F414399

General Info

Members Datasets Scaffolds Average Seq Length
340 214 318 98

Family's Representative Sequence

Representative Sequence 3300031901|Ga0307406_11047451|Ga0307406_110474512
Length 110
Sequence VRSLGALAERGLVLTAMPRSNRRRPDSSGDDSFERLLAGWKRTETRRGVDWIVQPVSAVQAQKSYICPGCGRTVDAGVAHLVAWRADGVLGDRADLAARRHWHQHCWKTA

Samples

Sample ID Description Type Environment
1 2643221549 Agromyces sp. Root1464 Isolate Unclassified
2 2643221566 Microbacterium sp. Root166 Isolate Unclassified
3 2643221597 Microbacterium sp. Root180 Isolate Unclassified
4 2643221619 Agromyces sp. Root81 Isolate Unclassified
5 2773857763 Microbacterium sp. SAI-030 Isolate Unclassified
6 2808606368 Microbacterium sp. SLBN-1 Isolate Unclassified
7 2808606447 Microbacterium sp. HAR-UPW-R2A-48 Isolate Unclassified
8 2811994872 Microbacterium sp. MU4Y-5-1 Isolate Unclassified
9 2833709550 Microbacterium sp. 3290 Isolate Rhizosphere
10 2844841374 Leifsonia soli DSM 23871 Isolate Rhizosphere
11 2844852863 Herbiconiux flava DSM 26474 Isolate Rhizosphere
12 2852632344 Microbacterium sp. AK009 Isolate Rhizosphere
13 2870628048 Microbacterium thalassium DSM 12511 Isolate Rhizosphere
14 2919055335 Leifsonia sp. 1010 Isolate Rhizosphere
15 2919443155 Agromyces sp. 3263 Isolate Rhizosphere
16 2919523602 Leifsonia shinshuensis 3821 Isolate Unclassified
17 2928090899 Microbacterium sp. 1262 Isolate Rhizosphere
18 2928153084 Leifsonia sp. 563 Isolate Unclassified
19 2977251589 Microbacterium sp. SORGH_AS 505 Isolate Unclassified
20 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
21 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
22 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
23 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
24 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
25 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
26 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
27 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
28 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
29 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
30 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
31 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
32 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
33 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
34 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
37 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
38 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
39 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
40 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
41 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
42 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
43 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
44 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
45 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
46 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
47 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
48 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
49 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
50 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
51 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
52 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
53 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
54 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
56 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
57 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
58 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
59 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
60 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
61 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
62 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
63 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
64 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
65 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
66 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
67 3300013250 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 Metagenome Rhizosphere
68 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
69 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
70 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
71 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
72 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
73 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
74 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
75 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
76 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
77 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
78 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
79 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
80 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
81 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
82 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
83 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
84 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
85 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
86 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
112 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
113 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
114 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
115 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
116 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
117 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
118 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
119 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
120 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
121 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
122 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
123 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
124 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
125 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
126 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
127 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
128 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
129 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
130 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
131 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
132 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
133 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
134 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
135 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
136 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
137 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
138 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
139 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
140 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
141 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
142 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
143 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
144 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
145 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
146 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
147 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
148 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
149 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
150 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
151 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
152 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
153 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
154 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
155 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
156 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
157 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
158 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
159 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
160 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
161 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
162 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
163 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
164 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
165 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
166 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
167 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
168 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
169 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
170 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
171 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
172 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
173 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
174 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
175 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
176 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
177 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
178 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
179 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
180 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
181 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
182 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
183 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
184 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
185 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
186 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
187 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
188 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
189 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
190 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
191 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
192 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
193 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
194 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
195 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
196 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
197 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
198 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
199 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
200 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
201 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
202 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
203 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
204 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
205 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
206 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
207 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
208 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
209 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
210 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
211 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
212 8004182704 Microbacterium paraoxydans ku-mp Isolate Unclassified
213 8045830549 Microbacterium yannicii DSM 23203 Isolate Unclassified
214 8057345674 Herbiconiux aconitum CPCC 205763 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 90.88
Metatranscriptomes 2.65
Isolates 6.47

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.76
Nodule 0
Rhizoplane 10.88
Rhizosphere 61.47
Stem 0
Stem Tuber 0
Unclassified 15.88

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25154J39366_1004067 3300002738 Bacteria 2768
2 Ga0006562J51391_1026342 3300003578 Bacteria 1656
3 Ga0006562J51391_1026344 3300003578 Bacteria 2550
4 Ga0006562J51391_1026347 3300003578 Bacteria 1610
5 Ga0055532_1030364 3300003758 Bacteria 504
6 Ga0055527_1000012 3300003760 Bacteria 348744
7 Ga0055542_1000017 3300003762 Bacteria 348744
8 Ga0055529_1000023 3300003763 Bacteria 314383
9 Ga0065714_10384528 3300005288 Bacteria 603
10 Ga0070658_10169153 3300005327 Bacteria 1836
11 Ga0070690_100208093 3300005330 Bacteria 1364
12 Ga0070682_100985395 3300005337 Bacteria 698
13 Ga0068868_101234769 3300005338 Bacteria 692
14 Ga0070668_100892642 3300005347 Bacteria 794
15 Ga0070671_100082053 3300005355 Bacteria 2696
16 Ga0070659_100000149 3300005366 Bacteria 53509
17 Ga0070659_100090424 3300005366 Bacteria 2453
18 Ga0070659_100864091 3300005366 Bacteria 789
19 Ga0070663_100091425 3300005455 Bacteria 2255
20 Ga0070678_100529176 3300005456 Bacteria 1044
21 Ga0070678_100835577 3300005456 Bacteria 838
22 Ga0070685_10083871 3300005466 Bacteria 1915
23 Ga0068853_100465486 3300005539 Bacteria 1190
24 Ga0068853_102285297 3300005539 Bacteria 524
25 Ga0068855_100212605 3300005563 Bacteria 2172
26 Ga0068855_100371818 3300005563 Bacteria 1571
27 Ga0068855_101032891 3300005563 Bacteria 862
28 Ga0068857_101791801 3300005577 Bacteria 601
29 Ga0068854_100234077 3300005578 Bacteria 1459
30 Ga0068856_100071190 3300005614 Bacteria 3442
31 Ga0068856_100193955 3300005614 Bacteria 2045
32 Ga0068852_102335792 3300005616 Bacteria 556
33 Ga0068864_100509991 3300005618 Bacteria 1158
34 Ga0068861_100268621 3300005719 Bacteria 1464
35 Ga0068870_10119127 3300005840 Bacteria 1518
36 Ga0068863_100225606 3300005841 Bacteria 1806
37 Ga0075365_10001327 3300006038 Bacteria 11065
38 Ga0075365_11308863 3300006038 Bacteria 509
39 Ga0075363_100205191 3300006048 Bacteria 1127
40 Ga0075364_10121821 3300006051 Bacteria 1746
41 Ga0075364_10241858 3300006051 Bacteria 1226
42 Ga0075364_10599313 3300006051 Bacteria 753
43 Ga0075364_10814538 3300006051 Bacteria 636
44 Ga0075367_10002202 3300006178 Bacteria 8793
45 Ga0075369_10012204 3300006186 Bacteria 3393
46 Ga0075369_10318850 3300006186 Bacteria 727
47 Ga0075370_10175100 3300006353 Bacteria 1262
48 Ga0105240_10002898 3300009093 Bacteria 27065
49 Ga0105240_10046352 3300009093 Bacteria 5509
50 Ga0105240_10519788 3300009093 Bacteria 1321
51 Ga0111539_10403600 3300009094 Bacteria 1592
52 Ga0105245_10083496 3300009098 Bacteria 2924
53 Ga0105245_10092206 3300009098 Bacteria 2789
54 Ga0105247_10227602 3300009101 Bacteria 1265
55 Ga0105247_10533682 3300009101 Bacteria 860
56 Ga0105243_11984989 3300009148 Bacteria 616
57 Ga0105241_10003266 3300009174 Bacteria 12064
58 Ga0105241_12687106 3300009174 Bacteria 501
59 Ga0105248_10000681 3300009177 Bacteria 38440
60 Ga0105248_10037804 3300009177 Bacteria 5402
61 Ga0105237_10012819 3300009545 Bacteria 8817
62 Ga0105237_10079034 3300009545 Bacteria 3279
63 Ga0105238_10292539 3300009551 Bacteria 1611
64 Ga0105249_10297836 3300009553 Bacteria 1616
65 Ga0105239_10049608 3300010375 Bacteria 4602
66 Ga0105239_10737003 3300010375 Bacteria 1128
67 Ga0105239_10800413 3300010375 Bacteria 1080
68 Ga0105239_11049005 3300010375 Bacteria 938
69 Ga0105239_11584520 3300010375 Bacteria 757
70 Ga0105246_10303245 3300011119 Bacteria 1291
71 Ga0105246_11056787 3300011119 Bacteria 739
72 Ga0157370_11447668 3300013104 Bacteria 618
73 Ga0157369_10000573 3300013105 Bacteria 48456
74 Ga0157369_10082343 3300013105 Bacteria 3443
75 Ga0157369_10222301 3300013105 Bacteria 1976
76 Ga0157369_10558047 3300013105 Bacteria 1183
77 Ga0171462_1003 3300013250 Bacteria 853796
78 Ga0163162_10767961 3300013306 Bacteria 1082
79 Ga0163162_11093278 3300013306 Bacteria 903
80 Ga0157372_10027455 3300013307 Bacteria 6200
81 Ga0157372_10731544 3300013307 Bacteria 1151
82 Ga0157372_12039433 3300013307 Bacteria 659
83 Ga0157372_13253646 3300013307 Bacteria 518
84 Ga0157375_11938424 3300013308 Bacteria 700
85 Ga0163163_10435396 3300014325 Bacteria 1371
86 Ga0157380_10106930 3300014326 Bacteria 2342
87 Ga0157380_13090788 3300014326 Bacteria 531
88 Ga0157376_10893861 3300014969 Unclassified 906
89 Ga0157376_10931706 3300014969 Bacteria 888
90 Ga0197907_11201786 3300020069 Bacteria 4303
91 Ga0206356_11288880 3300020070 Bacteria 853
92 Ga0206355_1601115 3300020076 Bacteria 1063
93 Ga0206352_10249236 3300020078 Bacteria 687
94 Ga0206353_10173718 3300020082 Bacteria 4276
95 Ga0206353_11299884 3300020082 Bacteria 616
96 Ga0209672_100003 3300025228 Bacteria 1560476
97 Ga0209147_101360 3300025229 Bacteria 9191
98 Ga0209563_101072 3300025230 Bacteria 7891
99 Ga0209646_1000168 3300025246 Bacteria 86352
100 Ga0209148_1000004 3300025254 Bacteria 1844481
101 Ga0209233_1074936 3300025261 Bacteria 616
102 Ga0209455_1000022 3300025272 Bacteria 688910
103 Ga0209455_1002580 3300025272 Bacteria 6907
104 Ga0207692_10121823 3300025898 Bacteria 1461
105 Ga0207647_10047573 3300025904 Bacteria 2667
106 Ga0207647_10135484 3300025904 Bacteria 1446
107 Ga0207643_10085229 3300025908 Bacteria 1835
108 Ga0207705_10000001 3300025909 Bacteria 2061880
109 Ga0207705_10538793 3300025909 Bacteria 907
110 Ga0207695_10002117 3300025913 Bacteria 30146
111 Ga0207671_10064352 3300025914 Bacteria 2726
112 Ga0207657_10053818 3300025919 Bacteria 3484
113 Ga0207687_10130367 3300025927 Bacteria 1894
114 Ga0207644_10521012 3300025931 Bacteria 982
115 Ga0207691_10138860 3300025940 Bacteria 2142
116 Ga0207711_10007361 3300025941 Bacteria 9212
117 Ga0207711_10196339 3300025941 Bacteria 1840
118 Ga0207667_10017962 3300025949 Bacteria 7948
119 Ga0207667_10295096 3300025949 Bacteria 1656
120 Ga0207667_10510330 3300025949 Bacteria 1219
121 Ga0207712_10190476 3300025961 Bacteria 1618
122 Ga0207668_10408956 3300025972 Bacteria 1149
123 Ga0207640_10288413 3300025981 Bacteria 1293
124 Ga0207677_10998448 3300026023 Bacteria 759
125 Ga0207639_10005804 3300026041 Bacteria 8362
126 Ga0207639_11644259 3300026041 Bacteria 602
127 Ga0207678_10159170 3300026067 Bacteria 1928
128 Ga0207702_10021565 3300026078 Bacteria 5334
129 Ga0207641_10286103 3300026088 Bacteria 1552
130 Ga0207676_11781914 3300026095 Bacteria 614
131 Ga0207674_10574004 3300026116 Bacteria 1089
132 Ga0207674_10775640 3300026116 Bacteria 925
133 Ga0207675_100431972 3300026118 Bacteria 1302
134 Ga0207683_10078079 3300026121 Bacteria 2933
135 Ga0207683_10098552 3300026121 Bacteria 2608
136 Ga0268265_11680379 3300028380 Bacteria 641
137 Ga0307408_100641085 3300031548 Bacteria 949
138 Ga0307408_101467804 3300031548 Bacteria 644
139 Ga0307408_102007458 3300031548 Bacteria 556
140 Ga0307408_102147896 3300031548 Bacteria 539
141 Ga0307514_10286393 3300031649 Bacteria 937
142 Ga0307413_11241352 3300031824 Bacteria 650
143 Ga0307410_11456817 3300031852 Bacteria 602
144 Ga0307406_10158664 3300031901 Bacteria 1623
145 Ga0307406_10795610 3300031901 Bacteria 797
146 Ga0307406_11047451 3300031901 Bacteria 702
147 Ga0307407_10086722 3300031903 Bacteria 1908
148 Ga0307407_11582351 3300031903 Bacteria 520
149 Ga0307412_10243550 3300031911 Bacteria 1392
150 Ga0307409_100490600 3300031995 Bacteria 1194
151 Ga0307409_101276306 3300031995 Bacteria 759
152 Ga0307409_101567180 3300031995 Bacteria 687
153 Ga0307416_100272919 3300032002 Bacteria 1662
154 Ga0307416_103335126 3300032002 Bacteria 537
155 Ga0307414_10255144 3300032004 Bacteria 1460
156 Ga0307414_10382773 3300032004 Bacteria 1217
157 Ga0307414_10738942 3300032004 Bacteria 894
158 Ga0307414_11064905 3300032004 Bacteria 746
159 Ga0307414_11245947 3300032004 Bacteria 689
160 Ga0307414_11357435 3300032004 Bacteria 660
161 Ga0307414_11358925 3300032004 Bacteria 660
162 Ga0307415_100724375 3300032126 Bacteria 900
163 Ga0307415_101270853 3300032126 Bacteria 696
164 Ga0395899_0068951 3300037312 Bacteria 2591
165 Ga0395899_0706820 3300037312 Unclassified 631
166 Ga0395900_0005052 3300037418 Bacteria 13845
167 Ga0395900_0080746 3300037418 Bacteria 3342
168 Ga0395898_0000473 3300037466 Bacteria 80586
169 Ga0395898_0733469 3300037466 Bacteria 930
170 Ga0439465_0229910 3300041413 Bacteria 682
171 Ga0451793_0954298 3300041452 Bacteria 723
172 Ga0451795_0938915 3300041456 Bacteria 698
173 Ga0451807_1104978 3300041486 Bacteria 550
174 Ga0451837_1592894 3300041494 Bacteria 522
175 Ga0451839_0048735 3300041496 Bacteria 831
176 Ga0451847_0747176 3300041503 Bacteria 778
177 Ga0451843_1619024 3300041509 Bacteria 542
178 Ga0451853_0782077 3300041512 Bacteria 956
179 Ga0451853_2204479 3300041512 Bacteria 563
180 Ga0451853_2561382 3300041512 Bacteria 1612
181 Ga0450920_023112 3300042122 Bacteria 1205
182 Ga0450908_065029 3300042184 Bacteria 644
183 Ga0450908_080243 3300042184 Bacteria 585
184 Ga0466972_0066840 3300044658 Bacteria 1718
185 Ga0466972_0261858 3300044658 Bacteria 808
186 Ga0466965_0034272 3300044683 Bacteria 2483
187 Ga0466965_0112109 3300044683 Bacteria 1402
188 Ga0466965_0822855 3300044683 Bacteria 538
189 Ga0466961_0046375 3300044693 Bacteria 2780
190 Ga0466970_0162029 3300044765 Bacteria 1237
191 Ga0466957_0653257 3300044842 Bacteria 739
192 Ga0466960_0048660 3300044901 Bacteria 2038
193 Ga0466959_0051547 3300045049 Bacteria 3017
194 Ga0495650_0002266 3300046471 Bacteria 16043
195 Ga0495650_0186144 3300046471 Bacteria 728
196 Ga0495596_0113216 3300046500 Bacteria 1054
197 Ga0495620_0117937 3300046515 Bacteria 1048
198 Ga0495628_0211473 3300046516 Bacteria 1459
199 Ga0495654_0336563 3300046530 Bacteria 609
200 Ga0495656_0255393 3300046615 Bacteria 887
201 Ga0495613_0489769 3300046689 Bacteria 829
202 Ga0495604_0912937 3300047317 Unclassified 548
203 Ga0496100_0395630 3300048903 Bacteria 1051
204 Ga0496101_0089016 3300048904 Bacteria 2293
205 Ga0496101_0153550 3300048904 Bacteria 1762
206 Ga0496101_1099554 3300048904 Bacteria 624
207 Ga0496102_0120035 3300048905 Bacteria 2455
208 Ga0496102_0319012 3300048905 Bacteria 1464
209 Ga0496103_0237716 3300048906 Bacteria 1172
210 Ga0496103_0682972 3300048906 Bacteria 651
211 Ga0496104_0015930 3300048907 Bacteria 6822
212 Ga0496104_0066024 3300048907 Bacteria 3435
213 Ga0496104_0085455 3300048907 Bacteria 3011
214 Ga0496105_0013419 3300048908 Bacteria 6503
215 Ga0496105_0047371 3300048908 Bacteria 3547
216 Ga0496105_0134271 3300048908 Bacteria 2039
217 Ga0496105_0163005 3300048908 Bacteria 1830
218 Ga0496105_0212088 3300048908 Bacteria 1578
219 Ga0496106_1334753 3300048909 Bacteria 556
220 Ga0496107_0243198 3300048910 Bacteria 1339
221 Ga0496108_0019521 3300048911 Bacteria 5567
222 Ga0496109_0047811 3300048912 Bacteria 3891
223 Ga0496109_0245184 3300048912 Bacteria 1687
224 Ga0496110_0156010 3300048913 Bacteria 2068
225 Ga0496113_0051897 3300048916 Bacteria 3061
226 Ga0496113_0242836 3300048916 Bacteria 1437
227 Ga0496114_0027278 3300048917 Bacteria 4677
228 Ga0496114_0032174 3300048917 Bacteria 4316
229 Ga0496114_0048337 3300048917 Bacteria 3539
230 Ga0496114_0053166 3300048917 Bacteria 3376
231 Ga0496114_0067364 3300048917 Bacteria 3003
232 Ga0496115_0004310 3300048918 Bacteria 10299
233 Ga0496115_0022943 3300048918 Bacteria 4839
234 Ga0496115_0045138 3300048918 Bacteria 3517
235 Ga0496115_0103570 3300048918 Bacteria 2335
236 Ga0496115_1253435 3300048918 Bacteria 554
237 Ga0496116_0450194 3300048919 Bacteria 552
238 Ga0496117_0000321 3300048920 Bacteria 84088
239 Ga0496117_0018496 3300048920 Bacteria 5765
240 Ga0496117_0093280 3300048920 Bacteria 1931
241 Ga0496117_0119393 3300048920 Bacteria 1623
242 Ga0496117_0126642 3300048920 Bacteria 1557
243 Ga0496118_0024944 3300048921 Bacteria 5145
244 Ga0496118_0067954 3300048921 Bacteria 2591
245 Ga0496118_0531894 3300048921 Bacteria 577
246 Ga0496119_0001615 3300048922 Bacteria 26709
247 Ga0496119_0003146 3300048922 Bacteria 17351
248 Ga0496119_0003378 3300048922 Bacteria 16605
249 Ga0496119_0158066 3300048922 Bacteria 1208
250 Ga0496119_0183636 3300048922 Bacteria 1095
251 Ga0496120_0000426 3300048923 Bacteria 66901
252 Ga0496120_0010869 3300048923 Bacteria 6302
253 Ga0496120_0013004 3300048923 Bacteria 5629
254 Ga0496120_0022048 3300048923 Bacteria 4010
255 Ga0496120_0047652 3300048923 Bacteria 2470
256 Ga0496121_0106594 3300048924 Bacteria 2148
257 Ga0496122_0004360 3300048925 Bacteria 17676
258 Ga0496122_0292112 3300048925 Bacteria 884
259 Ga0496124_0879744 3300048927 Bacteria 546
260 Ga0496125_0000077 3300048928 Bacteria 232629
261 Ga0496125_0333795 3300048928 Bacteria 913
262 Ga0496126_0388448 3300048929 Bacteria 1134
263 Ga0496126_0589782 3300048929 Unclassified 877
264 Ga0496126_0638025 3300048929 Bacteria 835
265 Ga0501032_0147747 3300049569 Bacteria 1547
266 Ga0501034_0017981 3300049571 Bacteria 7251
267 Ga0501034_0021573 3300049571 Bacteria 6561
268 Ga0501034_0955578 3300049571 Bacteria 742
269 Ga0501036_0862561 3300049572 Bacteria 744
270 Ga0501036_0980770 3300049572 Bacteria 692
271 Ga0501037_0021825 3300049573 Bacteria 4738
272 Ga0501037_0643925 3300049573 Bacteria 709
273 Ga0501038_0190454 3300049574 Bacteria 1651
274 Ga0501038_1367333 3300049574 Bacteria 509
275 Ga0501039_0218647 3300049575 Bacteria 1498
276 Ga0501041_0899676 3300049577 Bacteria 569
277 Ga0501043_0001096 3300049579 Bacteria 23797
278 Ga0501043_0047085 3300049579 Bacteria 3390
279 Ga0501043_0332552 3300049579 Bacteria 1157
280 Ga0501046_0008111 3300049580 Bacteria 9176
281 Ga0501046_0700607 3300049580 Bacteria 713
282 Ga0501047_0037302 3300049581 Bacteria 4700
283 Ga0501047_0050446 3300049581 Bacteria 4019
284 Ga0501047_0063986 3300049581 Bacteria 3548
285 Ga0501069_0080951 3300049585 Bacteria 1829
286 Ga0501070_0000100 3300049586 Bacteria 75001
287 Ga0501070_0002712 3300049586 Bacteria 15449
288 Ga0501070_0017544 3300049586 Bacteria 6009
289 Ga0501070_0229316 3300049586 Bacteria 1522
290 Ga0501073_1065511 3300049589 Bacteria 556
291 Ga0501077_0094532 3300049593 Bacteria 1895
292 Ga0501080_0000083 3300049742 Bacteria 63863
293 Ga0501083_0003662 3300049744 Bacteria 10787
294 Ga0501035_0566043 3300049822 Bacteria 929
295 Ga0501044_0038144 3300049823 Bacteria 5018
296 nmdc:mga03n38_28233_c1 3300050490 Bacteria 2336
297 nmdc:mga00v17_529527_c1 3300050491 Bacteria 763
298 nmdc:mga00v17_92200_c1 3300050491 Bacteria 1904
299 nmdc:mga0yw44_184383_c1 3300050492 Bacteria 1375
300 nmdc:mga0yw44_838466_c1 3300050492 Bacteria 624
301 nmdc:mga06z11_17380_c1 3300050494 Bacteria 3263
302 nmdc:mga07m45_469751_c1 3300050496 Bacteria 729
303 nmdc:mga07m45_61432_c1 3300050496 Bacteria 2128
304 nmdc:mga0qj67_1401880_c1 3300050509 Bacteria 539
305 nmdc:mga08y16_1345270_c1 3300050511 Bacteria 679
306 nmdc:mga0sz30_26778_c1 3300050516 Bacteria 2365
307 Ga0500635_0000010 3300053080 Bacteria 147500
308 Ga0500635_0017018 3300053080 Bacteria 2171
309 Ga0495619_1072503 3300053085 Bacteria 537
310 Ga0500651_0000368 3300053093 Bacteria 24842
311 Ga0500597_216000 3300053120 Bacteria 799
312 Ga0500559_0017157 3300053136 Bacteria 3056
313 Ga0500573_0000001 3300053140 Bacteria 436394
314 Ga0500590_031525 3300053148 Bacteria 2749
315 Ga0500616_0000078 3300053153 Bacteria 202009
316 Ga0500620_000046 3300053155 Bacteria 22312
317 Ga0501084_0152871 3300054114 Bacteria 1945
318 Ga0501082_1842708 3300060353 Unclassified 528

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300050492 nmdc:mga0yw44_838466_c1 nmdc:mga0yw44_838466_c1_207_551 89
2 3300050496 nmdc:mga07m45_469751_c1 nmdc:mga07m45_469751_c1_120_464 89
3 iso_pu_bacteria 2977251589 2977254101 89
4 3300025940 Ga0207691_10138860 Ga0207691_101388602 90
5 iso_pu_bacteria 2643221566 2643848556 90
6 iso_pu_bacteria 2643221597 2643996049 90
7 iso_pu_bacteria 2773857763 2774399335 90
8 iso_pu_bacteria 2808606447 2809227568 90
9 iso_pu_bacteria 2833709550 2833711116 90
10 iso_pu_bacteria 2852632344 2852634329 90
11 iso_pu_bacteria 2870628048 2870630508 90
12 iso_pu_bacteria 8004182704 8004185313 90
13 iso_pu_bacteria 8045830549 8045831740 90
14 3300005539 Ga0068853_102285297 Ga0068853_1022852971 91
15 3300013105 Ga0157369_10558047 Ga0157369_105580472 91
16 3300013307 Ga0157372_10027455 Ga0157372_100274555 91
17 3300025904 Ga0207647_10047573 Ga0207647_100475733 91
18 3300048904 Ga0496101_0089016 Ga0496101_0089016_1922_2221 91
19 3300048905 Ga0496102_0120035 Ga0496102_0120035_2099_2398 91
20 3300048907 Ga0496104_0085455 Ga0496104_0085455_462_761 91
21 3300048908 Ga0496105_0047371 Ga0496105_0047371_1445_1744 91
22 3300048909 Ga0496106_1334753 Ga0496106_1334753_148_447 91
23 3300048910 Ga0496107_0243198 Ga0496107_0243198_453_752 91
24 3300048917 Ga0496114_0067364 Ga0496114_0067364_678_977 91
25 3300048918 Ga0496115_0022943 Ga0496115_0022943_2944_3243 91
26 3300048920 Ga0496117_0126642 Ga0496117_0126642_1032_1331 91
27 3300048921 Ga0496118_0531894 Ga0496118_0531894_92_391 91
28 3300048922 Ga0496119_0158066 Ga0496119_0158066_860_1159 91
29 3300048923 Ga0496120_0047652 Ga0496120_0047652_1289_1588 91
30 3300048924 Ga0496121_0106594 Ga0496121_0106594_1160_1459 91
31 3300048929 Ga0496126_0388448 Ga0496126_0388448_167_466 91
32 iso_pu_bacteria 2643221549 2643767959 91
33 iso_pu_bacteria 2643221619 2644111355 91
34 iso_pu_bacteria 2808606368 2808885776 91
35 iso_pu_bacteria 2811994872 2812323369 91
36 iso_pu_bacteria 2844841374 2844842136 91
37 iso_pu_bacteria 2844852863 2844854763 91
38 iso_pu_bacteria 2919055335 2919057782 91
39 iso_pu_bacteria 2919443155 2919446470 91
40 iso_pu_bacteria 2919523602 2919524183 91
41 iso_pu_bacteria 2928153084 2928155649 91
42 iso_pu_bacteria 8057345674 8057347851 91
43 3300048922 Ga0496119_0003146 Ga0496119_0003146_12285_12566 92
44 3300048923 Ga0496120_0010869 Ga0496120_0010869_2274_2555 92
45 3300020078 Ga0206352_10249236 Ga0206352_102492362 93
46 3300049571 Ga0501034_0955578 Ga0501034_0955578_298_600 93
47 3300049572 Ga0501036_0980770 Ga0501036_0980770_310_612 93
48 3300049573 Ga0501037_0643925 Ga0501037_0643925_142_444 93
49 3300049589 Ga0501073_1065511 Ga0501073_1065511_101_403 93
50 iso_pu_bacteria 2928090899 2928092010 93
51 3300005330 Ga0070690_100208093 Ga0070690_1002080932 94
52 3300005338 Ga0068868_101234769 Ga0068868_1012347692 94
53 3300005347 Ga0070668_100892642 Ga0070668_1008926422 94
54 3300005366 Ga0070659_100000149 Ga0070659_10000014946 94
55 3300005366 Ga0070659_100864091 Ga0070659_1008640912 94
56 3300005456 Ga0070678_100529176 Ga0070678_1005291762 94
57 3300005466 Ga0070685_10083871 Ga0070685_100838713 94
58 3300005563 Ga0068855_100212605 Ga0068855_1002126051 94
59 3300005563 Ga0068855_100371818 Ga0068855_1003718182 94
60 3300005563 Ga0068855_101032891 Ga0068855_1010328912 94
61 3300005577 Ga0068857_101791801 Ga0068857_1017918012 94
62 3300005578 Ga0068854_100234077 Ga0068854_1002340772 94
63 3300005614 Ga0068856_100193955 Ga0068856_1001939554 94
64 3300005616 Ga0068852_102335792 Ga0068852_1023357921 94
65 3300005841 Ga0068863_100225606 Ga0068863_1002256062 94
66 3300006038 Ga0075365_10001327 Ga0075365_100013279 94
67 3300006048 Ga0075363_100205191 Ga0075363_1002051912 94
68 3300006051 Ga0075364_10241858 Ga0075364_102418582 94
69 3300006051 Ga0075364_10814538 Ga0075364_108145382 94
70 3300006178 Ga0075367_10002202 Ga0075367_100022029 94
71 3300006186 Ga0075369_10012204 Ga0075369_100122043 94
72 3300006353 Ga0075370_10175100 Ga0075370_101751002 94
73 3300009093 Ga0105240_10002898 Ga0105240_100028982 94
74 3300009093 Ga0105240_10046352 Ga0105240_100463522 94
75 3300009093 Ga0105240_10519788 Ga0105240_105197881 94
76 3300009098 Ga0105245_10083496 Ga0105245_100834963 94
77 3300009098 Ga0105245_10092206 Ga0105245_100922062 94
78 3300009101 Ga0105247_10227602 Ga0105247_102276022 94
79 3300009101 Ga0105247_10533682 Ga0105247_105336822 94
80 3300009174 Ga0105241_10003266 Ga0105241_1000326614 94
81 3300009174 Ga0105241_12687106 Ga0105241_126871061 94
82 3300009177 Ga0105248_10000681 Ga0105248_1000068112 94
83 3300009177 Ga0105248_10037804 Ga0105248_100378046 94
84 3300009545 Ga0105237_10012819 Ga0105237_100128196 94
85 3300009545 Ga0105237_10079034 Ga0105237_100790344 94
86 3300009551 Ga0105238_10292539 Ga0105238_102925393 94
87 3300010375 Ga0105239_10049608 Ga0105239_100496082 94
88 3300010375 Ga0105239_10737003 Ga0105239_107370032 94
89 3300010375 Ga0105239_10800413 Ga0105239_108004132 94
90 3300010375 Ga0105239_11049005 Ga0105239_110490052 94
91 3300010375 Ga0105239_11584520 Ga0105239_115845202 94
92 3300013104 Ga0157370_11447668 Ga0157370_114476682 94
93 3300013250 Ga0171462_1003 Ga0171462_1003242 94
94 3300013307 Ga0157372_12039433 Ga0157372_120394332 94
95 3300014326 Ga0157380_13090788 Ga0157380_130907881 94
96 3300014969 Ga0157376_10893861 Ga0157376_108938612 94
97 3300014969 Ga0157376_10931706 Ga0157376_109317062 94
98 3300020082 Ga0206353_11299884 Ga0206353_112998842 94
99 3300025898 Ga0207692_10121823 Ga0207692_101218232 94
100 3300025913 Ga0207695_10002117 Ga0207695_1000211720 94
101 3300025914 Ga0207671_10064352 Ga0207671_100643522 94
102 3300025927 Ga0207687_10130367 Ga0207687_101303672 94
103 3300025931 Ga0207644_10521012 Ga0207644_105210122 94
104 3300025941 Ga0207711_10007361 Ga0207711_100073612 94
105 3300025941 Ga0207711_10196339 Ga0207711_101963393 94
106 3300025949 Ga0207667_10295096 Ga0207667_102950962 94
107 3300025972 Ga0207668_10408956 Ga0207668_104089562 94
108 3300025981 Ga0207640_10288413 Ga0207640_102884132 94
109 3300026023 Ga0207677_10998448 Ga0207677_109984482 94
110 3300026041 Ga0207639_10005804 Ga0207639_100058042 94
111 3300026078 Ga0207702_10021565 Ga0207702_100215656 94
112 3300026088 Ga0207641_10286103 Ga0207641_102861032 94
113 3300026116 Ga0207674_10574004 Ga0207674_105740042 94
114 3300026121 Ga0207683_10098552 Ga0207683_100985522 94
115 3300031548 Ga0307408_100641085 Ga0307408_1006410852 94
116 3300031548 Ga0307408_101467804 Ga0307408_1014678042 94
117 3300031548 Ga0307408_102007458 Ga0307408_1020074582 94
118 3300031649 Ga0307514_10286393 Ga0307514_102863931 94
119 3300031824 Ga0307413_11241352 Ga0307413_112413522 94
120 3300031852 Ga0307410_11456817 Ga0307410_114568171 94
121 3300031901 Ga0307406_10158664 Ga0307406_101586642 94
122 3300031901 Ga0307406_10795610 Ga0307406_107956102 94
123 3300031901 Ga0307406_11047451 Ga0307406_110474512 94
124 3300031903 Ga0307407_10086722 Ga0307407_100867222 94
125 3300031911 Ga0307412_10243550 Ga0307412_102435503 94
126 3300031995 Ga0307409_100490600 Ga0307409_1004906002 94
127 3300031995 Ga0307409_101567180 Ga0307409_1015671802 94
128 3300032004 Ga0307414_10738942 Ga0307414_107389422 94
129 3300032004 Ga0307414_11357435 Ga0307414_113574352 94
130 3300032126 Ga0307415_100724375 Ga0307415_1007243752 94
131 3300032126 Ga0307415_101270853 Ga0307415_1012708531 94
132 3300041413 Ga0439465_0229910 Ga0439465_0229910_273_557 94
133 3300041452 Ga0451793_0954298 Ga0451793_0954298_394_678 94
134 3300041456 Ga0451795_0938915 Ga0451795_0938915_370_672 94
135 3300041486 Ga0451807_1104978 Ga0451807_1104978_179_463 94
136 3300041494 Ga0451837_1592894 Ga0451837_1592894_214_498 94
137 3300041496 Ga0451839_0048735 Ga0451839_0048735_536_820 94
138 3300041503 Ga0451847_0747176 Ga0451847_0747176_236_523 94
139 3300041509 Ga0451843_1619024 Ga0451843_1619024_23_307 94
140 3300041512 Ga0451853_0782077 Ga0451853_0782077_458_760 94
141 3300041512 Ga0451853_2204479 Ga0451853_2204479_267_551 94
142 3300041512 Ga0451853_2561382 Ga0451853_2561382_345_629 94
143 3300042122 Ga0450920_023112 Ga0450920_023112_589_873 94
144 3300042184 Ga0450908_065029 Ga0450908_065029_182_469 94
145 3300042184 Ga0450908_080243 Ga0450908_080243_41_325 94
146 3300044683 Ga0466965_0034272 Ga0466965_0034272_1479_1763 94
147 3300044683 Ga0466965_0822855 Ga0466965_0822855_228_512 94
148 3300046471 Ga0495650_0002266 Ga0495650_0002266_1422_1724 94
149 3300046471 Ga0495650_0186144 Ga0495650_0186144_94_378 94
150 3300046500 Ga0495596_0113216 Ga0495596_0113216_340_624 94
151 3300046515 Ga0495620_0117937 Ga0495620_0117937_614_898 94
152 3300046516 Ga0495628_0211473 Ga0495628_0211473_722_1024 94
153 3300046530 Ga0495654_0336563 Ga0495654_0336563_214_498 94
154 3300047317 Ga0495604_0912937 Ga0495604_0912937_78_380 94
155 3300048904 Ga0496101_1099554 Ga0496101_1099554_128_412 94
156 3300048906 Ga0496103_0682972 Ga0496103_0682972_250_534 94
157 3300048907 Ga0496104_0015930 Ga0496104_0015930_1359_1643 94
158 3300048908 Ga0496105_0013419 Ga0496105_0013419_3924_4208 94
159 3300048908 Ga0496105_0163005 Ga0496105_0163005_406_690 94
160 3300048911 Ga0496108_0019521 Ga0496108_0019521_3015_3299 94
161 3300048912 Ga0496109_0047811 Ga0496109_0047811_808_1092 94
162 3300048913 Ga0496110_0156010 Ga0496110_0156010_922_1206 94
163 3300048916 Ga0496113_0051897 Ga0496113_0051897_1044_1328 94
164 3300048917 Ga0496114_0027278 Ga0496114_0027278_2044_2328 94
165 3300048917 Ga0496114_0048337 Ga0496114_0048337_597_881 94
166 3300048917 Ga0496114_0053166 Ga0496114_0053166_1348_1632 94
167 3300048918 Ga0496115_0103570 Ga0496115_0103570_152_436 94
168 3300048920 Ga0496117_0093280 Ga0496117_0093280_933_1235 94
169 3300048921 Ga0496118_0067954 Ga0496118_0067954_1140_1442 94
170 3300048922 Ga0496119_0001615 Ga0496119_0001615_9057_9359 94
171 3300048922 Ga0496119_0003378 Ga0496119_0003378_9532_9816 94
172 3300048922 Ga0496119_0183636 Ga0496119_0183636_619_903 94
173 3300048923 Ga0496120_0000426 Ga0496120_0000426_36044_36346 94
174 3300048923 Ga0496120_0013004 Ga0496120_0013004_4525_4827 94
175 3300048923 Ga0496120_0022048 Ga0496120_0022048_2497_2799 94
176 3300048925 Ga0496122_0292112 Ga0496122_0292112_171_455 94
177 3300048927 Ga0496124_0879744 Ga0496124_0879744_184_468 94
178 3300048928 Ga0496125_0000077 Ga0496125_0000077_22751_23038 94
179 3300048928 Ga0496125_0333795 Ga0496125_0333795_174_476 94
180 3300048929 Ga0496126_0589782 Ga0496126_0589782_63_365 94
181 3300049569 Ga0501032_0147747 Ga0501032_0147747_629_913 94
182 3300049574 Ga0501038_0190454 Ga0501038_0190454_1151_1435 94
183 3300049574 Ga0501038_1367333 Ga0501038_1367333_171_455 94
184 3300049575 Ga0501039_0218647 Ga0501039_0218647_557_841 94
185 3300049577 Ga0501041_0899676 Ga0501041_0899676_100_384 94
186 3300049579 Ga0501043_0332552 Ga0501043_0332552_487_771 94
187 3300049586 Ga0501070_0017544 Ga0501070_0017544_5127_5411 94
188 3300049586 Ga0501070_0229316 Ga0501070_0229316_455_739 94
189 3300050490 nmdc:mga03n38_28233_c1 nmdc:mga03n38_28233_c1_1588_1872 94
190 3300050492 nmdc:mga0yw44_184383_c1 nmdc:mga0yw44_184383_c1_438_722 94
191 3300050494 nmdc:mga06z11_17380_c1 nmdc:mga06z11_17380_c1_2105_2389 94
192 3300050496 nmdc:mga07m45_61432_c1 nmdc:mga07m45_61432_c1_418_702 94
193 3300050516 nmdc:mga0sz30_26778_c1 nmdc:mga0sz30_26778_c1_836_1120 94
194 3300053080 Ga0500635_0017018 Ga0500635_0017018_1329_1631 94
195 3300053085 Ga0495619_1072503 Ga0495619_1072503_72_356 94
196 3300053093 Ga0500651_0000368 Ga0500651_0000368_9806_10108 94
197 3300053120 Ga0500597_216000 Ga0500597_216000_284_586 94
198 3300053148 Ga0500590_031525 Ga0500590_031525_1514_1816 94
199 3300053155 Ga0500620_000046 Ga0500620_000046_21004_21306 94
200 3300002738 JGI25154J39366_1004067 JGI25154J39366_10040674 95
201 3300003578 Ga0006562J51391_1026342 Ga0006562J51391_10263422 95
202 3300003578 Ga0006562J51391_1026344 Ga0006562J51391_10263443 95
203 3300003578 Ga0006562J51391_1026347 Ga0006562J51391_10263472 95
204 3300003758 Ga0055532_1030364 Ga0055532_10303641 95
205 3300003760 Ga0055527_1000012 Ga0055527_1000012288 95
206 3300003762 Ga0055542_1000017 Ga0055542_1000017288 95
207 3300003763 Ga0055529_1000023 Ga0055529_1000023255 95
208 3300005288 Ga0065714_10384528 Ga0065714_103845281 95
209 3300005327 Ga0070658_10169153 Ga0070658_101691533 95
210 3300005337 Ga0070682_100985395 Ga0070682_1009853952 95
211 3300005355 Ga0070671_100082053 Ga0070671_1000820531 95
212 3300005366 Ga0070659_100090424 Ga0070659_1000904244 95
213 3300005455 Ga0070663_100091425 Ga0070663_1000914251 95
214 3300005456 Ga0070678_100835577 Ga0070678_1008355772 95
215 3300005539 Ga0068853_100465486 Ga0068853_1004654862 95
216 3300005614 Ga0068856_100071190 Ga0068856_1000711902 95
217 3300005618 Ga0068864_100509991 Ga0068864_1005099912 95
218 3300005719 Ga0068861_100268621 Ga0068861_1002686212 95
219 3300005840 Ga0068870_10119127 Ga0068870_101191272 95
220 3300006038 Ga0075365_11308863 Ga0075365_113088631 95
221 3300006051 Ga0075364_10121821 Ga0075364_101218213 95
222 3300006051 Ga0075364_10599313 Ga0075364_105993132 95
223 3300006186 Ga0075369_10318850 Ga0075369_103188502 95
224 3300009094 Ga0111539_10403600 Ga0111539_104036002 95
225 3300009148 Ga0105243_11984989 Ga0105243_119849892 95
226 3300009553 Ga0105249_10297836 Ga0105249_102978362 95
227 3300011119 Ga0105246_10303245 Ga0105246_103032452 95
228 3300011119 Ga0105246_11056787 Ga0105246_110567872 95
229 3300013105 Ga0157369_10000573 Ga0157369_100005736 95
230 3300013105 Ga0157369_10082343 Ga0157369_100823435 95
231 3300013105 Ga0157369_10222301 Ga0157369_102223013 95
232 3300013306 Ga0163162_10767961 Ga0163162_107679612 95
233 3300013306 Ga0163162_11093278 Ga0163162_110932782 95
234 3300013307 Ga0157372_10731544 Ga0157372_107315442 95
235 3300013307 Ga0157372_13253646 Ga0157372_132536462 95
236 3300013308 Ga0157375_11938424 Ga0157375_119384242 95
237 3300014325 Ga0163163_10435396 Ga0163163_104353962 95
238 3300014326 Ga0157380_10106930 Ga0157380_101069303 95
239 3300020069 Ga0197907_11201786 Ga0197907_112017866 95
240 3300020070 Ga0206356_11288880 Ga0206356_112888802 95
241 3300020076 Ga0206355_1601115 Ga0206355_16011152 95
242 3300020082 Ga0206353_10173718 Ga0206353_101737181 95
243 3300025228 Ga0209672_100003 Ga0209672_10000358 95
244 3300025229 Ga0209147_101360 Ga0209147_1013606 95
245 3300025230 Ga0209563_101072 Ga0209563_1010724 95
246 3300025246 Ga0209646_1000168 Ga0209646_10001687 95
247 3300025254 Ga0209148_1000004 Ga0209148_1000004353 95
248 3300025261 Ga0209233_1074936 Ga0209233_10749362 95
249 3300025272 Ga0209455_1000022 Ga0209455_1000022631 95
250 3300025272 Ga0209455_1002580 Ga0209455_10025803 95
251 3300025904 Ga0207647_10135484 Ga0207647_101354842 95
252 3300025908 Ga0207643_10085229 Ga0207643_100852292 95
253 3300025909 Ga0207705_10000001 Ga0207705_100000018 95
254 3300025909 Ga0207705_10538793 Ga0207705_105387932 95
255 3300025919 Ga0207657_10053818 Ga0207657_100538183 95
256 3300025949 Ga0207667_10017962 Ga0207667_100179626 95
257 3300025949 Ga0207667_10510330 Ga0207667_105103301 95
258 3300025961 Ga0207712_10190476 Ga0207712_101904762 95
259 3300026041 Ga0207639_11644259 Ga0207639_116442592 95
260 3300026067 Ga0207678_10159170 Ga0207678_101591701 95
261 3300026095 Ga0207676_11781914 Ga0207676_117819142 95
262 3300026116 Ga0207674_10775640 Ga0207674_107756402 95
263 3300026118 Ga0207675_100431972 Ga0207675_1004319722 95
264 3300026121 Ga0207683_10078079 Ga0207683_100780793 95
265 3300028380 Ga0268265_11680379 Ga0268265_116803792 95
266 3300031548 Ga0307408_102147896 Ga0307408_1021478961 95
267 3300031903 Ga0307407_11582351 Ga0307407_115823512 95
268 3300031995 Ga0307409_101276306 Ga0307409_1012763062 95
269 3300032002 Ga0307416_100272919 Ga0307416_1002729193 95
270 3300032002 Ga0307416_103335126 Ga0307416_1033351261 95
271 3300032004 Ga0307414_10255144 Ga0307414_102551443 95
272 3300032004 Ga0307414_10382773 Ga0307414_103827732 95
273 3300032004 Ga0307414_11064905 Ga0307414_110649052 95
274 3300032004 Ga0307414_11245947 Ga0307414_112459471 95
275 3300032004 Ga0307414_11358925 Ga0307414_113589252 95
276 3300037312 Ga0395899_0068951 Ga0395899_0068951_936_1235 95
277 3300037312 Ga0395899_0706820 Ga0395899_0706820_18_317 95
278 3300037418 Ga0395900_0005052 Ga0395900_0005052_8153_8452 95
279 3300037418 Ga0395900_0080746 Ga0395900_0080746_2164_2463 95
280 3300037466 Ga0395898_0000473 Ga0395898_0000473_54738_55037 95
281 3300037466 Ga0395898_0733469 Ga0395898_0733469_396_695 95
282 3300044658 Ga0466972_0066840 Ga0466972_0066840_525_824 95
283 3300044658 Ga0466972_0261858 Ga0466972_0261858_26_331 95
284 3300044683 Ga0466965_0112109 Ga0466965_0112109_179_478 95
285 3300044693 Ga0466961_0046375 Ga0466961_0046375_444_743 95
286 3300044765 Ga0466970_0162029 Ga0466970_0162029_529_828 95
287 3300044842 Ga0466957_0653257 Ga0466957_0653257_158_457 95
288 3300044901 Ga0466960_0048660 Ga0466960_0048660_969_1268 95
289 3300045049 Ga0466959_0051547 Ga0466959_0051547_2325_2624 95
290 3300046615 Ga0495656_0255393 Ga0495656_0255393_58_366 95
291 3300046689 Ga0495613_0489769 Ga0495613_0489769_41_349 95
292 3300048903 Ga0496100_0395630 Ga0496100_0395630_49_348 95
293 3300048904 Ga0496101_0153550 Ga0496101_0153550_795_1094 95
294 3300048905 Ga0496102_0319012 Ga0496102_0319012_716_1024 95
295 3300048906 Ga0496103_0237716 Ga0496103_0237716_571_879 95
296 3300048907 Ga0496104_0066024 Ga0496104_0066024_351_650 95
297 3300048908 Ga0496105_0134271 Ga0496105_0134271_408_707 95
298 3300048908 Ga0496105_0212088 Ga0496105_0212088_828_1127 95
299 3300048912 Ga0496109_0245184 Ga0496109_0245184_687_995 95
300 3300048916 Ga0496113_0242836 Ga0496113_0242836_881_1189 95
301 3300048917 Ga0496114_0032174 Ga0496114_0032174_3664_3963 95
302 3300048918 Ga0496115_0004310 Ga0496115_0004310_3435_3734 95
303 3300048918 Ga0496115_0045138 Ga0496115_0045138_2940_3239 95
304 3300048918 Ga0496115_1253435 Ga0496115_1253435_32_331 95
305 3300048919 Ga0496116_0450194 Ga0496116_0450194_198_509 95
306 3300048920 Ga0496117_0000321 Ga0496117_0000321_78806_79102 95
307 3300048920 Ga0496117_0018496 Ga0496117_0018496_794_1105 95
308 3300048920 Ga0496117_0119393 Ga0496117_0119393_252_563 95
309 3300048921 Ga0496118_0024944 Ga0496118_0024944_1315_1626 95
310 3300048925 Ga0496122_0004360 Ga0496122_0004360_4428_4724 95
311 3300048929 Ga0496126_0638025 Ga0496126_0638025_324_623 95
312 3300049571 Ga0501034_0017981 Ga0501034_0017981_6679_6990 95
313 3300049571 Ga0501034_0021573 Ga0501034_0021573_2193_2492 95
314 3300049572 Ga0501036_0862561 Ga0501036_0862561_80_379 95
315 3300049573 Ga0501037_0021825 Ga0501037_0021825_4355_4666 95
316 3300049579 Ga0501043_0001096 Ga0501043_0001096_6935_7246 95
317 3300049579 Ga0501043_0047085 Ga0501043_0047085_2065_2364 95
318 3300049580 Ga0501046_0008111 Ga0501046_0008111_28_327 95
319 3300049580 Ga0501046_0700607 Ga0501046_0700607_34_345 95
320 3300049581 Ga0501047_0037302 Ga0501047_0037302_4204_4515 95
321 3300049581 Ga0501047_0050446 Ga0501047_0050446_957_1256 95
322 3300049581 Ga0501047_0063986 Ga0501047_0063986_3036_3335 95
323 3300049585 Ga0501069_0080951 Ga0501069_0080951_261_572 95
324 3300049586 Ga0501070_0000100 Ga0501070_0000100_8171_8470 95
325 3300049586 Ga0501070_0002712 Ga0501070_0002712_7159_7470 95
326 3300049593 Ga0501077_0094532 Ga0501077_0094532_1294_1605 95
327 3300049742 Ga0501080_0000083 Ga0501080_0000083_10032_10343 95
328 3300049744 Ga0501083_0003662 Ga0501083_0003662_4287_4598 95
329 3300049822 Ga0501035_0566043 Ga0501035_0566043_425_736 95
330 3300049823 Ga0501044_0038144 Ga0501044_0038144_3151_3450 95
331 3300050491 nmdc:mga00v17_529527_c1 nmdc:mga00v17_529527_c1_152_439 95
332 3300050491 nmdc:mga00v17_92200_c1 nmdc:mga00v17_92200_c1_622_912 95
333 3300050509 nmdc:mga0qj67_1401880_c1 nmdc:mga0qj67_1401880_c1_62_370 95
334 3300050511 nmdc:mga08y16_1345270_c1 nmdc:mga08y16_1345270_c1_282_590 95
335 3300053080 Ga0500635_0000010 Ga0500635_0000010_42054_42356 95
336 3300053136 Ga0500559_0017157 Ga0500559_0017157_111_425 95
337 3300053140 Ga0500573_0000001 Ga0500573_0000001_371841_372149 95
338 3300053153 Ga0500616_0000078 Ga0500616_0000078_4769_5065 95
339 3300054114 Ga0501084_0152871 Ga0501084_0152871_1487_1798 95
340 3300060353 Ga0501082_1842708 Ga0501082_1842708_120_431 95

Structural Annotation

Top 5 Hits

ID Description Score Start End
6ti8-assembly1.cif.gz_A irak4 in complex with inhibitor 0.816 26 41
2l30-assembly1.cif.gz_A human parp-1 zinc finger 1 0.6963 38 94
5y5d-assembly1.cif.gz_B the crystal structure of vreh2 mutant m263w 0.696 25 42
5xmd-assembly2.cif.gz_D-3 crystal structure of epoxide hydrolase vreh1 from vigna radiata 0.6946 25 42
1uw0-assembly1.cif.gz_A solution structure of the zinc-finger domain from dna ligase iiia 0.6936 34 92
ID Description Score Start End Superfamily
af_Q58475_1_473_3.60.120.10 Alpha Beta;4-Layer Sandwich;Anthranilate synthase;Anthranilate synthase 0.8965 26 41 3.60.120.10
3c8cB01 Alpha Beta;2-Layer Sandwich;Beta-Lactamase;PAS domain 0.8703 26 40 3.30.450.20
af_A0A1D6H4H3_345_449_3.30.200.20 Alpha Beta;2-Layer Sandwich;Phosphorylase Kinase; domain 1;Phosphorylase Kinase; domain 1 0.8347 26 42 3.30.200.20
af_A0A1D8PTK4_4_109_3.30.230.100 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2; 0.7667 25 41 3.30.230.100
af_P51556_198_253_3.30.60.20 Alpha Beta;2-Layer Sandwich;Wheat Germ Agglutinin (Isolectin 2); domain 1; 0.7591 38 95 3.30.60.20
ID Description Score Start End GO Terms
AF-A0A7X7G8L3-F1-model_v4 ATP/GTP-binding protein 0.9676 34 93
AF-A0A520XZD8-F1-model_v4 ATP/GTP-binding protein 0.9615 36 94
AF-A0A6L6CVW9-F1-model_v4 ATP/GTP-binding protein 0.958 36 95
AF-A0A4P5RYH8-F1-model_v4 ATP/GTP-binding protein 0.9575 36 94
AF-A0A6J6UJC7-F1-model_v4 Unannotated protein 0.9572 36 95

Feature Viewer

pLDDT pTM Quality
77 0.6 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map