | Ga0395905_0169084 | Ga0395905_0169084_280_759 | 147 |
| 16 | 3300038443 | Ga0395901_0298076 | Ga0395901_0298076_77_556 | 147 |
| 17 | 3300049681 | Ga0501251_005113 | Ga0501251_005113_47_622 | 148 |
| 18 | 3300013102 | Ga0157371_10249182 | Ga0157371_102491822 | 150 |
| 19 | 3300049763 | Ga0501266_017521 | Ga0501266_017521_448_927 | 150 |
| 20 | 3300003320 | rootH2_10190555 | rootH2_101905552 | 151 |
| 21 | 3300009101 | Ga0105247_10340959 | Ga0105247_103409592 | 151 |
| 22 | 3300025900 | Ga0207710_10384297 | Ga0207710_103842971 | 151 |
| 23 | 3300031731 | Ga0307405_10809796 | Ga0307405_108097962 | 151 |
| 24 | 3300031852 | Ga0307410_10192084 | Ga0307410_101920841 | 151 |
| 25 | 3300031911 | Ga0307412_10202271 | Ga0307412_102022711 | 151 |
| 26 | 3300031995 | Ga0307409_100236796 | Ga0307409_1002367961 | 151 |
| 27 | 3300049652 | Ga0501202_000577 | Ga0501202_000577_2885_3364 | 151 |
| 28 | 3300049663 | Ga0501223_007291 | Ga0501223_007291_1138_1617 | 151 |
| 29 | 3300049665 | Ga0501227_083259 | Ga0501227_083259_79_558 | 151 |
| 30 | 3300049672 | Ga0501239_017944 | Ga0501239_017944_150_725 | 151 |
| 31 | 3300049688 | Ga0501259_002651 | Ga0501259_002651_1168_1743 | 151 |
| 32 | 3300049704 | Ga0501221_044813 | Ga0501221_044813_179_658 | 151 |
| 33 | 3300049765 | Ga0501268_003163 | Ga0501268_003163_1590_2165 | 151 |
| 34 | 3300049776 | Ga0501280_012414 | Ga0501280_012414_520_999 | 151 |
| 35 | 3300049851 | Ga0501212_014533 | Ga0501212_014533_113_592 | 151 |
| 36 | iso_pu_bacteria | 2818991442 | 2819577302 | 156 |
| 37 | iso_pu_bacteria | 2818991460 | 2819676451 | 156 |
| 38 | iso_pu_bacteria | 2821136567 | 2821140605 | 156 |
| 39 | iso_pu_bacteria | 2840677318 | 2840678295 | 156 |
| 40 | iso_pu_bacteria | 2883068021 | 2883071220 | 156 |
| 41 | iso_pu_bacteria | 2884791551 | 2884796282 | 156 |
| 42 | iso_pu_bacteria | 2896085136 | 2896086112 | 156 |
| 43 | iso_pu_bacteria | 2896109856 | 2896115321 | 156 |
| 44 | iso_pu_bacteria | 2904467357 | 2904473024 | 156 |
| 45 | iso_pu_bacteria | 2929177148 | 2929178200 | 156 |
| 46 | iso_pu_bacteria | 2929921140 | 2929922349 | 156 |
| 47 | iso_pu_bacteria | 2945977869 | 2945980562 | 156 |
| 48 | iso_pu_bacteria | 2946013367 | 2946013575 | 156 |
| 49 | iso_pu_bacteria | 8003151029 | 8003156767 | 156 |
| 50 | 3300009147 | Ga0114129_10018475 | Ga0114129_100184758 | 157 |
| 51 | 3300046660 | Ga0495625_0325970 | Ga0495625_0325970_48_530 | 157 |
| 52 | 3300005548 | Ga0070665_100021234 | Ga0070665_1000212343 | 158 |
| 53 | 3300005563 | Ga0068855_102342979 | Ga0068855_1023429791 | 158 |
| 54 | 3300005578 | Ga0068854_100037198 | Ga0068854_1000371983 | 158 |
| 55 | 3300005616 | Ga0068852_102028684 | Ga0068852_1020286841 | 158 |
| 56 | 3300009093 | Ga0105240_10127038 | Ga0105240_101270382 | 158 |
| 57 | 3300009094 | Ga0111539_10687291 | Ga0111539_106872911 | 158 |
| 58 | 3300009545 | Ga0105237_10543453 | Ga0105237_105434532 | 158 |
| 59 | 3300010375 | Ga0105239_10208786 | Ga0105239_102087861 | 158 |
| 60 | 3300025904 | Ga0207647_10007550 | Ga0207647_100075506 | 158 |
| 61 | 3300025913 | Ga0207695_10015588 | Ga0207695_1001558810 | 158 |
| 62 | 3300025914 | Ga0207671_10001129 | Ga0207671_100011295 | 158 |
| 63 | 3300025914 | Ga0207671_10102665 | Ga0207671_101026655 | 158 |
| 64 | 3300025981 | Ga0207640_10125507 | Ga0207640_101255072 | 158 |
| 65 | 3300026089 | Ga0207648_10083368 | Ga0207648_100833682 | 158 |
| 66 | 3300028379 | Ga0268266_10014957 | Ga0268266_100149578 | 158 |
| 67 | 3300028786 | Ga0307517_10284854 | Ga0307517_102848541 | 158 |
| 68 | 3300046616 | Ga0495668_0041672 | Ga0495668_0041672_313_789 | 158 |
| 69 | 3300049570 | Ga0501033_0413207 | Ga0501033_0413207_152_628 | 158 |
| 70 | 3300049703 | Ga0501219_000126 | Ga0501219_000126_3641_4117 | 158 |
| 71 | 3300049705 | Ga0501225_0015487 | Ga0501225_0015487_1264_1740 | 158 |
| 72 | 3300049758 | Ga0501241_003146 | Ga0501241_003146_2640_3116 | 158 |
| 73 | 3300049822 | Ga0501035_0041746 | Ga0501035_0041746_1071_1547 | 158 |
| 74 | 3300050005 | Ga0501284_00005 | Ga0501284_00005_29477_29953 | 158 |
| 75 | 3300053094 | Ga0500566_0135851 | Ga0500566_0135851_332_808 | 158 |
| 76 | 3300003322 | rootL2_10316123 | rootL2_103161232 | 159 |
| 77 | 3300003323 | rootH1_10396000 | rootH1_103960003 | 159 |
| 78 | 3300005290 | Ga0065712_10261466 | Ga0065712_102614662 | 159 |
| 79 | 3300005327 | Ga0070658_10151646 | Ga0070658_101516463 | 159 |
| 80 | 3300005328 | Ga0070676_10068512 | Ga0070676_100685121 | 159 |
| 81 | 3300005329 | Ga0070683_100006814 | Ga0070683_1000068145 | 159 |
| 82 | 3300005331 | Ga0070670_100032939 | Ga0070670_1000329393 | 159 |
| 83 | 3300005331 | Ga0070670_100041306 | Ga0070670_1000413064 | 159 |
| 84 | 3300005331 | Ga0070670_100062625 | Ga0070670_1000626252 | 159 |
| 85 | 3300005331 | Ga0070670_100277470 | Ga0070670_1002774702 | 159 |
| 86 | 3300005331 | Ga0070670_100595117 | Ga0070670_1005951172 | 159 |
| 87 | 3300005331 | Ga0070670_101757374 | Ga0070670_1017573741 | 159 |
| 88 | 3300005337 | Ga0070682_100000005 | Ga0070682_100000005106 | 159 |
| 89 | 3300005338 | Ga0068868_100029098 | Ga0068868_1000290983 | 159 |
| 90 | 3300005338 | Ga0068868_100098391 | Ga0068868_1000983912 | 159 |
| 91 | 3300005338 | Ga0068868_100129508 | Ga0068868_1001295083 | 159 |
| 92 | 3300005339 | Ga0070660_100359503 | Ga0070660_1003595032 | 159 |
| 93 | 3300005344 | Ga0070661_100213236 | Ga0070661_1002132363 | 159 |
| 94 | 3300005347 | Ga0070668_100004850 | Ga0070668_1000048509 | 159 |
| 95 | 3300005356 | Ga0070674_100008123 | Ga0070674_1000081233 | 159 |
| 96 | 3300005356 | Ga0070674_101012317 | Ga0070674_1010123171 | 159 |
| 97 | 3300005364 | Ga0070673_100006246 | Ga0070673_1000062467 | 159 |
| 98 | 3300005367 | Ga0070667_100001526 | Ga0070667_1000015269 | 159 |
| 99 | 3300005367 | Ga0070667_100014795 | Ga0070667_1000147952 | 159 |
| 100 | 3300005456 | Ga0070678_100002885 | Ga0070678_1000028852 | 159 |
| 101 | 3300005457 | Ga0070662_100551709 | Ga0070662_1005517091 | 159 |
| 102 | 3300005459 | Ga0068867_100015179 | Ga0068867_1000151792 | 159 |
| 103 | 3300005459 | Ga0068867_100660406 | Ga0068867_1006604062 | 159 |
| 104 | 3300005466 | Ga0070685_10204454 | Ga0070685_102044541 | 159 |
| 105 | 3300005530 | Ga0070679_100673923 | Ga0070679_1006739232 | 159 |
| 106 | 3300005535 | Ga0070684_100003131 | Ga0070684_1000031318 | 159 |
| 107 | 3300005539 | Ga0068853_100006785 | Ga0068853_1000067859 | 159 |
| 108 | 3300005543 | Ga0070672_100039346 | Ga0070672_1000393464 | 159 |
| 109 | 3300005548 | Ga0070665_100022763 | Ga0070665_1000227634 | 159 |
| 110 | 3300005564 | Ga0070664_100017491 | Ga0070664_1000174913 | 159 |
| 111 | 3300005578 | Ga0068854_100853371 | Ga0068854_1008533712 | 159 |
| 112 | 3300005614 | Ga0068856_101362063 | Ga0068856_1013620632 | 159 |
| 113 | 3300005615 | Ga0070702_100117687 | Ga0070702_1001176873 | 159 |
| 114 | 3300005616 | Ga0068852_100011047 | Ga0068852_1000110472 | 159 |
| 115 | 3300005616 | Ga0068852_100942887 | Ga0068852_1009428872 | 159 |
| 116 | 3300005617 | Ga0068859_100011263 | Ga0068859_1000112634 | 159 |
| 117 | 3300005617 | Ga0068859_100245036 | Ga0068859_1002450362 | 159 |
| 118 | 3300005718 | Ga0068866_10013528 | Ga0068866_100135283 | 159 |
| 119 | 3300005718 | Ga0068866_10081266 | Ga0068866_100812662 | 159 |
| 120 | 3300005719 | Ga0068861_100070804 | Ga0068861_1000708043 | 159 |
| 121 | 3300005719 | Ga0068861_100128151 | Ga0068861_1001281512 | 159 |
| 122 | 3300005719 | Ga0068861_100304787 | Ga0068861_1003047872 | 159 |
| 123 | 3300005834 | Ga0068851_10003573 | Ga0068851_100035732 | 159 |
| 124 | 3300005840 | Ga0068870_10012475 | Ga0068870_100124754 | 159 |
| 125 | 3300005841 | Ga0068863_100217854 | Ga0068863_1002178541 | 159 |
| 126 | 3300005843 | Ga0068860_100006905 | Ga0068860_1000069054 | 159 |
| 127 | 3300005843 | Ga0068860_100473360 | Ga0068860_1004733602 | 159 |
| 128 | 3300005843 | Ga0068860_100994793 | Ga0068860_1009947931 | 159 |
| 129 | 3300005844 | Ga0068862_100152614 | Ga0068862_1001526142 | 159 |
| 130 | 3300005844 | Ga0068862_100929871 | Ga0068862_1009298712 | 159 |
| 131 | 3300006237 | Ga0097621_100094414 | Ga0097621_1000944143 | 159 |
| 132 | 3300006358 | Ga0068871_100018344 | Ga0068871_1000183444 | 159 |
| 133 | 3300006358 | Ga0068871_100181046 | Ga0068871_1001810462 | 159 |
| 134 | 3300006847 | Ga0075431_100013446 | Ga0075431_1000134462 | 159 |
| 135 | 3300006931 | Ga0097620_100011263 | Ga0097620_1000112634 | 159 |
| 136 | 3300006931 | Ga0097620_100245047 | Ga0097620_1002450473 | 159 |
| 137 | 3300009094 | Ga0111539_10033493 | Ga0111539_100334935 | 159 |
| 138 | 3300009098 | Ga0105245_10147615 | Ga0105245_101476152 | 159 |
| 139 | 3300009176 | Ga0105242_10086023 | Ga0105242_100860232 | 159 |
| 140 | 3300009176 | Ga0105242_10276808 | Ga0105242_102768082 | 159 |
| 141 | 3300009176 | Ga0105242_10330544 | Ga0105242_103305442 | 159 |
| 142 | 3300009551 | Ga0105238_11128726 | Ga0105238_111287261 | 159 |
| 143 | 3300009553 | Ga0105249_10173535 | Ga0105249_101735353 | 159 |
| 144 | 3300011119 | Ga0105246_10014849 | Ga0105246_100148492 | 159 |
| 145 | 3300013104 | Ga0157370_10228186 | Ga0157370_102281862 | 159 |
| 146 | 3300013296 | Ga0157374_10074926 | Ga0157374_100749262 | 159 |
| 147 | 3300013296 | Ga0157374_10260974 | Ga0157374_102609742 | 159 |
| 148 | 3300013296 | Ga0157374_10298438 | Ga0157374_102984382 | 159 |
| 149 | 3300013297 | Ga0157378_10007680 | Ga0157378_100076802 | 159 |
| 150 | 3300013297 | Ga0157378_10068606 | Ga0157378_100686061 | 159 |
| 151 | 3300013307 | Ga0157372_10218084 | Ga0157372_102180843 | 159 |
| 152 | 3300013308 | Ga0157375_10019980 | Ga0157375_100199805 | 159 |
| 153 | 3300013308 | Ga0157375_11024613 | Ga0157375_110246132 | 159 |
| 154 | 3300013308 | Ga0157375_12073041 | Ga0157375_120730412 | 159 |
| 155 | 3300014325 | Ga0163163_10043941 | Ga0163163_100439413 | 159 |
| 156 | 3300014745 | Ga0157377_10022208 | Ga0157377_100222083 | 159 |
| 157 | 3300014968 | Ga0157379_10237763 | Ga0157379_102377632 | 159 |
| 158 | 3300025899 | Ga0207642_10009339 | Ga0207642_100093394 | 159 |
| 159 | 3300025899 | Ga0207642_10088579 | Ga0207642_100885792 | 159 |
| 160 | 3300025901 | Ga0207688_10036549 | Ga0207688_100365494 | 159 |
| 161 | 3300025907 | Ga0207645_10002126 | Ga0207645_100021262 | 159 |
| 162 | 3300025908 | Ga0207643_10004467 | Ga0207643_100044677 | 159 |
| 163 | 3300025909 | Ga0207705_10300657 | Ga0207705_103006572 | 159 |
| 164 | 3300025911 | Ga0207654_10208996 | Ga0207654_102089962 | 159 |
| 165 | 3300025917 | Ga0207660_10305071 | Ga0207660_103050712 | 159 |
| 166 | 3300025920 | Ga0207649_10108579 | Ga0207649_101085793 | 159 |
| 167 | 3300025921 | Ga0207652_10730504 | Ga0207652_107305041 | 159 |
| 168 | 3300025923 | Ga0207681_10085963 | Ga0207681_100859632 | 159 |
| 169 | 3300025925 | Ga0207650_10001228 | Ga0207650_1000122810 | 159 |
| 170 | 3300025925 | Ga0207650_10045458 | Ga0207650_100454583 | 159 |
| 171 | 3300025925 | Ga0207650_10066200 | Ga0207650_100662002 | 159 |
| 172 | 3300025925 | Ga0207650_10101410 | Ga0207650_101014102 | 159 |
| 173 | 3300025925 | Ga0207650_10323171 | Ga0207650_103231712 | 159 |
| 174 | 3300025926 | Ga0207659_10053090 | Ga0207659_100530901 | 159 |
| 175 | 3300025927 | Ga0207687_10179944 | Ga0207687_101799441 | 159 |
| 176 | 3300025934 | Ga0207686_10164773 | Ga0207686_101647732 | 159 |
| 177 | 3300025934 | Ga0207686_10268647 | Ga0207686_102686472 | 159 |
| 178 | 3300025937 | Ga0207669_10004979 | Ga0207669_100049793 | 159 |
| 179 | 3300025937 | Ga0207669_10244739 | Ga0207669_102447392 | 159 |
| 180 | 3300025938 | Ga0207704_10036390 | Ga0207704_100363904 | 159 |
| 181 | 3300025940 | Ga0207691_10002936 | Ga0207691_1000293613 | 159 |
| 182 | 3300025940 | Ga0207691_10049700 | Ga0207691_100497004 | 159 |
| 183 | 3300025942 | Ga0207689_10001010 | Ga0207689_1000101028 | 159 |
| 184 | 3300025942 | Ga0207689_10010642 | Ga0207689_100106424 | 159 |
| 185 | 3300025944 | Ga0207661_10012555 | Ga0207661_100125553 | 159 |
| 186 | 3300025945 | Ga0207679_10119746 | Ga0207679_101197463 | 159 |
| 187 | 3300025960 | Ga0207651_10164456 | Ga0207651_101644562 | 159 |
| 188 | 3300025960 | Ga0207651_10733192 | Ga0207651_107331922 | 159 |
| 189 | 3300025961 | Ga0207712_10023143 | Ga0207712_100231433 | 159 |
| 190 | 3300025972 | Ga0207668_10012948 | Ga0207668_100129483 | 159 |
| 191 | 3300025986 | Ga0207658_10981864 | Ga0207658_109818641 | 159 |
| 192 | 3300026023 | Ga0207677_10002608 | Ga0207677_100026083 | 159 |
| 193 | 3300026023 | Ga0207677_10064920 | Ga0207677_100649202 | 159 |
| 194 | 3300026023 | Ga0207677_10643218 | Ga0207677_106432182 | 159 |
| 195 | 3300026035 | Ga0207703_12153036 | Ga0207703_121530361 | 159 |
| 196 | 3300026041 | Ga0207639_10180791 | Ga0207639_101807912 | 159 |
| 197 | 3300026041 | Ga0207639_10429440 | Ga0207639_104294402 | 159 |
| 198 | 3300026078 | Ga0207702_11956251 | Ga0207702_119562511 | 159 |
| 199 | 3300026088 | Ga0207641_10008719 | Ga0207641_100087194 | 159 |
| 200 | 3300026088 | Ga0207641_10635331 | Ga0207641_106353311 | 159 |
| 201 | 3300026089 | Ga0207648_10001709 | Ga0207648_100017092 | 159 |
| 202 | 3300026095 | Ga0207676_10028232 | Ga0207676_100282322 | 159 |
| 203 | 3300026118 | Ga0207675_100019273 | Ga0207675_1000192737 | 159 |
| 204 | 3300026118 | Ga0207675_100183365 | Ga0207675_1001833653 | 159 |
| 205 | 3300026118 | Ga0207675_100192395 | Ga0207675_1001923952 | 159 |
| 206 | 3300026121 | Ga0207683_10808797 | Ga0207683_108087971 | 159 |
| 207 | 3300026142 | Ga0207698_11206307 | Ga0207698_112063072 | 159 |
| 208 | 3300028379 | Ga0268266_10164744 | Ga0268266_101647441 | 159 |
| 209 | 3300028380 | Ga0268265_10558504 | Ga0268265_105585042 | 159 |
| 210 | 3300028380 | Ga0268265_10637050 | Ga0268265_106370501 | 159 |
| 211 | 3300028381 | Ga0268264_10003067 | Ga0268264_100030674 | 159 |
| 212 | 3300028381 | Ga0268264_10527559 | Ga0268264_105275592 | 159 |
| 213 | 3300031251 | Ga0265327_10031108 | Ga0265327_100311083 | 159 |
| 214 | 3300031733 | Ga0316577_10243439 | Ga0316577_102434392 | 159 |
| 215 | 3300033180 | Ga0307510_10000401 | Ga0307510_1000040130 | 159 |
| 216 | 3300035398 | Ga0316574_0294233 | Ga0316574_0294233_537_1016 | 159 |
| 217 | 3300036712 | Ga0316584_0060826 | Ga0316584_0060826_511_990 | 159 |
| 218 | 3300041413 | Ga0439465_0058971 | Ga0439465_0058971_78_557 | 159 |
| 219 | 3300041456 | Ga0451795_0332560 | Ga0451795_0332560_97_576 | 159 |
| 220 | 3300041486 | Ga0451807_2269776 | Ga0451807_2269776_230_715 | 159 |
| 221 | 3300041509 | Ga0451843_0036126 | Ga0451843_0036126_50_532 | 159 |
| 222 | 3300044673 | Ga0453683_0169822 | Ga0453683_0169822_457_945 | 159 |
| 223 | 3300044673 | Ga0453683_0328621 | Ga0453683_0328621_222_710 | 159 |
| 224 | 3300044673 | Ga0453683_0568043 | Ga0453683_0568043_113_601 | 159 |
| 225 | 3300044712 | Ga0453684_0029937 | Ga0453684_0029937_3471_3965 | 159 |
| 226 | 3300044712 | Ga0453684_0255441 | Ga0453684_0255441_1118_1606 | 159 |
| 227 | 3300044712 | Ga0453684_1208332 | Ga0453684_1208332_292_777 | 159 |
| 228 | 3300049760 | Ga0501263_062256 | Ga0501263_062256_32_511 | 159 |
| 229 | 3300050507 | nmdc:mga05p37_88667_c1 | nmdc:mga05p37_88667_c1_3274_3759 | 159 |
| 230 | 3300050510 | nmdc:mga06r32_208939_c1 | nmdc:mga06r32_208939_c1_837_1334 | 159 |
| 231 | 3300050510 | nmdc:mga06r32_580415_c1 | nmdc:mga06r32_580415_c1_457_951 | 159 |
| 232 | 3300050511 | nmdc:mga08y16_213176_c1 | nmdc:mga08y16_213176_c1_122_601 | 159 |
| 233 | 3300053088 | Ga0500644_0000032 | Ga0500644_0000032_55720_56199 | 159 |
| 234 | 3300053090 | Ga0500646_0001105 | Ga0500646_0001105_2581_3060 | 159 |
| 235 | 3300053093 | Ga0500651_0190057 | Ga0500651_0190057_438_917 | 159 |
| 236 | 3300053109 | Ga0500569_000364 | Ga0500569_000364_2821_3300 | 159 |
| 237 | 3300053134 | Ga0500658_0141745 | Ga0500658_0141745_387_866 | 159 |
| 238 | 3300053136 | Ga0500559_0048529 | Ga0500559_0048529_647_1126 | 159 |
| 239 | 3300053136 | Ga0500559_0269560 | Ga0500559_0269560_34_513 | 159 |
| 240 | 3300053137 | Ga0500561_0011464 | Ga0500561_0011464_913_1392 | 159 |
| 241 | 3300053142 | Ga0500577_0006784 | Ga0500577_0006784_342_821 | 159 |
| 242 | 3300053148 | Ga0500590_024983 | Ga0500590_024983_1099_1578 | 159 |
| 243 | 3300053153 | Ga0500616_0147583 | Ga0500616_0147583_502_984 | 159 |
| 244 | 3300053156 | Ga0500622_0001270 | Ga0500622_0001270_17328_17807 | 159 |
| 245 | 3300053160 | Ga0500633_0026298 | Ga0500633_0026298_537_1016 | 159 |
| 246 | 3300053161 | Ga0500634_0137496 | Ga0500634_0137496_473_952 | 159 |
| 247 | 3300053177 | Ga0500636_0009300 | Ga0500636_0009300_2610_3089 | 159 |
| 248 | 2162886007 | SwRhRL2b_contig_3610923 | SwRhRL2b_0749.00000850 | 160 |
| 249 | 3300001979 | JGI24740J21852_10001947 | JGI24740J21852_100019479 | 160 |
| 250 | 3300001990 | JGI24737J22298_10103610 | JGI24737J22298_101036102 | 160 |
| 251 | 3300002738 | JGI25154J39366_1000120 | JGI25154J39366_100012028 | 160 |
| 252 | 3300002739 | JGI25158J39367_1012501 | JGI25158J39367_10125012 | 160 |
| 253 | 3300002741 | JGI25157J39369_1003740 | JGI25157J39369_10037403 | 160 |
| 254 | 3300003215 | JGI25153J46596_10000422 | JGI25153J46596_100004225 | 160 |
| 255 | 3300003316 | rootH1_10065058 | rootH1_100650585 | 160 |
| 256 | 3300003320 | rootH2_10072495 | rootH2_1007249517 | 160 |
| 257 | 3300003320 | rootH2_10099657 | rootH2_100996572 | 160 |
| 258 | 3300003322 | rootL2_10029350 | rootL2_100293504 | 160 |
| 259 | 3300003323 | rootH1_10002423 | rootH1_100024235 | 160 |
| 260 | 3300003354 | JGI25160J50197_1001631 | JGI25160J50197_10016315 | 160 |
| 261 | 3300003354 | JGI25160J50197_1011238 | JGI25160J50197_10112383 | 160 |
| 262 | 3300003761 | Ga0055535_1003734 | Ga0055535_10037343 | 160 |
| 263 | 3300003762 | Ga0055542_1004597 | Ga0055542_10045972 | 160 |
| 264 | 3300003790 | Ga0055528_1000265 | Ga0055528_100026528 | 160 |
| 265 | 3300003791 | Ga0055530_10000655 | Ga0055530_1000065514 | 160 |
| 266 | 3300003794 | Ga0055531_10014870 | Ga0055531_100148703 | 160 |
| 267 | 3300004625 | Ga0055543_1032645 | Ga0055543_10326452 | 160 |
| 268 | 3300005262 | Ga0065165_1000358 | Ga0065165_100035811 | 160 |
| 269 | 3300005289 | Ga0065704_10073113 | Ga0065704_100731136 | 160 |
| 270 | 3300005327 | Ga0070658_10018958 | Ga0070658_100189585 | 160 |
| 271 | 3300005366 | Ga0070659_100717235 | Ga0070659_1007172352 | 160 |
| 272 | 3300005577 | Ga0068857_100023699 | Ga0068857_1000236992 | 160 |
| 273 | 3300006195 | Ga0075366_10026135 | Ga0075366_100261353 | 160 |
| 274 | 3300006195 | Ga0075366_10148069 | Ga0075366_101480692 | 160 |
| 275 | 3300009098 | Ga0105245_10308399 | Ga0105245_103083992 | 160 |
| 276 | 3300009545 | Ga0105237_10020646 | Ga0105237_100206464 | 160 |
| 277 | 3300010375 | Ga0105239_10006591 | Ga0105239_100065915 | 160 |
| 278 | 3300010375 | Ga0105239_10142996 | Ga0105239_101429962 | 160 |
| 279 | 3300013100 | Ga0157373_10147460 | Ga0157373_101474602 | 160 |
| 280 | 3300013102 | Ga0157371_10059406 | Ga0157371_100594062 | 160 |
| 281 | 3300013104 | Ga0157370_10145464 | Ga0157370_101454642 | 160 |
| 282 | 3300013307 | Ga0157372_10174278 | Ga0157372_101742783 | 160 |
| 283 | 3300025208 | Ga0209436_103986 | Ga0209436_1039863 | 160 |
| 284 | 3300025242 | Ga0209258_100032 | Ga0209258_10003299 | 160 |
| 285 | 3300025246 | Ga0209646_1000050 | Ga0209646_100005028 | 160 |
| 286 | 3300025250 | Ga0209026_1000452 | Ga0209026_100045223 | 160 |
| 287 | 3300025254 | Ga0209148_1000223 | Ga0209148_100022327 | 160 |
| 288 | 3300025273 | Ga0209673_1000042 | Ga0209673_1000042185 | 160 |
| 289 | 3300025284 | Ga0209130_1001696 | Ga0209130_10016969 | 160 |
| 290 | 3300025291 | Ga0209675_1037632 | Ga0209675_10376321 | 160 |
| 291 | 3300025295 | Ga0209564_1028614 | Ga0209564_10286142 | 160 |
| 292 | 3300025297 | Ga0209758_1027512 | Ga0209758_10275123 | 160 |
| 293 | 3300025298 | Ga0209050_1000295 | Ga0209050_100029529 | 160 |
| 294 | 3300025302 | Ga0207426_1000660 | Ga0207426_100066024 | 160 |
| 295 | 3300025302 | Ga0207426_1000711 | Ga0207426_100071123 | 160 |
| 296 | 3300025302 | Ga0207426_1002632 | Ga0207426_10026323 | 160 |
| 297 | 3300025302 | Ga0207426_1013950 | Ga0207426_10139501 | 160 |
| 298 | 3300025304 | Ga0209257_1000128 | Ga0209257_1000128150 | 160 |
| 299 | 3300025909 | Ga0207705_10285263 | Ga0207705_102852632 | 160 |
| 300 | 3300025932 | Ga0207690_10194876 | Ga0207690_101948762 | 160 |
| 301 | 3300026116 | Ga0207674_10029729 | Ga0207674_100297296 | 160 |
| 302 | 3300041997 | Ga0439431_0002637 | Ga0439431_0002637_2458_2940 | 160 |
| 303 | 3300042004 | Ga0439445_0003527 | Ga0439445_0003527_1588_2070 | 160 |
| 304 | 3300042007 | Ga0439449_0053517 | Ga0439449_0053517_140_631 | 160 |
| 305 | 3300042014 | Ga0439457_018940 | Ga0439457_018940_963_1445 | 160 |
| 306 | 3300042876 | Ga0451577_0000240 | Ga0451577_0000240_74079_74561 | 160 |
| 307 | 3300044658 | Ga0466972_0021809 | Ga0466972_0021809_1330_1818 | 160 |
| 308 | 3300044683 | Ga0466965_0023426 | Ga0466965_0023426_2441_2932 | 160 |
| 309 | 3300044693 | Ga0466961_0203425 | Ga0466961_0203425_433_921 | 160 |
| 310 | 3300044735 | Ga0466968_0080160 | Ga0466968_0080160_563_1051 | 160 |
| 311 | 3300045049 | Ga0466959_0004513 | Ga0466959_0004513_3933_4454 | 160 |
| 312 | 3300046453 | Ga0495627_004119 | Ga0495627_004119_3887_4369 | 160 |
| 313 | 3300046558 | Ga0495633_0001243 | Ga0495633_0001243_7628_8110 | 160 |
| 314 | 3300046660 | Ga0495625_0526534 | Ga0495625_0526534_50_535 | 160 |
| 315 | 3300048904 | Ga0496101_0022413 | Ga0496101_0022413_3803_4285 | 160 |
| 316 | 3300048924 | Ga0496121_0000051 | Ga0496121_0000051_27707_28189 | 160 |
| 317 | 3300048929 | Ga0496126_0005896 | Ga0496126_0005896_1514_1996 | 160 |
| 318 | 3300049569 | Ga0501032_0022312 | Ga0501032_0022312_73_588 | 160 |
| 319 | 3300049570 | Ga0501033_0145643 | Ga0501033_0145643_23_511 | 160 |
| 320 | 3300049571 | Ga0501034_0142183 | Ga0501034_0142183_331_846 | 160 |
| 321 | 3300049572 | Ga0501036_0023942 | Ga0501036_0023942_230_745 | 160 |
| 322 | 3300049573 | Ga0501037_0039451 | Ga0501037_0039451_538_1053 | 160 |
| 323 | 3300049573 | Ga0501037_0201019 | Ga0501037_0201019_662_1144 | 160 |
| 324 | 3300049574 | Ga0501038_0037041 | Ga0501038_0037041_1812_2327 | 160 |
| 325 | 3300049575 | Ga0501039_0059426 | Ga0501039_0059426_2060_2575 | 160 |
| 326 | 3300049579 | Ga0501043_0010068 | Ga0501043_0010068_4154_4669 | 160 |
| 327 | 3300049580 | Ga0501046_0046484 | Ga0501046_0046484_1782_2297 | 160 |
| 328 | 3300049581 | Ga0501047_0091505 | Ga0501047_0091505_1646_2128 | 160 |
| 329 | 3300049581 | Ga0501047_0239840 | Ga0501047_0239840_1044_1559 | 160 |
| 330 | 3300049588 | Ga0501072_0315053 | Ga0501072_0315053_240_755 | 160 |
| 331 | 3300049758 | Ga0501241_000783 | Ga0501241_000783_1906_2388 | 160 |
| 332 | 3300049823 | Ga0501044_0293803 | Ga0501044_0293803_119_607 | 160 |
| 333 | 3300049823 | Ga0501044_0299283 | Ga0501044_0299283_268_750 | 160 |
| 334 | 3300049823 | Ga0501044_1091568 | Ga0501044_1091568_73_588 | 160 |
| 335 | 3300050493 | nmdc:mga0k408_182275_c1 | nmdc:mga0k408_182275_c1_435_917 | 160 |
| 336 | 3300053093 | Ga0500651_0155053 | Ga0500651_0155053_290_772 | 160 |
| 337 | 3300053105 | Ga0500557_096078 | Ga0500557_096078_240_725 | 160 |
| 338 | 3300053121 | Ga0500607_025592 | Ga0500607_025592_2670_3161 | 160 |
| 339 | 3300053139 | Ga0500568_0016742 | Ga0500568_0016742_1140_1625 | 160 |
| 340 | 3300053156 | Ga0500622_0000093 | Ga0500622_0000093_86895_87377 | 160 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5iwx-assembly1.cif.gz_B | crystal structure of 2-c-methyl-d-erythritol 2,4-cyclodiphosphate synthase from bacillus subtitis | 0.9792 | 3 | 160 |
| 5iwx-assembly1.cif.gz_B | crystal structure of 2-c-methyl-d-erythritol 2,4-cyclodiphosphate synthase from bacillus subtitis | 0.9728 | 3 | 160 |
| 3iew-assembly1.cif.gz_A | crystal structure of 2c-methyl-d-erythritol 2,4-cyclodiphosphate synthase from burkholderia pseudomallei with bound ctp and cdp | 0.9661 | 4 | 160 |
| 5l12-assembly1.cif.gz_A | crystal structure of 2c-methyl-d-erythritol 2,4-clycodiphosphate synthase from burkholderia pseudomallei double mutant | 0.965 | 3 | 159 |
| 3k2x-assembly1.cif.gz_A | crystal structure of 2c-methyl-d-erythritol 2,4-cyclodiphosphate synthase from burkholderia pseudomallei in complex with 5'-iodo-cytosine | 0.9645 | 3 | 159 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_B6TL41_66_225_3.30.1330.50 | Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase | 0.9583 | 4 | 160 | 3.30.1330.50 |
| 1iv1B00 | Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase | 0.9439 | 5 | 157 | 3.30.1330.50 |
| 5b8fC00 | Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase | 0.9435 | 2 | 160 | 3.30.1330.50 |
| 1w55A02 | Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase | 0.9393 | 3 | 160 | 3.30.1330.50 |
| 3t80F00 | Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase | 0.9354 | 3 | 159 | 3.30.1330.50 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7C3YSD8-F1-model_v4 | 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase (MECDP-synthase) (MECPP-synthase) (MECPS) (EC 4.6.1.12) | 0.9778 | 5 | 160 |
GO:0008685
GO:0016114 GO:0019288 GO:0046872 |
| AF-A0A1N6K225-F1-model_v4 | 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase (MECDP-synthase) (MECPP-synthase) (MECPS) (EC 4.6.1.12) | 0.9732 | 1 | 160 |
GO:0008685
GO:0016114 GO:0019288 GO:0046872 |
| AF-A0A1G3QRJ1-F1-model_v4 | 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase (MECDP-synthase) (MECPP-synthase) (MECPS) (EC 4.6.1.12) | 0.9718 | 3 | 159 |
GO:0008685
GO:0016114 GO:0019288 GO:0046872 |
| AF-A0A1F2RZ30-F1-model_v4 | 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase (MECDP-synthase) (MECPP-synthase) (MECPS) (EC 4.6.1.12) | 0.9716 | 2 | 160 |
GO:0008685
GO:0016114 GO:0019288 GO:0046872 |
| AF-Q1IVA8-F1-model_v4 | 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase (MECDP-synthase) (MECPP-synthase) (MECPS) (EC 4.6.1.12) | 0.971 | 3 | 160 |
GO:0008685
GO:0016114 GO:0019288 GO:0046872 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar