F414423

General Info

Members Datasets Scaffolds Average Seq Length
340 217 680 311

Family's Representative Sequence

Representative Sequence 3300037471|Ga0395905_0235082|Ga0395905_0235082_464_1519
Length 351
Sequence VPSFRRGFSGGTIDCARPLEGPSSDDGLRPVVAPPAGIIERVRYVDILEAIGQTPLVGLRAMSPKPAVRLWGKLEGQNPSGSLKDRIAKQMIEAALASGELTPEKTILEPTSGNTGIALAMVARRMGYRLTVVIPDNASEERIRLLELFGAEIVYSPADKGTNGSIEVARALARDDRYYMPFQYGNPANPLAHYEGTGPEIVRDLPEVTHFVAGLGTGGTLTGVGRRLHEHDPAIKVIAAEPELGEMVYGLRSLDEGFIPPIFDESVLDRKFLVNSSDSLRATRELTEKEGIFAGISSGAVVSVAQRIAAEIERGDIVCLLPDGGWKYLSTEAWAAELERAEKSVSETLWW

Samples

Sample ID Description Type Environment
1 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
2 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
3 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
6 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
7 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
8 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
9 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
10 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
11 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
12 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
13 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
14 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
15 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
16 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
17 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
18 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
19 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
20 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
21 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
22 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
23 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
24 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
25 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
26 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
27 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
28 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
29 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
30 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
31 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
32 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
33 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
34 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
35 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
36 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
37 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
38 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
39 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
40 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
41 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
42 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
43 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
44 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
45 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
46 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
47 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
48 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
49 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
50 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
51 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
52 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
53 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
54 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
55 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
57 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
58 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
59 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
60 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
61 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
62 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
63 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
64 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
65 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
66 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
67 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
68 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
69 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
70 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
103 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
105 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
106 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
107 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
108 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
109 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
110 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
111 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
112 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
113 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
114 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
115 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
116 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
117 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
118 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
119 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
120 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
121 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
122 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
123 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
124 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
125 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
126 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
127 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
128 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
129 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
130 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
131 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
132 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
133 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
134 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
135 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
136 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
137 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
138 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
139 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
140 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
141 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
142 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
143 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
144 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
145 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
146 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
147 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
148 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
149 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
150 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
151 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
152 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
153 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
154 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
155 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
156 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
157 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
158 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
159 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
160 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
161 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
162 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
163 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
164 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
165 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
166 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
167 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
168 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
169 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
170 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
171 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
172 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
173 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
174 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
175 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
176 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
177 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
178 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
179 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
180 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
181 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
182 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
183 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
184 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
185 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
186 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
187 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
188 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
189 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
190 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
191 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
192 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
193 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
194 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
195 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
196 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
197 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
198 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
199 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
200 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
201 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
202 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
203 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
204 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
205 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
206 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
207 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
208 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
209 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
210 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
211 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
212 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
213 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
214 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
215 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
216 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
217 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.71
Metatranscriptomes 0.29
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.59
Nodule 0
Rhizoplane 7.35
Rhizosphere 90.88
Stem 0
Stem Tuber 0
Unclassified 0.59

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0395905_0235082 3300037471 Bacteria 1713
2 JGI24752J21851_1013286 3300001976 Bacteria 1075
3 JGI24751J29686_10000888 3300002459 Bacteria 6842
4 Ga0070683_100132422 3300005329 Bacteria 2360
5 Ga0068868_100067600 3300005338 Bacteria 2844
6 Ga0070692_10069338 3300005345 Bacteria 1876
7 Ga0070675_100253281 3300005354 Bacteria 1542
8 Ga0070675_100340814 3300005354 Bacteria 1328
9 Ga0070671_100015240 3300005355 Bacteria 6208
10 Ga0070688_100033731 3300005365 Bacteria 3096
11 Ga0070688_100037845 3300005365 Bacteria 2942
12 Ga0070667_100186892 3300005367 Bacteria 1834
13 Ga0070711_100055654 3300005439 Bacteria 2733
14 Ga0070700_100003512 3300005441 Bacteria 8081
15 Ga0070700_100231175 3300005441 Bacteria 1316
16 Ga0070694_100125598 3300005444 Bacteria 1846
17 Ga0070694_100347164 3300005444 Bacteria 1149
18 Ga0070708_100005680 3300005445 Bacteria 9897
19 Ga0070708_100181851 3300005445 Bacteria 1965
20 Ga0068867_100017344 3300005459 Bacteria 5114
21 Ga0070706_100046479 3300005467 Bacteria 4007
22 Ga0070698_100224186 3300005471 Bacteria 1813
23 Ga0070699_100012415 3300005518 Bacteria 7350
24 Ga0070699_100028876 3300005518 Bacteria 4781
25 Ga0070684_100006768 3300005535 Bacteria 8887
26 Ga0070697_100129733 3300005536 Bacteria 2114
27 Ga0070695_100230459 3300005545 Bacteria 1339
28 Ga0070696_100009921 3300005546 Bacteria 6372
29 Ga0070696_100012995 3300005546 Bacteria 5586
30 Ga0070696_100079409 3300005546 Bacteria 2321
31 Ga0070704_100047478 3300005549 Bacteria 3001
32 Ga0070704_100114753 3300005549 Bacteria 2056
33 Ga0068855_100215322 3300005563 Bacteria 2156
34 Ga0070664_100022889 3300005564 Bacteria 5155
35 Ga0068857_100065663 3300005577 Bacteria 3227
36 Ga0068864_100030514 3300005618 Bacteria 4570
37 Ga0068864_100110845 3300005618 Bacteria 2444
38 Ga0068866_10004018 3300005718 Bacteria 6046
39 Ga0068866_10023052 3300005718 Bacteria 2890
40 Ga0068861_100089778 3300005719 Bacteria 2422
41 Ga0068861_100119298 3300005719 Bacteria 2126
42 Ga0068870_10004615 3300005840 Bacteria 5943
43 Ga0068863_100027753 3300005841 Bacteria 5402
44 Ga0068858_100086968 3300005842 Bacteria 2907
45 Ga0068860_100100624 3300005843 Bacteria 2758
46 Ga0068862_100338058 3300005844 Bacteria 1394
47 Ga0081455_10004592 3300005937 Bacteria 15421
48 Ga0081538_10069431 3300005981 Bacteria 1952
49 Ga0075364_10131172 3300006051 Bacteria 1682
50 Ga0075432_10000437 3300006058 Bacteria 12246
51 Ga0070716_100013253 3300006173 Bacteria 4197
52 Ga0070712_100102775 3300006175 Bacteria 2117
53 Ga0070712_100262618 3300006175 Bacteria 1384
54 Ga0075427_10003448 3300006194 Bacteria 2179
55 Ga0097621_100122336 3300006237 Bacteria 2208
56 Ga0068871_100082161 3300006358 Bacteria 2671
57 Ga0075428_100037893 3300006844 Bacteria 5306
58 Ga0075430_100000232 3300006846 Bacteria 38628
59 Ga0075430_100089654 3300006846 Bacteria 2573
60 Ga0075431_100000621 3300006847 Bacteria 29956
61 Ga0075431_100091643 3300006847 Bacteria 3137
62 Ga0075431_100116672 3300006847 Bacteria 2755
63 Ga0075433_10053450 3300006852 Bacteria 3522
64 Ga0075434_100002205 3300006871 Bacteria 16978
65 Ga0075434_100081674 3300006871 Bacteria 3230
66 Ga0075434_100111080 3300006871 Bacteria 2752
67 Ga0075429_100002279 3300006880 Bacteria 16096
68 Ga0075429_100040930 3300006880 Bacteria 4034
69 Ga0068865_100083633 3300006881 Bacteria 2297
70 Ga0068865_100229515 3300006881 Bacteria 1455
71 Ga0105251_10003695 3300009011 Bacteria 10972
72 Ga0111539_10132293 3300009094 Bacteria 2921
73 Ga0111539_10843816 3300009094 Bacteria 1066
74 Ga0105245_10041344 3300009098 Bacteria 4109
75 Ga0105245_10108513 3300009098 Bacteria 2578
76 Ga0105245_10218714 3300009098 Bacteria 1837
77 Ga0105247_10064559 3300009101 Bacteria 2275
78 Ga0114129_10004034 3300009147 Bacteria 20730
79 Ga0114129_10029050 3300009147 Bacteria 7832
80 Ga0114129_10066711 3300009147 Bacteria 5019
81 Ga0114129_10144292 3300009147 Bacteria 3261
82 Ga0114129_10209032 3300009147 Bacteria 2639
83 Ga0114129_11056789 3300009147 Bacteria 1019
84 Ga0105243_10105205 3300009148 Bacteria 2350
85 Ga0105242_10007869 3300009176 Bacteria 8204
86 Ga0105242_10021063 3300009176 Bacteria 5115
87 Ga0105242_10079242 3300009176 Bacteria 2743
88 Ga0105248_10026725 3300009177 Bacteria 6418
89 Ga0105249_10073119 3300009553 Bacteria 3171
90 Ga0105246_10005587 3300011119 Bacteria 7669
91 Ga0105246_10016750 3300011119 Bacteria 4647
92 Ga0157378_10001770 3300013297 Bacteria 19392
93 Ga0157378_10012432 3300013297 Bacteria 7454
94 Ga0157378_10026810 3300013297 Bacteria 5081
95 Ga0163162_10158888 3300013306 Bacteria 2381
96 Ga0163162_10185114 3300013306 Bacteria 2209
97 Ga0157375_10018021 3300013308 Bacteria 6395
98 Ga0163163_10006162 3300014325 Bacteria 10454
99 Ga0163163_10257489 3300014325 Bacteria 1796
100 Ga0157380_10211973 3300014326 Bacteria 1727
101 Ga0157377_10132847 3300014745 Bacteria 1522
102 Ga0157379_10012107 3300014968 Bacteria 7533
103 Ga0157376_10516218 3300014969 Bacteria 1177
104 Ga0213876_10031229 3300021384 Bacteria 2811
105 Ga0213876_10142711 3300021384 Bacteria 1273
106 Ga0207713_1027771 3300025735 Bacteria 2564
107 Ga0207688_10110938 3300025901 Bacteria 1592
108 Ga0207647_10026259 3300025904 Bacteria 3813
109 Ga0207685_10000520 3300025905 Bacteria 6596
110 Ga0207643_10000529 3300025908 Bacteria 24514
111 Ga0207643_10046467 3300025908 Bacteria 2454
112 Ga0207693_10022833 3300025915 Bacteria 4967
113 Ga0207663_10019159 3300025916 Bacteria 3848
114 Ga0207660_10384703 3300025917 Bacteria 1128
115 Ga0207649_10091020 3300025920 Bacteria 1997
116 Ga0207681_10031010 3300025923 Bacteria 3489
117 Ga0207650_10021813 3300025925 Bacteria 4529
118 Ga0207650_10212298 3300025925 Bacteria 1554
119 Ga0207687_10211156 3300025927 Bacteria 1523
120 Ga0207644_10015739 3300025931 Bacteria 5082
121 Ga0207690_10012375 3300025932 Bacteria 5104
122 Ga0207686_10002897 3300025934 Bacteria 9246
123 Ga0207709_10005568 3300025935 Bacteria 7133
124 Ga0207709_10072692 3300025935 Bacteria 2188
125 Ga0207709_10232299 3300025935 Bacteria 1337
126 Ga0207669_10044222 3300025937 Bacteria 2615
127 Ga0207704_10020557 3300025938 Bacteria 3496
128 Ga0207704_10119653 3300025938 Bacteria 1799
129 Ga0207665_10076125 3300025939 Bacteria 2300
130 Ga0207689_10024362 3300025942 Bacteria 5078
131 Ga0207667_10369595 3300025949 Bacteria 1462
132 Ga0207712_10028056 3300025961 Bacteria 3764
133 Ga0207668_10159257 3300025972 Bacteria 1757
134 Ga0207677_10011223 3300026023 Bacteria 5099
135 Ga0207703_10067430 3300026035 Bacteria 2945
136 Ga0207708_10001392 3300026075 Bacteria 18169
137 Ga0207708_10109013 3300026075 Bacteria 2148
138 Ga0207641_10130048 3300026088 Bacteria 2260
139 Ga0207648_10003843 3300026089 Bacteria 15690
140 Ga0207648_10042667 3300026089 Bacteria 3982
141 Ga0207676_10131078 3300026095 Bacteria 2131
142 Ga0207676_10168548 3300026095 Bacteria 1905
143 Ga0207674_10001271 3300026116 Bacteria 32960
144 Ga0207675_100005740 3300026118 Bacteria 11873
145 Ga0207675_100207580 3300026118 Bacteria 1883
146 Ga0207683_10105596 3300026121 Bacteria 2518
147 Ga0207428_10002625 3300027907 Bacteria 17919
148 Ga0207428_10022221 3300027907 Bacteria 5356
149 Ga0268265_10412135 3300028380 Bacteria 1252
150 Ga0307515_10009322 3300028794 Bacteria 18990
151 Ga0316579_10117918 3300031691 Bacteria 1275
152 Ga0316576_10114294 3300031727 Bacteria 2025
153 Ga0316593_10011034 3300032168 Bacteria 2613
154 Ga0373926_0000252 3300035083 Bacteria 12887
155 Ga0373944_0000014 3300035089 Bacteria 32465
156 Ga0373944_0033650 3300035089 Bacteria 1554
157 Ga0373936_0000295 3300035113 Bacteria 16679
158 Ga0373945_0000027 3300035116 Bacteria 29851
159 Ga0373945_0046124 3300035116 Bacteria 1589
160 Ga0373943_0000464 3300035170 Bacteria 17230
161 Ga0373943_0029733 3300035170 Bacteria 2582
162 Ga0373946_0000184 3300035171 Bacteria 19247
163 Ga0373946_0170554 3300035171 Bacteria 1027
164 Ga0373962_0011947 3300035242 Bacteria 2183
165 Ga0373935_0000347 3300035692 Bacteria 23488
166 Ga0373927_0001023 3300035695 Bacteria 21274
167 Ga0373947_0000587 3300035725 Bacteria 21386
168 Ga0373947_0018745 3300035725 Bacteria 3985
169 Ga0373947_0138654 3300035725 Bacteria 1558
170 Ga0316584_0050012 3300036712 Bacteria 3125
171 Ga0373925_0002341 3300037068 Bacteria 15232
172 Ga0373925_0032879 3300037068 Bacteria 3820
173 Ga0373925_0044844 3300037068 Bacteria 3284
174 Ga0373925_0139705 3300037068 Bacteria 1895
175 Ga0395899_0002670 3300037312 Bacteria 14380
176 Ga0395899_0029520 3300037312 Bacteria 4125
177 Ga0395899_0032604 3300037312 Bacteria 3914
178 Ga0395899_0132480 3300037312 Bacteria 1779
179 Ga0395899_0157440 3300037312 Bacteria 1607
180 Ga0395900_0022677 3300037418 Bacteria 6425
181 Ga0395900_0043091 3300037418 Bacteria 4650
182 Ga0395898_0143555 3300037466 Bacteria 2285
183 Ga0395905_0007252 3300037471 Bacteria 11046
184 Ga0395905_0036204 3300037471 Bacteria 4634
185 Ga0395905_0075676 3300037471 Bacteria 3155
186 Ga0395905_0102483 3300037471 Bacteria 2687
187 Ga0395901_0147828 3300038443 Bacteria 2469
188 Ga0395901_0252666 3300038443 Bacteria 1836
189 Ga0395901_0474775 3300038443 Bacteria 1276
190 Ga0395901_0687277 3300038443 Bacteria 1022
191 Ga0436363_1694179 3300039450 Bacteria 2087
192 Ga0439461_0021480 3300041410 Bacteria 1287
193 Ga0439454_006507 3300042011 Bacteria 1439
194 Ga0439464_0001808 3300042439 Bacteria 5165
195 Ga0439460_0004850 3300042461 Bacteria 3287
196 Ga0466969_0000602 3300044656 Bacteria 19505
197 Ga0466966_0049118 3300044684 Bacteria 2688
198 Ga0466961_0000071 3300044693 Bacteria 62344
199 Ga0466970_0111657 3300044765 Bacteria 1493
200 Ga0466957_0036342 3300044842 Bacteria 2961
201 Ga0466957_0067323 3300044842 Bacteria 2209
202 Ga0466957_0172122 3300044842 Unclassified 1411
203 Ga0466959_0008821 3300045049 Bacteria 7145
204 Ga0466959_0041238 3300045049 Bacteria 3408
205 Ga0466958_0019626 3300045836 Unclassified 3935
206 Ga0466958_0039574 3300045836 Bacteria 2833
207 Ga0466967_0090608 3300045976 Bacteria 2778
208 Ga0495617_039984 3300046452 Bacteria 1569
209 Ga0495592_0064640 3300046454 Bacteria 2681
210 Ga0495603_0009004 3300046455 Bacteria 6038
211 Ga0495603_0016538 3300046455 Bacteria 4463
212 Ga0495603_0046594 3300046455 Bacteria 2583
213 Ga0495629_0004663 3300046459 Bacteria 10262
214 Ga0495641_0001892 3300046461 Bacteria 17140
215 Ga0495653_0052458 3300046463 Bacteria 3125
216 Ga0495580_0068976 3300046472 Bacteria 2471
217 Ga0495582_0000300 3300046473 Bacteria 27352
218 Ga0495582_0000994 3300046473 Bacteria 15876
219 Ga0495639_0000271 3300046475 Bacteria 25699
220 Ga0495639_0102638 3300046475 Bacteria 1352
221 Ga0495662_0005398 3300046476 Bacteria 6397
222 Ga0495662_0032127 3300046476 Bacteria 2536
223 Ga0495585_0035880 3300046492 Bacteria 2800
224 Ga0495594_0004082 3300046499 Bacteria 7505
225 Ga0495583_0094441 3300046506 Bacteria 1284
226 Ga0495608_0174090 3300046511 Bacteria 1364
227 Ga0495630_0002186 3300046517 Bacteria 13619
228 Ga0495630_0187680 3300046517 Bacteria 1577
229 Ga0495644_0029295 3300046523 Bacteria 2081
230 Ga0495666_0000343 3300046526 Bacteria 20377
231 Ga0495665_0000410 3300046531 Bacteria 21902
232 Ga0495665_0007556 3300046531 Bacteria 5887
233 Ga0495665_0080696 3300046531 Bacteria 1711
234 Ga0495640_0001746 3300046533 Bacteria 17198
235 Ga0495586_0001642 3300046535 Bacteria 12269
236 Ga0495598_0010885 3300046537 Bacteria 2191
237 Ga0495609_0089658 3300046538 Bacteria 1338
238 Ga0495609_0112101 3300046538 Bacteria 1177
239 Ga0495621_0005667 3300046539 Bacteria 3603
240 Ga0495633_0030475 3300046558 Bacteria 2620
241 Ga0495656_0026691 3300046615 Bacteria 2301
242 Ga0495656_0133308 3300046615 Bacteria 1184
243 Ga0495634_0004368 3300046642 Bacteria 11130
244 Ga0495634_0039203 3300046642 Bacteria 3227
245 Ga0495635_0000361 3300046663 Bacteria 28924
246 Ga0495635_0145023 3300046663 Bacteria 1617
247 Ga0495588_0000458 3300046674 Bacteria 20518
248 Ga0495647_0000094 3300046681 Bacteria 22211
249 Ga0495658_0000299 3300046683 Bacteria 28208
250 Ga0495658_0002230 3300046683 Bacteria 9796
251 Ga0495658_0239675 3300046683 Bacteria 1139
252 Ga0495669_0041662 3300046684 Bacteria 2040
253 Ga0495613_0001069 3300046689 Bacteria 20906
254 Ga0495613_0002159 3300046689 Bacteria 14909
255 Ga0495613_0092868 3300046689 Bacteria 2185
256 Ga0495624_0001682 3300046690 Bacteria 16951
257 Ga0495624_0108788 3300046690 Bacteria 1705
258 Ga0495670_0001700 3300046691 Bacteria 10816
259 Ga0495670_0103190 3300046691 Bacteria 1470
260 Ga0495670_0129010 3300046691 Bacteria 1317
261 Ga0495600_0157443 3300046809 Bacteria 1469
262 Ga0495581_0000129 3300047315 Bacteria 32807
263 Ga0495581_0002136 3300047315 Bacteria 11147
264 Ga0495581_0038932 3300047315 Bacteria 2753
265 Ga0495674_0002433 3300047319 Bacteria 18202
266 Ga0495676_0004854 3300047321 Bacteria 12335
267 Ga0495676_0008878 3300047321 Bacteria 9180
268 Ga0495676_0042405 3300047321 Bacteria 3736
269 Ga0495680_0003753 3300047322 Bacteria 14793
270 Ga0495679_057123 3300047446 Bacteria 1155
271 Ga0495684_0105759 3300047471 Bacteria 2126
272 Ga0495593_0001715 3300047673 Bacteria 12975
273 Ga0495614_0000582 3300048089 Bacteria 15202
274 Ga0495614_0003943 3300048089 Bacteria 6663
275 Ga0496100_0046794 3300048903 Bacteria 2784
276 Ga0496100_0060026 3300048903 Bacteria 2502
277 Ga0496101_0014217 3300048904 Bacteria 5347
278 Ga0496101_0112239 3300048904 Bacteria 2053
279 Ga0496102_0004827 3300048905 Bacteria 11399
280 Ga0496102_0058078 3300048905 Bacteria 3534
281 Ga0496103_0135110 3300048906 Bacteria 1576
282 Ga0496103_0233183 3300048906 Bacteria 1184
283 Ga0496104_0119680 3300048907 Bacteria 2528
284 Ga0496105_0021813 3300048908 Bacteria 5185
285 Ga0496106_0020220 3300048909 Bacteria 4939
286 Ga0496106_0122783 3300048909 Bacteria 2031
287 Ga0496107_0016623 3300048910 Bacteria 5169
288 Ga0496107_0025192 3300048910 Bacteria 4209
289 Ga0496108_0047650 3300048911 Bacteria 3582
290 Ga0496108_0184934 3300048911 Bacteria 1805
291 Ga0496109_0010486 3300048912 Bacteria 7917
292 Ga0496109_0060920 3300048912 Bacteria 3449
293 Ga0496109_0165908 3300048912 Bacteria 2070
294 Ga0496110_0010234 3300048913 Bacteria 7619
295 Ga0496110_0097347 3300048913 Bacteria 2636
296 Ga0496111_0004519 3300048914 Bacteria 8803
297 Ga0496112_0052515 3300048915 Bacteria 4000
298 Ga0496112_0134324 3300048915 Bacteria 2445
299 Ga0496114_0013738 3300048917 Bacteria 6491
300 Ga0501040_0151608 3300049576 Bacteria 1635
301 Ga0501040_0300519 3300049576 Bacteria 1147
302 Ga0501041_0126921 3300049577 Bacteria 1588
303 Ga0501042_0112117 3300049578 Bacteria 1964
304 Ga0501042_0220776 3300049578 Bacteria 1367
305 Ga0501070_0196613 3300049586 Bacteria 1656
306 Ga0501075_0002306 3300049591 Bacteria 12664
307 Ga0501075_0053708 3300049591 Bacteria 3030
308 Ga0501079_0210964 3300049741 Bacteria 1517
309 Ga0501080_0190428 3300049742 Bacteria 1885
310 Ga0501081_0242584 3300049743 Bacteria 1314
311 Ga0501083_0365286 3300049744 Bacteria 939
312 Ga0501044_0375258 3300049823 Bacteria 1338
313 Ga0501045_0008889 3300049824 Bacteria 7014
314 Ga0501045_0131177 3300049824 Bacteria 1863
315 nmdc:mga05p37_18576_c1 3300050507 Bacteria 8402
316 nmdc:mga05p37_25270_c1 3300050507 Bacteria 7223
317 nmdc:mga05p37_490801_c1 3300050507 Bacteria 1412
318 nmdc:mga05p37_7807_c1 3300050507 Bacteria 12632
319 nmdc:mga05p37_814654_c1 3300050507 Bacteria 1019
320 nmdc:mga09592_406464_c1 3300050508 Bacteria 1177
321 nmdc:mga09592_7275_c1 3300050508 Bacteria 8995
322 nmdc:mga0qj67_3898_c1 3300050509 Bacteria 10776
323 nmdc:mga06r32_144921_c1 3300050510 Bacteria 2353
324 nmdc:mga06r32_15562_c1 3300050510 Bacteria 6909
325 nmdc:mga06r32_8062_c1 3300050510 Bacteria 9478
326 nmdc:mga08y16_98788_c1 3300050511 Bacteria 3040
327 nmdc:mga0n895_78615_c1 3300050512 Bacteria 3283
328 nmdc:mga0a205_13974_c1 3300050515 Bacteria 7488
329 nmdc:mga0a205_148821_c1 3300050515 Bacteria 2241
330 nmdc:mga0a205_2969_c1 3300050515 Bacteria 15047
331 Ga0495601_0000902 3300053077 Bacteria 16197
332 Ga0495601_0011983 3300053077 Bacteria 5195
333 Ga0495595_0108497 3300053084 Bacteria 1344
334 Ga0495619_0000476 3300053085 Bacteria 26883
335 Ga0495619_0004562 3300053085 Bacteria 8850
336 Ga0495619_0301685 3300053085 Bacteria 1109
337 Ga0500642_0052099 3300053130 Bacteria 1811
338 Ga0501082_0097256 3300060353 Bacteria 2545
339 Ga0530510_0119003 3300061734 Bacteria 1938
340 Ga0530510_0249803 3300061734 Bacteria 1322
341 Ga0395905_0235082
342 JGI24752J21851_1013286
343 JGI24751J29686_10000888
344 Ga0070683_100132422
345 Ga0068868_100067600
346 Ga0070692_10069338
347 Ga0070675_100253281
348 Ga0070675_100340814
349 Ga0070671_100015240
350 Ga0070688_100033731
351 Ga0070688_100037845
352 Ga0070667_100186892
353 Ga0070711_100055654
354 Ga0070700_100003512
355 Ga0070700_100231175
356 Ga0070694_100125598
357 Ga0070694_100347164
358 Ga0070708_100005680
359 Ga0070708_100181851
360 Ga0068867_100017344
361 Ga0070706_100046479
362 Ga0070698_100224186
363 Ga0070699_100012415
364 Ga0070699_100028876
365 Ga0070684_100006768
366 Ga0070697_100129733
367 Ga0070695_100230459
368 Ga0070696_100009921
369 Ga0070696_100012995
370 Ga0070696_100079409
371 Ga0070704_100047478
372 Ga0070704_100114753
373 Ga0068855_100215322
374 Ga0070664_100022889
375 Ga0068857_100065663
376 Ga0068864_100030514
377 Ga0068864_100110845
378 Ga0068866_10004018
379 Ga0068866_10023052
380 Ga0068861_100089778
381 Ga0068861_100119298
382 Ga0068870_10004615
383 Ga0068863_100027753
384 Ga0068858_100086968
385 Ga0068860_100100624
386 Ga0068862_100338058
387 Ga0081455_10004592
388 Ga0081538_10069431
389 Ga0075364_10131172
390 Ga0075432_10000437
391 Ga0070716_100013253
392 Ga0070712_100102775
393 Ga0070712_100262618
394 Ga0075427_10003448
395 Ga0097621_100122336
396 Ga0068871_100082161
397 Ga0075428_100037893
398 Ga0075430_100000232
399 Ga0075430_100089654
400 Ga0075431_100000621
401 Ga0075431_100091643
402 Ga0075431_100116672
403 Ga0075433_10053450
404 Ga0075434_100002205
405 Ga0075434_100081674
406 Ga0075434_100111080
407 Ga0075429_100002279
408 Ga0075429_100040930
409 Ga0068865_100083633
410 Ga0068865_100229515
411 Ga0105251_10003695
412 Ga0111539_10132293
413 Ga0111539_10843816
414 Ga0105245_10041344
415 Ga0105245_10108513
416 Ga0105245_10218714
417 Ga0105247_10064559
418 Ga0114129_10004034
419 Ga0114129_10029050
420 Ga0114129_10066711
421 Ga0114129_10144292
422 Ga0114129_10209032
423 Ga0114129_11056789
424 Ga0105243_10105205
425 Ga0105242_10007869
426 Ga0105242_10021063
427 Ga0105242_10079242
428 Ga0105248_10026725
429 Ga0105249_10073119
430 Ga0105246_10005587
431 Ga0105246_10016750
432 Ga0157378_10001770
433 Ga0157378_10012432
434 Ga0157378_10026810
435 Ga0163162_10158888
436 Ga0163162_10185114
437 Ga0157375_10018021
438 Ga0163163_10006162
439 Ga0163163_10257489
440 Ga0157380_10211973
441 Ga0157377_10132847
442 Ga0157379_10012107
443 Ga0157376_10516218
444 Ga0213876_10031229
445 Ga0213876_10142711
446 Ga0207713_1027771
447 Ga0207688_10110938
448 Ga0207647_10026259
449 Ga0207685_10000520
450 Ga0207643_10000529
451 Ga0207643_10046467
452 Ga0207693_10022833
453 Ga0207663_10019159
454 Ga0207660_10384703
455 Ga0207649_10091020
456 Ga0207681_10031010
457 Ga0207650_10021813
458 Ga0207650_10212298
459 Ga0207687_10211156
460 Ga0207644_10015739
461 Ga0207690_10012375
462 Ga0207686_10002897
463 Ga0207709_10005568
464 Ga0207709_10072692
465 Ga0207709_10232299
466 Ga0207669_10044222
467 Ga0207704_10020557
468 Ga0207704_10119653
469 Ga0207665_10076125
470 Ga0207689_10024362
471 Ga0207667_10369595
472 Ga0207712_10028056
473 Ga0207668_10159257
474 Ga0207677_10011223
475 Ga0207703_10067430
476 Ga0207708_10001392
477 Ga0207708_10109013
478 Ga0207641_10130048
479 Ga0207648_10003843
480 Ga0207648_10042667
481 Ga0207676_10131078
482 Ga0207676_10168548
483 Ga0207674_10001271
484 Ga0207675_100005740
485 Ga0207675_100207580
486 Ga0207683_10105596
487 Ga0207428_10002625
488 Ga0207428_10022221
489 Ga0268265_10412135
490 Ga0307515_10009322
491 Ga0316579_10117918
492 Ga0316576_10114294
493 Ga0316593_10011034
494 Ga0373926_0000252
495 Ga0373944_0000014
496 Ga0373944_0033650
497 Ga0373936_0000295
498 Ga0373945_0000027
499 Ga0373945_0046124
500 Ga0373943_0000464
501 Ga0373943_0029733
502 Ga0373946_0000184
503 Ga0373946_0170554
504 Ga0373962_0011947
505 Ga0373935_0000347
506 Ga0373927_0001023
507 Ga0373947_0000587
508 Ga0373947_0018745
509 Ga0373947_0138654
510 Ga0316584_0050012
511 Ga0373925_0002341
512 Ga0373925_0032879
513 Ga0373925_0044844
514 Ga0373925_0139705
515 Ga0395899_0002670
516 Ga0395899_0029520
517 Ga0395899_0032604
518 Ga0395899_0132480
519 Ga0395899_0157440
520 Ga0395900_0022677
521 Ga0395900_0043091
522 Ga0395898_0143555
523 Ga0395905_0007252
524 Ga0395905_0036204
525 Ga0395905_0075676
526 Ga0395905_0102483
527 Ga0395901_0147828
528 Ga0395901_0252666
529 Ga0395901_0474775
530 Ga0395901_0687277
531 Ga0436363_1694179
532 Ga0439461_0021480
533 Ga0439454_006507
534 Ga0439464_0001808
535 Ga0439460_0004850
536 Ga0466969_0000602
537 Ga0466966_0049118
538 Ga0466961_0000071
539 Ga0466970_0111657
540 Ga0466957_0036342
541 Ga0466957_0067323
542 Ga0466957_0172122
543 Ga0466959_0008821
544 Ga0466959_0041238
545 Ga0466958_0019626
546 Ga0466958_0039574
547 Ga0466967_0090608
548 Ga0495617_039984
549 Ga0495592_0064640
550 Ga0495603_0009004
551 Ga0495603_0016538
552 Ga0495603_0046594
553 Ga0495629_0004663
554 Ga0495641_0001892
555 Ga0495653_0052458
556 Ga0495580_0068976
557 Ga0495582_0000300
558 Ga0495582_0000994
559 Ga0495639_0000271
560 Ga0495639_0102638
561 Ga0495662_0005398
562 Ga0495662_0032127
563 Ga0495585_0035880
564 Ga0495594_0004082
565 Ga0495583_0094441
566 Ga0495608_0174090
567 Ga0495630_0002186
568 Ga0495630_0187680
569 Ga0495644_0029295
570 Ga0495666_0000343
571 Ga0495665_0000410
572 Ga0495665_0007556
573 Ga0495665_0080696
574 Ga0495640_0001746
575 Ga0495586_0001642
576 Ga0495598_0010885
577 Ga0495609_0089658
578 Ga0495609_0112101
579 Ga0495621_0005667
580 Ga0495633_0030475
581 Ga0495656_0026691
582 Ga0495656_0133308
583 Ga0495634_0004368
584 Ga0495634_0039203
585 Ga0495635_0000361
586 Ga0495635_0145023
587 Ga0495588_0000458
588 Ga0495647_0000094
589 Ga0495658_0000299
590 Ga0495658_0002230
591 Ga0495658_0239675
592 Ga0495669_0041662
593 Ga0495613_0001069
594 Ga0495613_0002159
595 Ga0495613_0092868
596 Ga0495624_0001682
597 Ga0495624_0108788
598 Ga0495670_0001700
599 Ga0495670_0103190
600 Ga0495670_0129010
601 Ga0495600_0157443
602 Ga0495581_0000129
603 Ga0495581_0002136
604 Ga0495581_0038932
605 Ga0495674_0002433
606 Ga0495676_0004854
607 Ga0495676_0008878
608 Ga0495676_0042405
609 Ga0495680_0003753
610 Ga0495679_057123
611 Ga0495684_0105759
612 Ga0495593_0001715
613 Ga0495614_0000582
614 Ga0495614_0003943
615 Ga0496100_0046794
616 Ga0496100_0060026
617 Ga0496101_0014217
618 Ga0496101_0112239
619 Ga0496102_0004827
620 Ga0496102_0058078
621 Ga0496103_0135110
622 Ga0496103_0233183
623 Ga0496104_0119680
624 Ga0496105_0021813
625 Ga0496106_0020220
626 Ga0496106_0122783
627 Ga0496107_0016623
628 Ga0496107_0025192
629 Ga0496108_0047650
630 Ga0496108_0184934
631 Ga0496109_0010486
632 Ga0496109_0060920
633 Ga0496109_0165908
634 Ga0496110_0010234
635 Ga0496110_0097347
636 Ga0496111_0004519
637 Ga0496112_0052515
638 Ga0496112_0134324
639 Ga0496114_0013738
640 Ga0501040_0151608
641 Ga0501040_0300519
642 Ga0501041_0126921
643 Ga0501042_0112117
644 Ga0501042_0220776
645 Ga0501070_0196613
646 Ga0501075_0002306
647 Ga0501075_0053708
648 Ga0501079_0210964
649 Ga0501080_0190428
650 Ga0501081_0242584
651 Ga0501083_0365286
652 Ga0501044_0375258
653 Ga0501045_0008889
654 Ga0501045_0131177
655 nmdc:mga05p37_18576_c1
656 nmdc:mga05p37_25270_c1
657 nmdc:mga05p37_490801_c1
658 nmdc:mga05p37_7807_c1
659 nmdc:mga05p37_814654_c1
660 nmdc:mga09592_406464_c1
661 nmdc:mga09592_7275_c1
662 nmdc:mga0qj67_3898_c1
663 nmdc:mga06r32_144921_c1
664 nmdc:mga06r32_15562_c1
665 nmdc:mga06r32_8062_c1
666 nmdc:mga08y16_98788_c1
667 nmdc:mga0n895_78615_c1
668 nmdc:mga0a205_13974_c1
669 nmdc:mga0a205_148821_c1
670 nmdc:mga0a205_2969_c1
671 Ga0495601_0000902
672 Ga0495601_0011983
673 Ga0495595_0108497
674 Ga0495619_0000476
675 Ga0495619_0004562
676 Ga0495619_0301685
677 Ga0500642_0052099
678 Ga0501082_0097256
679 Ga0530510_0119003
680 Ga0530510_0249803

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00291

PALP

Pyridoxal-phosphate dependent enzyme

47

323

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
3fgp-assembly1.cif.gz_A 2.05 a crystal structure of cysm from mycobacterium tuberculosis - open and closed conformations 0.9738 2 299
2jc3-assembly3.cif.gz_F structure of o-acetylserine sulfhydrylase b from salmonella typhimurium 0.9718 3 289
2bhs-assembly2.cif.gz_C crystal structure of cysteine synthase b 0.9709 6 290
2v03-assembly1.cif.gz_A-2 high resolution structure and catalysis of an o-acetylserine sulfhydrylase 0.9663 3 293
3dwi-assembly1.cif.gz_B crystal structure of mycobacterium tuberculosis cysm, the cysteine synthase b 0.9608 2 293
ID Description Score Start End Superfamily
af_P16703_7_287_3.30.360.10 Alpha Beta;2-Layer Sandwich;Dihydrodipicolinate Reductase; domain 2;Dihydrodipicolinate Reductase; domain 2 0.9754 10 286 3.30.360.10
af_P16703_143_287_3.40.50.1100 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9676 144 286 3.40.50.1100
3rr2A02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9619 44 140 3.40.50.1100
af_P16703_7_287_3.30.360.10 Alpha Beta;2-Layer Sandwich;Dihydrodipicolinate Reductase; domain 2;Dihydrodipicolinate Reductase; domain 2 0.9584 10 286 3.30.360.10
4jbnB02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.954 44 140 3.40.50.1100
ID Description Score Start End GO Terms
AF-A0A350MTL8-F1-model_v4 Cysteine synthase B (EC 2.5.1.47) 0.9884 2 293 GO:0004124
GO:0006535
AF-A0A1F9C8M8-F1-model_v4 Tryptophan synthase beta chain-like PALP domain-containing protein 0.988 1 276 GO:0004124
GO:0006535
AF-A0A358QTX4-F1-model_v4 O-acetylserine (thiol)-lyase 0.9826 1 288 GO:0004124
GO:0006535
AF-A0A3M0XET6-F1-model_v4 Pyridoxal-phosphate dependent enzyme 0.9824 28 289 GO:0006508
GO:0008237
GO:0019344
GO:0046872
AF-A0A7C5VUA9-F1-model_v4 Cysteine synthase family protein 0.9822 1 295 GO:0004124
GO:0006535

Map