F414399
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 340 | 214 | 318 | 98 |
Family's Representative Sequence
| Representative Sequence | 3300031901|Ga0307406_11047451|Ga0307406_110474512 |
| Length | 110 |
| Sequence | VRSLGALAERGLVLTAMPRSNRRRPDSSGDDSFERLLAGWKRTETRRGVDWIVQPVSAVQAQKSYICPGCGRTVDAGVAHLVAWRADGVLGDRADLAARRHWHQHCWKTA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2643221549 | Agromyces sp. Root1464 | Isolate | Unclassified |
| 2 | 2643221566 | Microbacterium sp. Root166 | Isolate | Unclassified |
| 3 | 2643221597 | Microbacterium sp. Root180 | Isolate | Unclassified |
| 4 | 2643221619 | Agromyces sp. Root81 | Isolate | Unclassified |
| 5 | 2773857763 | Microbacterium sp. SAI-030 | Isolate | Unclassified |
| 6 | 2808606368 | Microbacterium sp. SLBN-1 | Isolate | Unclassified |
| 7 | 2808606447 | Microbacterium sp. HAR-UPW-R2A-48 | Isolate | Unclassified |
| 8 | 2811994872 | Microbacterium sp. MU4Y-5-1 | Isolate | Unclassified |
| 9 | 2833709550 | Microbacterium sp. 3290 | Isolate | Rhizosphere |
| 10 | 2844841374 | Leifsonia soli DSM 23871 | Isolate | Rhizosphere |
| 11 | 2844852863 | Herbiconiux flava DSM 26474 | Isolate | Rhizosphere |
| 12 | 2852632344 | Microbacterium sp. AK009 | Isolate | Rhizosphere |
| 13 | 2870628048 | Microbacterium thalassium DSM 12511 | Isolate | Rhizosphere |
| 14 | 2919055335 | Leifsonia sp. 1010 | Isolate | Rhizosphere |
| 15 | 2919443155 | Agromyces sp. 3263 | Isolate | Rhizosphere |
| 16 | 2919523602 | Leifsonia shinshuensis 3821 | Isolate | Unclassified |
| 17 | 2928090899 | Microbacterium sp. 1262 | Isolate | Rhizosphere |
| 18 | 2928153084 | Leifsonia sp. 563 | Isolate | Unclassified |
| 19 | 2977251589 | Microbacterium sp. SORGH_AS 505 | Isolate | Unclassified |
| 20 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 21 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 22 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 23 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 24 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 25 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 26 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 27 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 29 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 30 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 31 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 37 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 38 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 39 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 40 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 41 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 42 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 43 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 44 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 45 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 46 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 47 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 48 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 49 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 50 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 51 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 52 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 53 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300013250 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 | Metagenome | Rhizosphere |
| 68 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 75 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 76 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 77 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 78 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 79 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 80 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 81 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 82 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 83 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 84 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 85 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 86 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 112 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 113 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 114 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 115 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 116 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 117 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 118 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 119 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 120 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 121 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 122 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 123 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 124 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 125 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 126 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 127 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 128 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 129 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 130 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 131 | 3300041503 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG | Metagenome | Unclassified |
| 132 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 133 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 134 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 135 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 136 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 137 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 138 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 139 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 140 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 141 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 142 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 143 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 152 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 153 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 154 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 155 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 156 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 157 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 158 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 159 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 160 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 161 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 162 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 163 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 164 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 165 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 166 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 167 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 168 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 169 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 170 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 171 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 172 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 173 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 174 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 175 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 176 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 177 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 178 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 179 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 180 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 181 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 182 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 183 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 184 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 185 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 186 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 187 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 188 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 189 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 190 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 191 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 192 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 193 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 194 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 195 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 196 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 197 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 198 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 199 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 200 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 201 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 202 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 204 | 3300053120 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere | Metagenome | Endosphere |
| 205 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 206 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 207 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 208 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 209 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 210 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 211 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 212 | 8004182704 | Microbacterium paraoxydans ku-mp | Isolate | Unclassified |
| 213 | 8045830549 | Microbacterium yannicii DSM 23203 | Isolate | Unclassified |
| 214 | 8057345674 | Herbiconiux aconitum CPCC 205763 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 90.88 |
| Metatranscriptomes | 2.65 |
| Isolates | 6.47 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 11.76 |
| Nodule | 0 |
| Rhizoplane | 10.88 |
| Rhizosphere | 61.47 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 15.88 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25154J39366_1004067 | 3300002738 | Bacteria | 2768 |
| 2 | Ga0006562J51391_1026342 | 3300003578 | Bacteria | 1656 |
| 3 | Ga0006562J51391_1026344 | 3300003578 | Bacteria | 2550 |
| 4 | Ga0006562J51391_1026347 | 3300003578 | Bacteria | 1610 |
| 5 | Ga0055532_1030364 | 3300003758 | Bacteria | 504 |
| 6 | Ga0055527_1000012 | 3300003760 | Bacteria | 348744 |
| 7 | Ga0055542_1000017 | 3300003762 | Bacteria | 348744 |
| 8 | Ga0055529_1000023 | 3300003763 | Bacteria | 314383 |
| 9 | Ga0065714_10384528 | 3300005288 | Bacteria | 603 |
| 10 | Ga0070658_10169153 | 3300005327 | Bacteria | 1836 |
| 11 | Ga0070690_100208093 | 3300005330 | Bacteria | 1364 |
| 12 | Ga0070682_100985395 | 3300005337 | Bacteria | 698 |
| 13 | Ga0068868_101234769 | 3300005338 | Bacteria | 692 |
| 14 | Ga0070668_100892642 | 3300005347 | Bacteria | 794 |
| 15 | Ga0070671_100082053 | 3300005355 | Bacteria | 2696 |
| 16 | Ga0070659_100000149 | 3300005366 | Bacteria | 53509 |
| 17 | Ga0070659_100090424 | 3300005366 | Bacteria | 2453 |
| 18 | Ga0070659_100864091 | 3300005366 | Bacteria | 789 |
| 19 | Ga0070663_100091425 | 3300005455 | Bacteria | 2255 |
| 20 | Ga0070678_100529176 | 3300005456 | Bacteria | 1044 |
| 21 | Ga0070678_100835577 | 3300005456 | Bacteria | 838 |
| 22 | Ga0070685_10083871 | 3300005466 | Bacteria | 1915 |
| 23 | Ga0068853_100465486 | 3300005539 | Bacteria | 1190 |
| 24 | Ga0068853_102285297 | 3300005539 | Bacteria | 524 |
| 25 | Ga0068855_100212605 | 3300005563 | Bacteria | 2172 |
| 26 | Ga0068855_100371818 | 3300005563 | Bacteria | 1571 |
| 27 | Ga0068855_101032891 | 3300005563 | Bacteria | 862 |
| 28 | Ga0068857_101791801 | 3300005577 | Bacteria | 601 |
| 29 | Ga0068854_100234077 | 3300005578 | Bacteria | 1459 |
| 30 | Ga0068856_100071190 | 3300005614 | Bacteria | 3442 |
| 31 | Ga0068856_100193955 | 3300005614 | Bacteria | 2045 |
| 32 | Ga0068852_102335792 | 3300005616 | Bacteria | 556 |
| 33 | Ga0068864_100509991 | 3300005618 | Bacteria | 1158 |
| 34 | Ga0068861_100268621 | 3300005719 | Bacteria | 1464 |
| 35 | Ga0068870_10119127 | 3300005840 | Bacteria | 1518 |
| 36 | Ga0068863_100225606 | 3300005841 | Bacteria | 1806 |
| 37 | Ga0075365_10001327 | 3300006038 | Bacteria | 11065 |
| 38 | Ga0075365_11308863 | 3300006038 | Bacteria | 509 |
| 39 | Ga0075363_100205191 | 3300006048 | Bacteria | 1127 |
| 40 | Ga0075364_10121821 | 3300006051 | Bacteria | 1746 |
| 41 | Ga0075364_10241858 | 3300006051 | Bacteria | 1226 |
| 42 | Ga0075364_10599313 | 3300006051 | Bacteria | 753 |
| 43 | Ga0075364_10814538 | 3300006051 | Bacteria | 636 |
| 44 | Ga0075367_10002202 | 3300006178 | Bacteria | 8793 |
| 45 | Ga0075369_10012204 | 3300006186 | Bacteria | 3393 |
| 46 | Ga0075369_10318850 | 3300006186 | Bacteria | 727 |
| 47 | Ga0075370_10175100 | 3300006353 | Bacteria | 1262 |
| 48 | Ga0105240_10002898 | 3300009093 | Bacteria | 27065 |
| 49 | Ga0105240_10046352 | 3300009093 | Bacteria | 5509 |
| 50 | Ga0105240_10519788 | 3300009093 | Bacteria | 1321 |
| 51 | Ga0111539_10403600 | 3300009094 | Bacteria | 1592 |
| 52 | Ga0105245_10083496 | 3300009098 | Bacteria | 2924 |
| 53 | Ga0105245_10092206 | 3300009098 | Bacteria | 2789 |
| 54 | Ga0105247_10227602 | 3300009101 | Bacteria | 1265 |
| 55 | Ga0105247_10533682 | 3300009101 | Bacteria | 860 |
| 56 | Ga0105243_11984989 | 3300009148 | Bacteria | 616 |
| 57 | Ga0105241_10003266 | 3300009174 | Bacteria | 12064 |
| 58 | Ga0105241_12687106 | 3300009174 | Bacteria | 501 |
| 59 | Ga0105248_10000681 | 3300009177 | Bacteria | 38440 |
| 60 | Ga0105248_10037804 | 3300009177 | Bacteria | 5402 |
| 61 | Ga0105237_10012819 | 3300009545 | Bacteria | 8817 |
| 62 | Ga0105237_10079034 | 3300009545 | Bacteria | 3279 |
| 63 | Ga0105238_10292539 | 3300009551 | Bacteria | 1611 |
| 64 | Ga0105249_10297836 | 3300009553 | Bacteria | 1616 |
| 65 | Ga0105239_10049608 | 3300010375 | Bacteria | 4602 |
| 66 | Ga0105239_10737003 | 3300010375 | Bacteria | 1128 |
| 67 | Ga0105239_10800413 | 3300010375 | Bacteria | 1080 |
| 68 | Ga0105239_11049005 | 3300010375 | Bacteria | 938 |
| 69 | Ga0105239_11584520 | 3300010375 | Bacteria | 757 |
| 70 | Ga0105246_10303245 | 3300011119 | Bacteria | 1291 |
| 71 | Ga0105246_11056787 | 3300011119 | Bacteria | 739 |
| 72 | Ga0157370_11447668 | 3300013104 | Bacteria | 618 |
| 73 | Ga0157369_10000573 | 3300013105 | Bacteria | 48456 |
| 74 | Ga0157369_10082343 | 3300013105 | Bacteria | 3443 |
| 75 | Ga0157369_10222301 | 3300013105 | Bacteria | 1976 |
| 76 | Ga0157369_10558047 | 3300013105 | Bacteria | 1183 |
| 77 | Ga0171462_1003 | 3300013250 | Bacteria | 853796 |
| 78 | Ga0163162_10767961 | 3300013306 | Bacteria | 1082 |
| 79 | Ga0163162_11093278 | 3300013306 | Bacteria | 903 |
| 80 | Ga0157372_10027455 | 3300013307 | Bacteria | 6200 |
| 81 | Ga0157372_10731544 | 3300013307 | Bacteria | 1151 |
| 82 | Ga0157372_12039433 | 3300013307 | Bacteria | 659 |
| 83 | Ga0157372_13253646 | 3300013307 | Bacteria | 518 |
| 84 | Ga0157375_11938424 | 3300013308 | Bacteria | 700 |
| 85 | Ga0163163_10435396 | 3300014325 | Bacteria | 1371 |
| 86 | Ga0157380_10106930 | 3300014326 | Bacteria | 2342 |
| 87 | Ga0157380_13090788 | 3300014326 | Bacteria | 531 |
| 88 | Ga0157376_10893861 | 3300014969 | Unclassified | 906 |
| 89 | Ga0157376_10931706 | 3300014969 | Bacteria | 888 |
| 90 | Ga0197907_11201786 | 3300020069 | Bacteria | 4303 |
| 91 | Ga0206356_11288880 | 3300020070 | Bacteria | 853 |
| 92 | Ga0206355_1601115 | 3300020076 | Bacteria | 1063 |
| 93 | Ga0206352_10249236 | 3300020078 | Bacteria | 687 |
| 94 | Ga0206353_10173718 | 3300020082 | Bacteria | 4276 |
| 95 | Ga0206353_11299884 | 3300020082 | Bacteria | 616 |
| 96 | Ga0209672_100003 | 3300025228 | Bacteria | 1560476 |
| 97 | Ga0209147_101360 | 3300025229 | Bacteria | 9191 |
| 98 | Ga0209563_101072 | 3300025230 | Bacteria | 7891 |
| 99 | Ga0209646_1000168 | 3300025246 | Bacteria | 86352 |
| 100 | Ga0209148_1000004 | 3300025254 | Bacteria | 1844481 |
| 101 | Ga0209233_1074936 | 3300025261 | Bacteria | 616 |
| 102 | Ga0209455_1000022 | 3300025272 | Bacteria | 688910 |
| 103 | Ga0209455_1002580 | 3300025272 | Bacteria | 6907 |
| 104 | Ga0207692_10121823 | 3300025898 | Bacteria | 1461 |
| 105 | Ga0207647_10047573 | 3300025904 | Bacteria | 2667 |
| 106 | Ga0207647_10135484 | 3300025904 | Bacteria | 1446 |
| 107 | Ga0207643_10085229 | 3300025908 | Bacteria | 1835 |
| 108 | Ga0207705_10000001 | 3300025909 | Bacteria | 2061880 |
| 109 | Ga0207705_10538793 | 3300025909 | Bacteria | 907 |
| 110 | Ga0207695_10002117 | 3300025913 | Bacteria | 30146 |
| 111 | Ga0207671_10064352 | 3300025914 | Bacteria | 2726 |
| 112 | Ga0207657_10053818 | 3300025919 | Bacteria | 3484 |
| 113 | Ga0207687_10130367 | 3300025927 | Bacteria | 1894 |
| 114 | Ga0207644_10521012 | 3300025931 | Bacteria | 982 |
| 115 | Ga0207691_10138860 | 3300025940 | Bacteria | 2142 |
| 116 | Ga0207711_10007361 | 3300025941 | Bacteria | 9212 |
| 117 | Ga0207711_10196339 | 3300025941 | Bacteria | 1840 |
| 118 | Ga0207667_10017962 | 3300025949 | Bacteria | 7948 |
| 119 | Ga0207667_10295096 | 3300025949 | Bacteria | 1656 |
| 120 | Ga0207667_10510330 | 3300025949 | Bacteria | 1219 |
| 121 | Ga0207712_10190476 | 3300025961 | Bacteria | 1618 |
| 122 | Ga0207668_10408956 | 3300025972 | Bacteria | 1149 |
| 123 | Ga0207640_10288413 | 3300025981 | Bacteria | 1293 |
| 124 | Ga0207677_10998448 | 3300026023 | Bacteria | 759 |
| 125 | Ga0207639_10005804 | 3300026041 | Bacteria | 8362 |
| 126 | Ga0207639_11644259 | 3300026041 | Bacteria | 602 |
| 127 | Ga0207678_10159170 | 3300026067 | Bacteria | 1928 |
| 128 | Ga0207702_10021565 | 3300026078 | Bacteria | 5334 |
| 129 | Ga0207641_10286103 | 3300026088 | Bacteria | 1552 |
| 130 | Ga0207676_11781914 | 3300026095 | Bacteria | 614 |
| 131 | Ga0207674_10574004 | 3300026116 | Bacteria | 1089 |
| 132 | Ga0207674_10775640 | 3300026116 | Bacteria | 925 |
| 133 | Ga0207675_100431972 | 3300026118 | Bacteria | 1302 |
| 134 | Ga0207683_10078079 | 3300026121 | Bacteria | 2933 |
| 135 | Ga0207683_10098552 | 3300026121 | Bacteria | 2608 |
| 136 | Ga0268265_11680379 | 3300028380 | Bacteria | 641 |
| 137 | Ga0307408_100641085 | 3300031548 | Bacteria | 949 |
| 138 | Ga0307408_101467804 | 3300031548 | Bacteria | 644 |
| 139 | Ga0307408_102007458 | 3300031548 | Bacteria | 556 |
| 140 | Ga0307408_102147896 | 3300031548 | Bacteria | 539 |
| 141 | Ga0307514_10286393 | 3300031649 | Bacteria | 937 |
| 142 | Ga0307413_11241352 | 3300031824 | Bacteria | 650 |
| 143 | Ga0307410_11456817 | 3300031852 | Bacteria | 602 |
| 144 | Ga0307406_10158664 | 3300031901 | Bacteria | 1623 |
| 145 | Ga0307406_10795610 | 3300031901 | Bacteria | 797 |
| 146 | Ga0307406_11047451 | 3300031901 | Bacteria | 702 |
| 147 | Ga0307407_10086722 | 3300031903 | Bacteria | 1908 |
| 148 | Ga0307407_11582351 | 3300031903 | Bacteria | 520 |
| 149 | Ga0307412_10243550 | 3300031911 | Bacteria | 1392 |
| 150 | Ga0307409_100490600 | 3300031995 | Bacteria | 1194 |
| 151 | Ga0307409_101276306 | 3300031995 | Bacteria | 759 |
| 152 | Ga0307409_101567180 | 3300031995 | Bacteria | 687 |
| 153 | Ga0307416_100272919 | 3300032002 | Bacteria | 1662 |
| 154 | Ga0307416_103335126 | 3300032002 | Bacteria | 537 |
| 155 | Ga0307414_10255144 | 3300032004 | Bacteria | 1460 |
| 156 | Ga0307414_10382773 | 3300032004 | Bacteria | 1217 |
| 157 | Ga0307414_10738942 | 3300032004 | Bacteria | 894 |
| 158 | Ga0307414_11064905 | 3300032004 | Bacteria | 746 |
| 159 | Ga0307414_11245947 | 3300032004 | Bacteria | 689 |
| 160 | Ga0307414_11357435 | 3300032004 | Bacteria | 660 |
| 161 | Ga0307414_11358925 | 3300032004 | Bacteria | 660 |
| 162 | Ga0307415_100724375 | 3300032126 | Bacteria | 900 |
| 163 | Ga0307415_101270853 | 3300032126 | Bacteria | 696 |
| 164 | Ga0395899_0068951 | 3300037312 | Bacteria | 2591 |
| 165 | Ga0395899_0706820 | 3300037312 | Unclassified | 631 |
| 166 | Ga0395900_0005052 | 3300037418 | Bacteria | 13845 |
| 167 | Ga0395900_0080746 | 3300037418 | Bacteria | 3342 |
| 168 | Ga0395898_0000473 | 3300037466 | Bacteria | 80586 |
| 169 | Ga0395898_0733469 | 3300037466 | Bacteria | 930 |
| 170 | Ga0439465_0229910 | 3300041413 | Bacteria | 682 |
| 171 | Ga0451793_0954298 | 3300041452 | Bacteria | 723 |
| 172 | Ga0451795_0938915 | 3300041456 | Bacteria | 698 |
| 173 | Ga0451807_1104978 | 3300041486 | Bacteria | 550 |
| 174 | Ga0451837_1592894 | 3300041494 | Bacteria | 522 |
| 175 | Ga0451839_0048735 | 3300041496 | Bacteria | 831 |
| 176 | Ga0451847_0747176 | 3300041503 | Bacteria | 778 |
| 177 | Ga0451843_1619024 | 3300041509 | Bacteria | 542 |
| 178 | Ga0451853_0782077 | 3300041512 | Bacteria | 956 |
| 179 | Ga0451853_2204479 | 3300041512 | Bacteria | 563 |
| 180 | Ga0451853_2561382 | 3300041512 | Bacteria | 1612 |
| 181 | Ga0450920_023112 | 3300042122 | Bacteria | 1205 |
| 182 | Ga0450908_065029 | 3300042184 | Bacteria | 644 |
| 183 | Ga0450908_080243 | 3300042184 | Bacteria | 585 |
| 184 | Ga0466972_0066840 | 3300044658 | Bacteria | 1718 |
| 185 | Ga0466972_0261858 | 3300044658 | Bacteria | 808 |
| 186 | Ga0466965_0034272 | 3300044683 | Bacteria | 2483 |
| 187 | Ga0466965_0112109 | 3300044683 | Bacteria | 1402 |
| 188 | Ga0466965_0822855 | 3300044683 | Bacteria | 538 |
| 189 | Ga0466961_0046375 | 3300044693 | Bacteria | 2780 |
| 190 | Ga0466970_0162029 | 3300044765 | Bacteria | 1237 |
| 191 | Ga0466957_0653257 | 3300044842 | Bacteria | 739 |
| 192 | Ga0466960_0048660 | 3300044901 | Bacteria | 2038 |
| 193 | Ga0466959_0051547 | 3300045049 | Bacteria | 3017 |
| 194 | Ga0495650_0002266 | 3300046471 | Bacteria | 16043 |
| 195 | Ga0495650_0186144 | 3300046471 | Bacteria | 728 |
| 196 | Ga0495596_0113216 | 3300046500 | Bacteria | 1054 |
| 197 | Ga0495620_0117937 | 3300046515 | Bacteria | 1048 |
| 198 | Ga0495628_0211473 | 3300046516 | Bacteria | 1459 |
| 199 | Ga0495654_0336563 | 3300046530 | Bacteria | 609 |
| 200 | Ga0495656_0255393 | 3300046615 | Bacteria | 887 |
| 201 | Ga0495613_0489769 | 3300046689 | Bacteria | 829 |
| 202 | Ga0495604_0912937 | 3300047317 | Unclassified | 548 |
| 203 | Ga0496100_0395630 | 3300048903 | Bacteria | 1051 |
| 204 | Ga0496101_0089016 | 3300048904 | Bacteria | 2293 |
| 205 | Ga0496101_0153550 | 3300048904 | Bacteria | 1762 |
| 206 | Ga0496101_1099554 | 3300048904 | Bacteria | 624 |
| 207 | Ga0496102_0120035 | 3300048905 | Bacteria | 2455 |
| 208 | Ga0496102_0319012 | 3300048905 | Bacteria | 1464 |
| 209 | Ga0496103_0237716 | 3300048906 | Bacteria | 1172 |
| 210 | Ga0496103_0682972 | 3300048906 | Bacteria | 651 |
| 211 | Ga0496104_0015930 | 3300048907 | Bacteria | 6822 |
| 212 | Ga0496104_0066024 | 3300048907 | Bacteria | 3435 |
| 213 | Ga0496104_0085455 | 3300048907 | Bacteria | 3011 |
| 214 | Ga0496105_0013419 | 3300048908 | Bacteria | 6503 |
| 215 | Ga0496105_0047371 | 3300048908 | Bacteria | 3547 |
| 216 | Ga0496105_0134271 | 3300048908 | Bacteria | 2039 |
| 217 | Ga0496105_0163005 | 3300048908 | Bacteria | 1830 |
| 218 | Ga0496105_0212088 | 3300048908 | Bacteria | 1578 |
| 219 | Ga0496106_1334753 | 3300048909 | Bacteria | 556 |
| 220 | Ga0496107_0243198 | 3300048910 | Bacteria | 1339 |
| 221 | Ga0496108_0019521 | 3300048911 | Bacteria | 5567 |
| 222 | Ga0496109_0047811 | 3300048912 | Bacteria | 3891 |
| 223 | Ga0496109_0245184 | 3300048912 | Bacteria | 1687 |
| 224 | Ga0496110_0156010 | 3300048913 | Bacteria | 2068 |
| 225 | Ga0496113_0051897 | 3300048916 | Bacteria | 3061 |
| 226 | Ga0496113_0242836 | 3300048916 | Bacteria | 1437 |
| 227 | Ga0496114_0027278 | 3300048917 | Bacteria | 4677 |
| 228 | Ga0496114_0032174 | 3300048917 | Bacteria | 4316 |
| 229 | Ga0496114_0048337 | 3300048917 | Bacteria | 3539 |
| 230 | Ga0496114_0053166 | 3300048917 | Bacteria | 3376 |
| 231 | Ga0496114_0067364 | 3300048917 | Bacteria | 3003 |
| 232 | Ga0496115_0004310 | 3300048918 | Bacteria | 10299 |
| 233 | Ga0496115_0022943 | 3300048918 | Bacteria | 4839 |
| 234 | Ga0496115_0045138 | 3300048918 | Bacteria | 3517 |
| 235 | Ga0496115_0103570 | 3300048918 | Bacteria | 2335 |
| 236 | Ga0496115_1253435 | 3300048918 | Bacteria | 554 |
| 237 | Ga0496116_0450194 | 3300048919 | Bacteria | 552 |
| 238 | Ga0496117_0000321 | 3300048920 | Bacteria | 84088 |
| 239 | Ga0496117_0018496 | 3300048920 | Bacteria | 5765 |
| 240 | Ga0496117_0093280 | 3300048920 | Bacteria | 1931 |
| 241 | Ga0496117_0119393 | 3300048920 | Bacteria | 1623 |
| 242 | Ga0496117_0126642 | 3300048920 | Bacteria | 1557 |
| 243 | Ga0496118_0024944 | 3300048921 | Bacteria | 5145 |
| 244 | Ga0496118_0067954 | 3300048921 | Bacteria | 2591 |
| 245 | Ga0496118_0531894 | 3300048921 | Bacteria | 577 |
| 246 | Ga0496119_0001615 | 3300048922 | Bacteria | 26709 |
| 247 | Ga0496119_0003146 | 3300048922 | Bacteria | 17351 |
| 248 | Ga0496119_0003378 | 3300048922 | Bacteria | 16605 |
| 249 | Ga0496119_0158066 | 3300048922 | Bacteria | 1208 |
| 250 | Ga0496119_0183636 | 3300048922 | Bacteria | 1095 |
| 251 | Ga0496120_0000426 | 3300048923 | Bacteria | 66901 |
| 252 | Ga0496120_0010869 | 3300048923 | Bacteria | 6302 |
| 253 | Ga0496120_0013004 | 3300048923 | Bacteria | 5629 |
| 254 | Ga0496120_0022048 | 3300048923 | Bacteria | 4010 |
| 255 | Ga0496120_0047652 | 3300048923 | Bacteria | 2470 |
| 256 | Ga0496121_0106594 | 3300048924 | Bacteria | 2148 |
| 257 | Ga0496122_0004360 | 3300048925 | Bacteria | 17676 |
| 258 | Ga0496122_0292112 | 3300048925 | Bacteria | 884 |
| 259 | Ga0496124_0879744 | 3300048927 | Bacteria | 546 |
| 260 | Ga0496125_0000077 | 3300048928 | Bacteria | 232629 |
| 261 | Ga0496125_0333795 | 3300048928 | Bacteria | 913 |
| 262 | Ga0496126_0388448 | 3300048929 | Bacteria | 1134 |
| 263 | Ga0496126_0589782 | 3300048929 | Unclassified | 877 |
| 264 | Ga0496126_0638025 | 3300048929 | Bacteria | 835 |
| 265 | Ga0501032_0147747 | 3300049569 | Bacteria | 1547 |
| 266 | Ga0501034_0017981 | 3300049571 | Bacteria | 7251 |
| 267 | Ga0501034_0021573 | 3300049571 | Bacteria | 6561 |
| 268 | Ga0501034_0955578 | 3300049571 | Bacteria | 742 |
| 269 | Ga0501036_0862561 | 3300049572 | Bacteria | 744 |
| 270 | Ga0501036_0980770 | 3300049572 | Bacteria | 692 |
| 271 | Ga0501037_0021825 | 3300049573 | Bacteria | 4738 |
| 272 | Ga0501037_0643925 | 3300049573 | Bacteria | 709 |
| 273 | Ga0501038_0190454 | 3300049574 | Bacteria | 1651 |
| 274 | Ga0501038_1367333 | 3300049574 | Bacteria | 509 |
| 275 | Ga0501039_0218647 | 3300049575 | Bacteria | 1498 |
| 276 | Ga0501041_0899676 | 3300049577 | Bacteria | 569 |
| 277 | Ga0501043_0001096 | 3300049579 | Bacteria | 23797 |
| 278 | Ga0501043_0047085 | 3300049579 | Bacteria | 3390 |
| 279 | Ga0501043_0332552 | 3300049579 | Bacteria | 1157 |
| 280 | Ga0501046_0008111 | 3300049580 | Bacteria | 9176 |
| 281 | Ga0501046_0700607 | 3300049580 | Bacteria | 713 |
| 282 | Ga0501047_0037302 | 3300049581 | Bacteria | 4700 |
| 283 | Ga0501047_0050446 | 3300049581 | Bacteria | 4019 |
| 284 | Ga0501047_0063986 | 3300049581 | Bacteria | 3548 |
| 285 | Ga0501069_0080951 | 3300049585 | Bacteria | 1829 |
| 286 | Ga0501070_0000100 | 3300049586 | Bacteria | 75001 |
| 287 | Ga0501070_0002712 | 3300049586 | Bacteria | 15449 |
| 288 | Ga0501070_0017544 | 3300049586 | Bacteria | 6009 |
| 289 | Ga0501070_0229316 | 3300049586 | Bacteria | 1522 |
| 290 | Ga0501073_1065511 | 3300049589 | Bacteria | 556 |
| 291 | Ga0501077_0094532 | 3300049593 | Bacteria | 1895 |
| 292 | Ga0501080_0000083 | 3300049742 | Bacteria | 63863 |
| 293 | Ga0501083_0003662 | 3300049744 | Bacteria | 10787 |
| 294 | Ga0501035_0566043 | 3300049822 | Bacteria | 929 |
| 295 | Ga0501044_0038144 | 3300049823 | Bacteria | 5018 |
| 296 | nmdc:mga03n38_28233_c1 | 3300050490 | Bacteria | 2336 |
| 297 | nmdc:mga00v17_529527_c1 | 3300050491 | Bacteria | 763 |
| 298 | nmdc:mga00v17_92200_c1 | 3300050491 | Bacteria | 1904 |
| 299 | nmdc:mga0yw44_184383_c1 | 3300050492 | Bacteria | 1375 |
| 300 | nmdc:mga0yw44_838466_c1 | 3300050492 | Bacteria | 624 |
| 301 | nmdc:mga06z11_17380_c1 | 3300050494 | Bacteria | 3263 |
| 302 | nmdc:mga07m45_469751_c1 | 3300050496 | Bacteria | 729 |
| 303 | nmdc:mga07m45_61432_c1 | 3300050496 | Bacteria | 2128 |
| 304 | nmdc:mga0qj67_1401880_c1 | 3300050509 | Bacteria | 539 |
| 305 | nmdc:mga08y16_1345270_c1 | 3300050511 | Bacteria | 679 |
| 306 | nmdc:mga0sz30_26778_c1 | 3300050516 | Bacteria | 2365 |
| 307 | Ga0500635_0000010 | 3300053080 | Bacteria | 147500 |
| 308 | Ga0500635_0017018 | 3300053080 | Bacteria | 2171 |
| 309 | Ga0495619_1072503 | 3300053085 | Bacteria | 537 |
| 310 | Ga0500651_0000368 | 3300053093 | Bacteria | 24842 |
| 311 | Ga0500597_216000 | 3300053120 | Bacteria | 799 |
| 312 | Ga0500559_0017157 | 3300053136 | Bacteria | 3056 |
| 313 | Ga0500573_0000001 | 3300053140 | Bacteria | 436394 |
| 314 | Ga0500590_031525 | 3300053148 | Bacteria | 2749 |
| 315 | Ga0500616_0000078 | 3300053153 | Bacteria | 202009 |
| 316 | Ga0500620_000046 | 3300053155 | Bacteria | 22312 |
| 317 | Ga0501084_0152871 | 3300054114 | Bacteria | 1945 |
| 318 | Ga0501082_1842708 | 3300060353 | Unclassified | 528 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300050492 | nmdc:mga0yw44_838466_c1 | nmdc:mga0yw44_838466_c1_207_551 | 89 |
| 2 | 3300050496 | nmdc:mga07m45_469751_c1 | nmdc:mga07m45_469751_c1_120_464 | 89 |
| 3 | iso_pu_bacteria | 2977251589 | 2977254101 | 89 |
| 4 | 3300025940 | Ga0207691_10138860 | Ga0207691_101388602 | 90 |
| 5 | iso_pu_bacteria | 2643221566 | 2643848556 | 90 |
| 6 | iso_pu_bacteria | 2643221597 | 2643996049 | 90 |
| 7 | iso_pu_bacteria | 2773857763 | 2774399335 | 90 |
| 8 | iso_pu_bacteria | 2808606447 | 2809227568 | 90 |
| 9 | iso_pu_bacteria | 2833709550 | 2833711116 | 90 |
| 10 | iso_pu_bacteria | 2852632344 | 2852634329 | 90 |
| 11 | iso_pu_bacteria | 2870628048 | 2870630508 | 90 |
| 12 | iso_pu_bacteria | 8004182704 | 8004185313 | 90 |
| 13 | iso_pu_bacteria | 8045830549 | 8045831740 | 90 |
| 14 | 3300005539 | Ga0068853_102285297 | Ga0068853_1022852971 | 91 |
| 15 | 3300013105 | Ga0157369_10558047 | Ga0157369_105580472 | 91 |
| 16 | 3300013307 | Ga0157372_10027455 | Ga0157372_100274555 | 91 |
| 17 | 3300025904 | Ga0207647_10047573 | Ga0207647_100475733 | 91 |
| 18 | 3300048904 | Ga0496101_0089016 | Ga0496101_0089016_1922_2221 | 91 |
| 19 | 3300048905 | Ga0496102_0120035 | Ga0496102_0120035_2099_2398 | 91 |
| 20 | 3300048907 | Ga0496104_0085455 | Ga0496104_0085455_462_761 | 91 |
| 21 | 3300048908 | Ga0496105_0047371 | Ga0496105_0047371_1445_1744 | 91 |
| 22 | 3300048909 | Ga0496106_1334753 | Ga0496106_1334753_148_447 | 91 |
| 23 | 3300048910 | Ga0496107_0243198 | Ga0496107_0243198_453_752 | 91 |
| 24 | 3300048917 | Ga0496114_0067364 | Ga0496114_0067364_678_977 | 91 |
| 25 | 3300048918 | Ga0496115_0022943 | Ga0496115_0022943_2944_3243 | 91 |
| 26 | 3300048920 | Ga0496117_0126642 | Ga0496117_0126642_1032_1331 | 91 |
| 27 | 3300048921 | Ga0496118_0531894 | Ga0496118_0531894_92_391 | 91 |
| 28 | 3300048922 | Ga0496119_0158066 | Ga0496119_0158066_860_1159 | 91 |
| 29 | 3300048923 | Ga0496120_0047652 | Ga0496120_0047652_1289_1588 | 91 |
| 30 | 3300048924 | Ga0496121_0106594 | Ga0496121_0106594_1160_1459 | 91 |
| 31 | 3300048929 | Ga0496126_0388448 | Ga0496126_0388448_167_466 | 91 |
| 32 | iso_pu_bacteria | 2643221549 | 2643767959 | 91 |
| 33 | iso_pu_bacteria | 2643221619 | 2644111355 | 91 |
| 34 | iso_pu_bacteria | 2808606368 | 2808885776 | 91 |
| 35 | iso_pu_bacteria | 2811994872 | 2812323369 | 91 |
| 36 | iso_pu_bacteria | 2844841374 | 2844842136 | 91 |
| 37 | iso_pu_bacteria | 2844852863 | 2844854763 | 91 |
| 38 | iso_pu_bacteria | 2919055335 | 2919057782 | 91 |
| 39 | iso_pu_bacteria | 2919443155 | 2919446470 | 91 |
| 40 | iso_pu_bacteria | 2919523602 | 2919524183 | 91 |
| 41 | iso_pu_bacteria | 2928153084 | 2928155649 | 91 |
| 42 | iso_pu_bacteria | 8057345674 | 8057347851 | 91 |
| 43 | 3300048922 | Ga0496119_0003146 | Ga0496119_0003146_12285_12566 | 92 |
| 44 | 3300048923 | Ga0496120_0010869 | Ga0496120_0010869_2274_2555 | 92 |
| 45 | 3300020078 | Ga0206352_10249236 | Ga0206352_102492362 | 93 |
| 46 | 3300049571 | Ga0501034_0955578 | Ga0501034_0955578_298_600 | 93 |
| 47 | 3300049572 | Ga0501036_0980770 | Ga0501036_0980770_310_612 | 93 |
| 48 | 3300049573 | Ga0501037_0643925 | Ga0501037_0643925_142_444 | 93 |
| 49 | 3300049589 | Ga0501073_1065511 | Ga0501073_1065511_101_403 | 93 |
| 50 | iso_pu_bacteria | 2928090899 | 2928092010 | 93 |
| 51 | 3300005330 | Ga0070690_100208093 | Ga0070690_1002080932 | 94 |
| 52 | 3300005338 | Ga0068868_101234769 | Ga0068868_1012347692 | 94 |
| 53 | 3300005347 | Ga0070668_100892642 | Ga0070668_1008926422 | 94 |
| 54 | 3300005366 | Ga0070659_100000149 | Ga0070659_10000014946 | 94 |
| 55 | 3300005366 | Ga0070659_100864091 | Ga0070659_1008640912 | 94 |
| 56 | 3300005456 | Ga0070678_100529176 | Ga0070678_1005291762 | 94 |
| 57 | 3300005466 | Ga0070685_10083871 | Ga0070685_100838713 | 94 |
| 58 | 3300005563 | Ga0068855_100212605 | Ga0068855_1002126051 | 94 |
| 59 | 3300005563 | Ga0068855_100371818 | Ga0068855_1003718182 | 94 |
| 60 | 3300005563 | Ga0068855_101032891 | Ga0068855_1010328912 | 94 |
| 61 | 3300005577 | Ga0068857_101791801 | Ga0068857_1017918012 | 94 |
| 62 | 3300005578 | Ga0068854_100234077 | Ga0068854_1002340772 | 94 |
| 63 | 3300005614 | Ga0068856_100193955 | Ga0068856_1001939554 | 94 |
| 64 | 3300005616 | Ga0068852_102335792 | Ga0068852_1023357921 | 94 |
| 65 | 3300005841 | Ga0068863_100225606 | Ga0068863_1002256062 | 94 |
| 66 | 3300006038 | Ga0075365_10001327 | Ga0075365_100013279 | 94 |
| 67 | 3300006048 | Ga0075363_100205191 | Ga0075363_1002051912 | 94 |
| 68 | 3300006051 | Ga0075364_10241858 | Ga0075364_102418582 | 94 |
| 69 | 3300006051 | Ga0075364_10814538 | Ga0075364_108145382 | 94 |
| 70 | 3300006178 | Ga0075367_10002202 | Ga0075367_100022029 | 94 |
| 71 | 3300006186 | Ga0075369_10012204 | Ga0075369_100122043 | 94 |
| 72 | 3300006353 | Ga0075370_10175100 | Ga0075370_101751002 | 94 |
| 73 | 3300009093 | Ga0105240_10002898 | Ga0105240_100028982 | 94 |
| 74 | 3300009093 | Ga0105240_10046352 | Ga0105240_100463522 | 94 |
| 75 | 3300009093 | Ga0105240_10519788 | Ga0105240_105197881 | 94 |
| 76 | 3300009098 | Ga0105245_10083496 | Ga0105245_100834963 | 94 |
| 77 | 3300009098 | Ga0105245_10092206 | Ga0105245_100922062 | 94 |
| 78 | 3300009101 | Ga0105247_10227602 | Ga0105247_102276022 | 94 |
| 79 | 3300009101 | Ga0105247_10533682 | Ga0105247_105336822 | 94 |
| 80 | 3300009174 | Ga0105241_10003266 | Ga0105241_1000326614 | 94 |
| 81 | 3300009174 | Ga0105241_12687106 | Ga0105241_126871061 | 94 |
| 82 | 3300009177 | Ga0105248_10000681 | Ga0105248_1000068112 | 94 |
| 83 | 3300009177 | Ga0105248_10037804 | Ga0105248_100378046 | 94 |
| 84 | 3300009545 | Ga0105237_10012819 | Ga0105237_100128196 | 94 |
| 85 | 3300009545 | Ga0105237_10079034 | Ga0105237_100790344 | 94 |
| 86 | 3300009551 | Ga0105238_10292539 | Ga0105238_102925393 | 94 |
| 87 | 3300010375 | Ga0105239_10049608 | Ga0105239_100496082 | 94 |
| 88 | 3300010375 | Ga0105239_10737003 | Ga0105239_107370032 | 94 |
| 89 | 3300010375 | Ga0105239_10800413 | Ga0105239_108004132 | 94 |
| 90 | 3300010375 | Ga0105239_11049005 | Ga0105239_110490052 | 94 |
| 91 | 3300010375 | Ga0105239_11584520 | Ga0105239_115845202 | 94 |
| 92 | 3300013104 | Ga0157370_11447668 | Ga0157370_114476682 | 94 |
| 93 | 3300013250 | Ga0171462_1003 | Ga0171462_1003242 | 94 |
| 94 | 3300013307 | Ga0157372_12039433 | Ga0157372_120394332 | 94 |
| 95 | 3300014326 | Ga0157380_13090788 | Ga0157380_130907881 | 94 |
| 96 | 3300014969 | Ga0157376_10893861 | Ga0157376_108938612 | 94 |
| 97 | 3300014969 | Ga0157376_10931706 | Ga0157376_109317062 | 94 |
| 98 | 3300020082 | Ga0206353_11299884 | Ga0206353_112998842 | 94 |
| 99 | 3300025898 | Ga0207692_10121823 | Ga0207692_101218232 | 94 |
| 100 | 3300025913 | Ga0207695_10002117 | Ga0207695_1000211720 | 94 |
| 101 | 3300025914 | Ga0207671_10064352 | Ga0207671_100643522 | 94 |
| 102 | 3300025927 | Ga0207687_10130367 | Ga0207687_101303672 | 94 |
| 103 | 3300025931 | Ga0207644_10521012 | Ga0207644_105210122 | 94 |
| 104 | 3300025941 | Ga0207711_10007361 | Ga0207711_100073612 | 94 |
| 105 | 3300025941 | Ga0207711_10196339 | Ga0207711_101963393 | 94 |
| 106 | 3300025949 | Ga0207667_10295096 | Ga0207667_102950962 | 94 |
| 107 | 3300025972 | Ga0207668_10408956 | Ga0207668_104089562 | 94 |
| 108 | 3300025981 | Ga0207640_10288413 | Ga0207640_102884132 | 94 |
| 109 | 3300026023 | Ga0207677_10998448 | Ga0207677_109984482 | 94 |
| 110 | 3300026041 | Ga0207639_10005804 | Ga0207639_100058042 | 94 |
| 111 | 3300026078 | Ga0207702_10021565 | Ga0207702_100215656 | 94 |
| 112 | 3300026088 | Ga0207641_10286103 | Ga0207641_102861032 | 94 |
| 113 | 3300026116 | Ga0207674_10574004 | Ga0207674_105740042 | 94 |
| 114 | 3300026121 | Ga0207683_10098552 | Ga0207683_100985522 | 94 |
| 115 | 3300031548 | Ga0307408_100641085 | Ga0307408_1006410852 | 94 |
| 116 | 3300031548 | Ga0307408_101467804 | Ga0307408_1014678042 | 94 |
| 117 | 3300031548 | Ga0307408_102007458 | Ga0307408_1020074582 | 94 |
| 118 | 3300031649 | Ga0307514_10286393 | Ga0307514_102863931 | 94 |
| 119 | 3300031824 | Ga0307413_11241352 | Ga0307413_112413522 | 94 |
| 120 | 3300031852 | Ga0307410_11456817 | Ga0307410_114568171 | 94 |
| 121 | 3300031901 | Ga0307406_10158664 | Ga0307406_101586642 | 94 |
| 122 | 3300031901 | Ga0307406_10795610 | Ga0307406_107956102 | 94 |
| 123 | 3300031901 | Ga0307406_11047451 | Ga0307406_110474512 | 94 |
| 124 | 3300031903 | Ga0307407_10086722 | Ga0307407_100867222 | 94 |
| 125 | 3300031911 | Ga0307412_10243550 | Ga0307412_102435503 | 94 |
| 126 | 3300031995 | Ga0307409_100490600 | Ga0307409_1004906002 | 94 |
| 127 | 3300031995 | Ga0307409_101567180 | Ga0307409_1015671802 | 94 |
| 128 | 3300032004 | Ga0307414_10738942 | Ga0307414_107389422 | 94 |
| 129 | 3300032004 | Ga0307414_11357435 | Ga0307414_113574352 | 94 |
| 130 | 3300032126 | Ga0307415_100724375 | Ga0307415_1007243752 | 94 |
| 131 | 3300032126 | Ga0307415_101270853 | Ga0307415_1012708531 | 94 |
| 132 | 3300041413 | Ga0439465_0229910 | Ga0439465_0229910_273_557 | 94 |
| 133 | 3300041452 | Ga0451793_0954298 | Ga0451793_0954298_394_678 | 94 |
| 134 | 3300041456 | Ga0451795_0938915 | Ga0451795_0938915_370_672 | 94 |
| 135 | 3300041486 | Ga0451807_1104978 | Ga0451807_1104978_179_463 | 94 |
| 136 | 3300041494 | Ga0451837_1592894 | Ga0451837_1592894_214_498 | 94 |
| 137 | 3300041496 | Ga0451839_0048735 | Ga0451839_0048735_536_820 | 94 |
| 138 | 3300041503 | Ga0451847_0747176 | Ga0451847_0747176_236_523 | 94 |
| 139 | 3300041509 | Ga0451843_1619024 | Ga0451843_1619024_23_307 | 94 |
| 140 | 3300041512 | Ga0451853_0782077 | Ga0451853_0782077_458_760 | 94 |
| 141 | 3300041512 | Ga0451853_2204479 | Ga0451853_2204479_267_551 | 94 |
| 142 | 3300041512 | Ga0451853_2561382 | Ga0451853_2561382_345_629 | 94 |
| 143 | 3300042122 | Ga0450920_023112 | Ga0450920_023112_589_873 | 94 |
| 144 | 3300042184 | Ga0450908_065029 | Ga0450908_065029_182_469 | 94 |
| 145 | 3300042184 | Ga0450908_080243 | Ga0450908_080243_41_325 | 94 |
| 146 | 3300044683 | Ga0466965_0034272 | Ga0466965_0034272_1479_1763 | 94 |
| 147 | 3300044683 | Ga0466965_0822855 | Ga0466965_0822855_228_512 | 94 |
| 148 | 3300046471 | Ga0495650_0002266 | Ga0495650_0002266_1422_1724 | 94 |
| 149 | 3300046471 | Ga0495650_0186144 | Ga0495650_0186144_94_378 | 94 |
| 150 | 3300046500 | Ga0495596_0113216 | Ga0495596_0113216_340_624 | 94 |
| 151 | 3300046515 | Ga0495620_0117937 | Ga0495620_0117937_614_898 | 94 |
| 152 | 3300046516 | Ga0495628_0211473 | Ga0495628_0211473_722_1024 | 94 |
| 153 | 3300046530 | Ga0495654_0336563 | Ga0495654_0336563_214_498 | 94 |
| 154 | 3300047317 | Ga0495604_0912937 | Ga0495604_0912937_78_380 | 94 |
| 155 | 3300048904 | Ga0496101_1099554 | Ga0496101_1099554_128_412 | 94 |
| 156 | 3300048906 | Ga0496103_0682972 | Ga0496103_0682972_250_534 | 94 |
| 157 | 3300048907 | Ga0496104_0015930 | Ga0496104_0015930_1359_1643 | 94 |
| 158 | 3300048908 | Ga0496105_0013419 | Ga0496105_0013419_3924_4208 | 94 |
| 159 | 3300048908 | Ga0496105_0163005 | Ga0496105_0163005_406_690 | 94 |
| 160 | 3300048911 | Ga0496108_0019521 | Ga0496108_0019521_3015_3299 | 94 |
| 161 | 3300048912 | Ga0496109_0047811 | Ga0496109_0047811_808_1092 | 94 |
| 162 | 3300048913 | Ga0496110_0156010 | Ga0496110_0156010_922_1206 | 94 |
| 163 | 3300048916 | Ga0496113_0051897 | Ga0496113_0051897_1044_1328 | 94 |
| 164 | 3300048917 | Ga0496114_0027278 | Ga0496114_0027278_2044_2328 | 94 |
| 165 | 3300048917 | Ga0496114_0048337 | Ga0496114_0048337_597_881 | 94 |
| 166 | 3300048917 | Ga0496114_0053166 | Ga0496114_0053166_1348_1632 | 94 |
| 167 | 3300048918 | Ga0496115_0103570 | Ga0496115_0103570_152_436 | 94 |
| 168 | 3300048920 | Ga0496117_0093280 | Ga0496117_0093280_933_1235 | 94 |
| 169 | 3300048921 | Ga0496118_0067954 | Ga0496118_0067954_1140_1442 | 94 |
| 170 | 3300048922 | Ga0496119_0001615 | Ga0496119_0001615_9057_9359 | 94 |
| 171 | 3300048922 | Ga0496119_0003378 | Ga0496119_0003378_9532_9816 | 94 |
| 172 | 3300048922 | Ga0496119_0183636 | Ga0496119_0183636_619_903 | 94 |
| 173 | 3300048923 | Ga0496120_0000426 | Ga0496120_0000426_36044_36346 | 94 |
| 174 | 3300048923 | Ga0496120_0013004 | Ga0496120_0013004_4525_4827 | 94 |
| 175 | 3300048923 | Ga0496120_0022048 | Ga0496120_0022048_2497_2799 | 94 |
| 176 | 3300048925 | Ga0496122_0292112 | Ga0496122_0292112_171_455 | 94 |
| 177 | 3300048927 | Ga0496124_0879744 | Ga0496124_0879744_184_468 | 94 |
| 178 | 3300048928 | Ga0496125_0000077 | Ga0496125_0000077_22751_23038 | 94 |
| 179 | 3300048928 | Ga0496125_0333795 | Ga0496125_0333795_174_476 | 94 |
| 180 | 3300048929 | Ga0496126_0589782 | Ga0496126_0589782_63_365 | 94 |
| 181 | 3300049569 | Ga0501032_0147747 | Ga0501032_0147747_629_913 | 94 |
| 182 | 3300049574 | Ga0501038_0190454 | Ga0501038_0190454_1151_1435 | 94 |
| 183 | 3300049574 | Ga0501038_1367333 | Ga0501038_1367333_171_455 | 94 |
| 184 | 3300049575 | Ga0501039_0218647 | Ga0501039_0218647_557_841 | 94 |
| 185 | 3300049577 | Ga0501041_0899676 | Ga0501041_0899676_100_384 | 94 |
| 186 | 3300049579 | Ga0501043_0332552 | Ga0501043_0332552_487_771 | 94 |
| 187 | 3300049586 | Ga0501070_0017544 | Ga0501070_0017544_5127_5411 | 94 |
| 188 | 3300049586 | Ga0501070_0229316 | Ga0501070_0229316_455_739 | 94 |
| 189 | 3300050490 | nmdc:mga03n38_28233_c1 | nmdc:mga03n38_28233_c1_1588_1872 | 94 |
| 190 | 3300050492 | nmdc:mga0yw44_184383_c1 | nmdc:mga0yw44_184383_c1_438_722 | 94 |
| 191 | 3300050494 | nmdc:mga06z11_17380_c1 | nmdc:mga06z11_17380_c1_2105_2389 | 94 |
| 192 | 3300050496 | nmdc:mga07m45_61432_c1 | nmdc:mga07m45_61432_c1_418_702 | 94 |
| 193 | 3300050516 | nmdc:mga0sz30_26778_c1 | nmdc:mga0sz30_26778_c1_836_1120 | 94 |
| 194 | 3300053080 | Ga0500635_0017018 | Ga0500635_0017018_1329_1631 | 94 |
| 195 | 3300053085 | Ga0495619_1072503 | Ga0495619_1072503_72_356 | 94 |
| 196 | 3300053093 | Ga0500651_0000368 | Ga0500651_0000368_9806_10108 | 94 |
| 197 | 3300053120 | Ga0500597_216000 | Ga0500597_216000_284_586 | 94 |
| 198 | 3300053148 | Ga0500590_031525 | Ga0500590_031525_1514_1816 | 94 |
| 199 | 3300053155 | Ga0500620_000046 | Ga0500620_000046_21004_21306 | 94 |
| 200 | 3300002738 | JGI25154J39366_1004067 | JGI25154J39366_10040674 | 95 |
| 201 | 3300003578 | Ga0006562J51391_1026342 | Ga0006562J51391_10263422 | 95 |
| 202 | 3300003578 | Ga0006562J51391_1026344 | Ga0006562J51391_10263443 | 95 |
| 203 | 3300003578 | Ga0006562J51391_1026347 | Ga0006562J51391_10263472 | 95 |
| 204 | 3300003758 | Ga0055532_1030364 | Ga0055532_10303641 | 95 |
| 205 | 3300003760 | Ga0055527_1000012 | Ga0055527_1000012288 | 95 |
| 206 | 3300003762 | Ga0055542_1000017 | Ga0055542_1000017288 | 95 |
| 207 | 3300003763 | Ga0055529_1000023 | Ga0055529_1000023255 | 95 |
| 208 | 3300005288 | Ga0065714_10384528 | Ga0065714_103845281 | 95 |
| 209 | 3300005327 | Ga0070658_10169153 | Ga0070658_101691533 | 95 |
| 210 | 3300005337 | Ga0070682_100985395 | Ga0070682_1009853952 | 95 |
| 211 | 3300005355 | Ga0070671_100082053 | Ga0070671_1000820531 | 95 |
| 212 | 3300005366 | Ga0070659_100090424 | Ga0070659_1000904244 | 95 |
| 213 | 3300005455 | Ga0070663_100091425 | Ga0070663_1000914251 | 95 |
| 214 | 3300005456 | Ga0070678_100835577 | Ga0070678_1008355772 | 95 |
| 215 | 3300005539 | Ga0068853_100465486 | Ga0068853_1004654862 | 95 |
| 216 | 3300005614 | Ga0068856_100071190 | Ga0068856_1000711902 | 95 |
| 217 | 3300005618 | Ga0068864_100509991 | Ga0068864_1005099912 | 95 |
| 218 | 3300005719 | Ga0068861_100268621 | Ga0068861_1002686212 | 95 |
| 219 | 3300005840 | Ga0068870_10119127 | Ga0068870_101191272 | 95 |
| 220 | 3300006038 | Ga0075365_11308863 | Ga0075365_113088631 | 95 |
| 221 | 3300006051 | Ga0075364_10121821 | Ga0075364_101218213 | 95 |
| 222 | 3300006051 | Ga0075364_10599313 | Ga0075364_105993132 | 95 |
| 223 | 3300006186 | Ga0075369_10318850 | Ga0075369_103188502 | 95 |
| 224 | 3300009094 | Ga0111539_10403600 | Ga0111539_104036002 | 95 |
| 225 | 3300009148 | Ga0105243_11984989 | Ga0105243_119849892 | 95 |
| 226 | 3300009553 | Ga0105249_10297836 | Ga0105249_102978362 | 95 |
| 227 | 3300011119 | Ga0105246_10303245 | Ga0105246_103032452 | 95 |
| 228 | 3300011119 | Ga0105246_11056787 | Ga0105246_110567872 | 95 |
| 229 | 3300013105 | Ga0157369_10000573 | Ga0157369_100005736 | 95 |
| 230 | 3300013105 | Ga0157369_10082343 | Ga0157369_100823435 | 95 |
| 231 | 3300013105 | Ga0157369_10222301 | Ga0157369_102223013 | 95 |
| 232 | 3300013306 | Ga0163162_10767961 | Ga0163162_107679612 | 95 |
| 233 | 3300013306 | Ga0163162_11093278 | Ga0163162_110932782 | 95 |
| 234 | 3300013307 | Ga0157372_10731544 | Ga0157372_107315442 | 95 |
| 235 | 3300013307 | Ga0157372_13253646 | Ga0157372_132536462 | 95 |
| 236 | 3300013308 | Ga0157375_11938424 | Ga0157375_119384242 | 95 |
| 237 | 3300014325 | Ga0163163_10435396 | Ga0163163_104353962 | 95 |
| 238 | 3300014326 | Ga0157380_10106930 | Ga0157380_101069303 | 95 |
| 239 | 3300020069 | Ga0197907_11201786 | Ga0197907_112017866 | 95 |
| 240 | 3300020070 | Ga0206356_11288880 | Ga0206356_112888802 | 95 |
| 241 | 3300020076 | Ga0206355_1601115 | Ga0206355_16011152 | 95 |
| 242 | 3300020082 | Ga0206353_10173718 | Ga0206353_101737181 | 95 |
| 243 | 3300025228 | Ga0209672_100003 | Ga0209672_10000358 | 95 |
| 244 | 3300025229 | Ga0209147_101360 | Ga0209147_1013606 | 95 |
| 245 | 3300025230 | Ga0209563_101072 | Ga0209563_1010724 | 95 |
| 246 | 3300025246 | Ga0209646_1000168 | Ga0209646_10001687 | 95 |
| 247 | 3300025254 | Ga0209148_1000004 | Ga0209148_1000004353 | 95 |
| 248 | 3300025261 | Ga0209233_1074936 | Ga0209233_10749362 | 95 |
| 249 | 3300025272 | Ga0209455_1000022 | Ga0209455_1000022631 | 95 |
| 250 | 3300025272 | Ga0209455_1002580 | Ga0209455_10025803 | 95 |
| 251 | 3300025904 | Ga0207647_10135484 | Ga0207647_101354842 | 95 |
| 252 | 3300025908 | Ga0207643_10085229 | Ga0207643_100852292 | 95 |
| 253 | 3300025909 | Ga0207705_10000001 | Ga0207705_100000018 | 95 |
| 254 | 3300025909 | Ga0207705_10538793 | Ga0207705_105387932 | 95 |
| 255 | 3300025919 | Ga0207657_10053818 | Ga0207657_100538183 | 95 |
| 256 | 3300025949 | Ga0207667_10017962 | Ga0207667_100179626 | 95 |
| 257 | 3300025949 | Ga0207667_10510330 | Ga0207667_105103301 | 95 |
| 258 | 3300025961 | Ga0207712_10190476 | Ga0207712_101904762 | 95 |
| 259 | 3300026041 | Ga0207639_11644259 | Ga0207639_116442592 | 95 |
| 260 | 3300026067 | Ga0207678_10159170 | Ga0207678_101591701 | 95 |
| 261 | 3300026095 | Ga0207676_11781914 | Ga0207676_117819142 | 95 |
| 262 | 3300026116 | Ga0207674_10775640 | Ga0207674_107756402 | 95 |
| 263 | 3300026118 | Ga0207675_100431972 | Ga0207675_1004319722 | 95 |
| 264 | 3300026121 | Ga0207683_10078079 | Ga0207683_100780793 | 95 |
| 265 | 3300028380 | Ga0268265_11680379 | Ga0268265_116803792 | 95 |
| 266 | 3300031548 | Ga0307408_102147896 | Ga0307408_1021478961 | 95 |
| 267 | 3300031903 | Ga0307407_11582351 | Ga0307407_115823512 | 95 |
| 268 | 3300031995 | Ga0307409_101276306 | Ga0307409_1012763062 | 95 |
| 269 | 3300032002 | Ga0307416_100272919 | Ga0307416_1002729193 | 95 |
| 270 | 3300032002 | Ga0307416_103335126 | Ga0307416_1033351261 | 95 |
| 271 | 3300032004 | Ga0307414_10255144 | Ga0307414_102551443 | 95 |
| 272 | 3300032004 | Ga0307414_10382773 | Ga0307414_103827732 | 95 |
| 273 | 3300032004 | Ga0307414_11064905 | Ga0307414_110649052 | 95 |
| 274 | 3300032004 | Ga0307414_11245947 | Ga0307414_112459471 | 95 |
| 275 | 3300032004 | Ga0307414_11358925 | Ga0307414_113589252 | 95 |
| 276 | 3300037312 | Ga0395899_0068951 | Ga0395899_0068951_936_1235 | 95 |
| 277 | 3300037312 | Ga0395899_0706820 | Ga0395899_0706820_18_317 | 95 |
| 278 | 3300037418 | Ga0395900_0005052 | Ga0395900_0005052_8153_8452 | 95 |
| 279 | 3300037418 | Ga0395900_0080746 | Ga0395900_0080746_2164_2463 | 95 |
| 280 | 3300037466 | Ga0395898_0000473 | Ga0395898_0000473_54738_55037 | 95 |
| 281 | 3300037466 | Ga0395898_0733469 | Ga0395898_0733469_396_695 | 95 |
| 282 | 3300044658 | Ga0466972_0066840 | Ga0466972_0066840_525_824 | 95 |
| 283 | 3300044658 | Ga0466972_0261858 | Ga0466972_0261858_26_331 | 95 |
| 284 | 3300044683 | Ga0466965_0112109 | Ga0466965_0112109_179_478 | 95 |
| 285 | 3300044693 | Ga0466961_0046375 | Ga0466961_0046375_444_743 | 95 |
| 286 | 3300044765 | Ga0466970_0162029 | Ga0466970_0162029_529_828 | 95 |
| 287 | 3300044842 | Ga0466957_0653257 | Ga0466957_0653257_158_457 | 95 |
| 288 | 3300044901 | Ga0466960_0048660 | Ga0466960_0048660_969_1268 | 95 |
| 289 | 3300045049 | Ga0466959_0051547 | Ga0466959_0051547_2325_2624 | 95 |
| 290 | 3300046615 | Ga0495656_0255393 | Ga0495656_0255393_58_366 | 95 |
| 291 | 3300046689 | Ga0495613_0489769 | Ga0495613_0489769_41_349 | 95 |
| 292 | 3300048903 | Ga0496100_0395630 | Ga0496100_0395630_49_348 | 95 |
| 293 | 3300048904 | Ga0496101_0153550 | Ga0496101_0153550_795_1094 | 95 |
| 294 | 3300048905 | Ga0496102_0319012 | Ga0496102_0319012_716_1024 | 95 |
| 295 | 3300048906 | Ga0496103_0237716 | Ga0496103_0237716_571_879 | 95 |
| 296 | 3300048907 | Ga0496104_0066024 | Ga0496104_0066024_351_650 | 95 |
| 297 | 3300048908 | Ga0496105_0134271 | Ga0496105_0134271_408_707 | 95 |
| 298 | 3300048908 | Ga0496105_0212088 | Ga0496105_0212088_828_1127 | 95 |
| 299 | 3300048912 | Ga0496109_0245184 | Ga0496109_0245184_687_995 | 95 |
| 300 | 3300048916 | Ga0496113_0242836 | Ga0496113_0242836_881_1189 | 95 |
| 301 | 3300048917 | Ga0496114_0032174 | Ga0496114_0032174_3664_3963 | 95 |
| 302 | 3300048918 | Ga0496115_0004310 | Ga0496115_0004310_3435_3734 | 95 |
| 303 | 3300048918 | Ga0496115_0045138 | Ga0496115_0045138_2940_3239 | 95 |
| 304 | 3300048918 | Ga0496115_1253435 | Ga0496115_1253435_32_331 | 95 |
| 305 | 3300048919 | Ga0496116_0450194 | Ga0496116_0450194_198_509 | 95 |
| 306 | 3300048920 | Ga0496117_0000321 | Ga0496117_0000321_78806_79102 | 95 |
| 307 | 3300048920 | Ga0496117_0018496 | Ga0496117_0018496_794_1105 | 95 |
| 308 | 3300048920 | Ga0496117_0119393 | Ga0496117_0119393_252_563 | 95 |
| 309 | 3300048921 | Ga0496118_0024944 | Ga0496118_0024944_1315_1626 | 95 |
| 310 | 3300048925 | Ga0496122_0004360 | Ga0496122_0004360_4428_4724 | 95 |
| 311 | 3300048929 | Ga0496126_0638025 | Ga0496126_0638025_324_623 | 95 |
| 312 | 3300049571 | Ga0501034_0017981 | Ga0501034_0017981_6679_6990 | 95 |
| 313 | 3300049571 | Ga0501034_0021573 | Ga0501034_0021573_2193_2492 | 95 |
| 314 | 3300049572 | Ga0501036_0862561 | Ga0501036_0862561_80_379 | 95 |
| 315 | 3300049573 | Ga0501037_0021825 | Ga0501037_0021825_4355_4666 | 95 |
| 316 | 3300049579 | Ga0501043_0001096 | Ga0501043_0001096_6935_7246 | 95 |
| 317 | 3300049579 | Ga0501043_0047085 | Ga0501043_0047085_2065_2364 | 95 |
| 318 | 3300049580 | Ga0501046_0008111 | Ga0501046_0008111_28_327 | 95 |
| 319 | 3300049580 | Ga0501046_0700607 | Ga0501046_0700607_34_345 | 95 |
| 320 | 3300049581 | Ga0501047_0037302 | Ga0501047_0037302_4204_4515 | 95 |
| 321 | 3300049581 | Ga0501047_0050446 | Ga0501047_0050446_957_1256 | 95 |
| 322 | 3300049581 | Ga0501047_0063986 | Ga0501047_0063986_3036_3335 | 95 |
| 323 | 3300049585 | Ga0501069_0080951 | Ga0501069_0080951_261_572 | 95 |
| 324 | 3300049586 | Ga0501070_0000100 | Ga0501070_0000100_8171_8470 | 95 |
| 325 | 3300049586 | Ga0501070_0002712 | Ga0501070_0002712_7159_7470 | 95 |
| 326 | 3300049593 | Ga0501077_0094532 | Ga0501077_0094532_1294_1605 | 95 |
| 327 | 3300049742 | Ga0501080_0000083 | Ga0501080_0000083_10032_10343 | 95 |
| 328 | 3300049744 | Ga0501083_0003662 | Ga0501083_0003662_4287_4598 | 95 |
| 329 | 3300049822 | Ga0501035_0566043 | Ga0501035_0566043_425_736 | 95 |
| 330 | 3300049823 | Ga0501044_0038144 | Ga0501044_0038144_3151_3450 | 95 |
| 331 | 3300050491 | nmdc:mga00v17_529527_c1 | nmdc:mga00v17_529527_c1_152_439 | 95 |
| 332 | 3300050491 | nmdc:mga00v17_92200_c1 | nmdc:mga00v17_92200_c1_622_912 | 95 |
| 333 | 3300050509 | nmdc:mga0qj67_1401880_c1 | nmdc:mga0qj67_1401880_c1_62_370 | 95 |
| 334 | 3300050511 | nmdc:mga08y16_1345270_c1 | nmdc:mga08y16_1345270_c1_282_590 | 95 |
| 335 | 3300053080 | Ga0500635_0000010 | Ga0500635_0000010_42054_42356 | 95 |
| 336 | 3300053136 | Ga0500559_0017157 | Ga0500559_0017157_111_425 | 95 |
| 337 | 3300053140 | Ga0500573_0000001 | Ga0500573_0000001_371841_372149 | 95 |
| 338 | 3300053153 | Ga0500616_0000078 | Ga0500616_0000078_4769_5065 | 95 |
| 339 | 3300054114 | Ga0501084_0152871 | Ga0501084_0152871_1487_1798 | 95 |
| 340 | 3300060353 | Ga0501082_1842708 | Ga0501082_1842708_120_431 | 95 |
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6ti8-assembly1.cif.gz_A | irak4 in complex with inhibitor | 0.816 | 26 | 41 |
| 2l30-assembly1.cif.gz_A | human parp-1 zinc finger 1 | 0.6963 | 38 | 94 |
| 5y5d-assembly1.cif.gz_B | the crystal structure of vreh2 mutant m263w | 0.696 | 25 | 42 |
| 5xmd-assembly2.cif.gz_D-3 | crystal structure of epoxide hydrolase vreh1 from vigna radiata | 0.6946 | 25 | 42 |
| 1uw0-assembly1.cif.gz_A | solution structure of the zinc-finger domain from dna ligase iiia | 0.6936 | 34 | 92 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q58475_1_473_3.60.120.10 | Alpha Beta;4-Layer Sandwich;Anthranilate synthase;Anthranilate synthase | 0.8965 | 26 | 41 | 3.60.120.10 |
| 3c8cB01 | Alpha Beta;2-Layer Sandwich;Beta-Lactamase;PAS domain | 0.8703 | 26 | 40 | 3.30.450.20 |
| af_A0A1D6H4H3_345_449_3.30.200.20 | Alpha Beta;2-Layer Sandwich;Phosphorylase Kinase; domain 1;Phosphorylase Kinase; domain 1 | 0.8347 | 26 | 42 | 3.30.200.20 |
| af_A0A1D8PTK4_4_109_3.30.230.100 | Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2; | 0.7667 | 25 | 41 | 3.30.230.100 |
| af_P51556_198_253_3.30.60.20 | Alpha Beta;2-Layer Sandwich;Wheat Germ Agglutinin (Isolectin 2); domain 1; | 0.7591 | 38 | 95 | 3.30.60.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7X7G8L3-F1-model_v4 | ATP/GTP-binding protein | 0.9676 | 34 | 93 |
|
| AF-A0A520XZD8-F1-model_v4 | ATP/GTP-binding protein | 0.9615 | 36 | 94 |
|
| AF-A0A6L6CVW9-F1-model_v4 | ATP/GTP-binding protein | 0.958 | 36 | 95 |
|
| AF-A0A4P5RYH8-F1-model_v4 | ATP/GTP-binding protein | 0.9575 | 36 | 94 |
|
| AF-A0A6J6UJC7-F1-model_v4 | Unannotated protein | 0.9572 | 36 | 95 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar