F414377

General Info

Members Datasets Scaffolds Average Seq Length
340 237 680 164

Family's Representative Sequence

Representative Sequence 3300027682|Ga0209971_1009835|Ga0209971_10098352
Length 201
Sequence MKDSRGAPGQLSGEGKTGRREPLRTAPTPGLAQSKDTPMKKVLIVFHSKTGGTYQMAQAAAKGAASEPEVDVKAVHAAEAGPDDLLRSDGYIFATPENLAMMSGMMKDFFDRAYYPALDLIVGRPYAILICAGSDGENAARQIERIATGWRLKKIAEAIIVCTHAQTPETILAPKQIGAFDLSRCEEIGATLAAGLMLGIY

Samples

Sample ID Description Type Environment
1 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
25 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
26 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
27 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
28 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
33 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
36 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
37 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
38 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
39 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
40 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
41 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
42 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
43 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
44 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
45 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
46 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
47 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
48 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
49 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
50 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
51 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
52 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
53 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
54 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
55 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
56 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
57 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
58 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
59 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
60 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
62 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
63 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
64 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
65 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
66 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
67 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
69 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
70 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
71 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
72 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
74 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
75 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
76 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
77 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
78 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
79 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
80 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
81 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
82 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
83 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
84 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
85 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
86 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
87 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
88 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
89 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
90 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
91 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
92 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
93 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
94 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300027252 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) Metagenome Rhizosphere
135 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
136 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
137 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
138 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
139 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
143 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
144 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
145 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
146 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
147 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
148 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
149 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
150 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
151 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
152 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
153 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
154 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
155 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
156 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
157 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
158 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
159 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
160 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
161 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
162 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
163 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
164 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
165 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
166 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
167 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
168 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
169 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
170 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
171 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
172 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
173 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
174 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
175 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
176 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
177 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
178 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
179 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
180 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
181 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
182 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
183 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
184 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
185 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
186 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
187 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
188 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
189 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
190 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
191 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
192 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
193 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
194 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
195 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
196 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
197 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
198 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
199 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
200 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
201 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
202 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
203 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
204 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
205 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
206 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
207 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
208 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
209 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
210 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
211 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
212 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
213 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
214 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
215 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
216 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
217 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
218 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
219 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
220 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
221 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
222 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
223 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
224 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
225 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
226 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
227 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
228 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
229 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
230 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
231 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
232 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
233 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
234 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
235 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
236 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
237 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.65
Nodule 0
Rhizoplane 5
Rhizosphere 92.06
Stem 0
Stem Tuber 0
Unclassified 20

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0209971_1009835 3300027682 Unclassified 2264
2 Ga0065712_10006369 3300005290 Bacteria 4717
3 Ga0065715_10022370 3300005293 Bacteria 1349
4 Ga0070676_10010628 3300005328 Bacteria 4994
5 Ga0070676_10018264 3300005328 Unclassified 3883
6 Ga0070676_10746594 3300005328 Bacteria 718
7 Ga0070683_100595087 3300005329 Bacteria 1058
8 Ga0070690_100606158 3300005330 Unclassified 832
9 Ga0070690_100638725 3300005330 Bacteria 812
10 Ga0070670_100013736 3300005331 Bacteria 6939
11 Ga0070677_10017808 3300005333 Bacteria 2549
12 Ga0068869_100023573 3300005334 Bacteria 4253
13 Ga0070666_10042101 3300005335 Bacteria 3054
14 Ga0070680_100062155 3300005336 Bacteria 3058
15 Ga0068868_100016658 3300005338 Bacteria 5465
16 Ga0068868_100159192 3300005338 Unclassified 1864
17 Ga0070689_100240838 3300005340 Bacteria 1490
18 Ga0070691_10115939 3300005341 Bacteria 1344
19 Ga0070661_100153884 3300005344 Bacteria 1739
20 Ga0070668_100142767 3300005347 Bacteria 1931
21 Ga0070669_100595230 3300005353 Bacteria 926
22 Ga0070675_100081191 3300005354 Bacteria 2704
23 Ga0070675_100446483 3300005354 Bacteria 1159
24 Ga0070671_100023841 3300005355 Bacteria 5008
25 Ga0070673_100058828 3300005364 Bacteria 3040
26 Ga0070673_100178501 3300005364 Bacteria 1816
27 Ga0070688_100593777 3300005365 Unclassified 847
28 Ga0070659_100111603 3300005366 Bacteria 2207
29 Ga0070667_100031342 3300005367 Unclassified 4433
30 Ga0070667_100049804 3300005367 Bacteria 3529
31 Ga0070667_100151412 3300005367 Bacteria 2038
32 Ga0070701_10663741 3300005438 Bacteria 697
33 Ga0070705_100095430 3300005440 Bacteria 1865
34 Ga0070700_100007441 3300005441 Bacteria 5913
35 Ga0070700_100572210 3300005441 Unclassified 881
36 Ga0070694_100087188 3300005444 Bacteria 2183
37 Ga0070708_100153215 3300005445 Bacteria 2145
38 Ga0070678_100563798 3300005456 Bacteria 1012
39 Ga0070678_101140231 3300005456 Bacteria 721
40 Ga0070681_10016699 3300005458 Bacteria 7329
41 Ga0070681_10030196 3300005458 Bacteria 5437
42 Ga0070681_10075544 3300005458 Bacteria 3329
43 Ga0070681_10100990 3300005458 Bacteria 2830
44 Ga0068867_100001303 3300005459 Bacteria 17238
45 Ga0068867_100260721 3300005459 Bacteria 1413
46 Ga0070707_100159221 3300005468 Bacteria 2199
47 Ga0070698_100239336 3300005471 Bacteria 1748
48 Ga0070679_100122104 3300005530 Bacteria 2589
49 Ga0070679_100223583 3300005530 Bacteria 1843
50 Ga0070684_101051899 3300005535 Bacteria 764
51 Ga0070697_100205182 3300005536 Bacteria 1676
52 Ga0070697_100271441 3300005536 Unclassified 1454
53 Ga0070697_100568779 3300005536 Unclassified 995
54 Ga0068853_100123786 3300005539 Bacteria 2309
55 Ga0070672_100010245 3300005543 Bacteria 6495
56 Ga0070672_100030051 3300005543 Unclassified 4078
57 Ga0070686_100282497 3300005544 Bacteria 1225
58 Ga0070695_100040001 3300005545 Bacteria 2966
59 Ga0070696_100068651 3300005546 Unclassified 2489
60 Ga0070696_100088236 3300005546 Bacteria 2204
61 Ga0070696_100103356 3300005546 Bacteria 2044
62 Ga0070696_101483129 3300005546 Unclassified 580
63 Ga0070665_100188608 3300005548 Bacteria 2063
64 Ga0070704_100092476 3300005549 Bacteria 2258
65 Ga0068855_100418233 3300005563 Bacteria 1466
66 Ga0070664_100001008 3300005564 Bacteria 22114
67 Ga0068857_100066920 3300005577 Bacteria 3197
68 Ga0068857_100152257 3300005577 Bacteria 2096
69 Ga0068857_102111445 3300005577 Unclassified 553
70 Ga0068854_100115120 3300005578 Bacteria 2034
71 Ga0068856_100279032 3300005614 Bacteria 1688
72 Ga0068856_100560811 3300005614 Bacteria 1163
73 Ga0068859_100138878 3300005617 Bacteria 2504
74 Ga0068859_100197503 3300005617 Bacteria 2096
75 Ga0068859_100753343 3300005617 Bacteria 1063
76 Ga0068864_100125558 3300005618 Unclassified 2299
77 Ga0068864_100458506 3300005618 Bacteria 1220
78 Ga0068866_10105613 3300005718 Bacteria 1562
79 Ga0068861_100550965 3300005719 Unclassified 1051
80 Ga0068870_10189434 3300005840 Bacteria 1240
81 Ga0068870_10329388 3300005840 Bacteria 973
82 Ga0068863_100177209 3300005841 Bacteria 2046
83 Ga0068863_100776120 3300005841 Bacteria 955
84 Ga0068858_101061042 3300005842 Bacteria 795
85 Ga0068860_100169825 3300005843 Bacteria 2106
86 Ga0081538_10222496 3300005981 Bacteria 747
87 Ga0075362_10016256 3300006177 Bacteria 3043
88 Ga0075369_10246570 3300006186 Bacteria 829
89 Ga0097621_100175393 3300006237 Bacteria 1850
90 Ga0097621_101130370 3300006237 Bacteria 736
91 Ga0068871_100067417 3300006358 Bacteria 2936
92 Ga0075428_100298833 3300006844 Bacteria 1731
93 Ga0075431_100027906 3300006847 Bacteria 5793
94 Ga0075431_100236035 3300006847 Unclassified 1862
95 Ga0075431_100544099 3300006847 Bacteria 1149
96 Ga0075433_10073810 3300006852 Unclassified 3001
97 Ga0075433_10773972 3300006852 Bacteria 839
98 Ga0075434_100056400 3300006871 Bacteria 3904
99 Ga0068865_100088454 3300006881 Bacteria 2241
100 Ga0097620_100138882 3300006931 Bacteria 2504
101 Ga0097620_100197520 3300006931 Bacteria 2096
102 Ga0097620_100753363 3300006931 Bacteria 1063
103 Ga0075435_100354018 3300007076 Bacteria 1259
104 Ga0105244_10355197 3300009036 Bacteria 675
105 Ga0105240_10241860 3300009093 Bacteria 2092
106 Ga0105245_10086054 3300009098 Unclassified 2882
107 Ga0114129_10154178 3300009147 Unclassified 3143
108 Ga0114129_10180129 3300009147 Bacteria 2876
109 Ga0114129_10328289 3300009147 Bacteria 2032
110 Ga0105243_10034087 3300009148 Bacteria 3939
111 Ga0105242_10154366 3300009176 Bacteria 2004
112 Ga0105242_10611026 3300009176 Bacteria 1054
113 Ga0105248_10622503 3300009177 Bacteria 1218
114 Ga0105237_12036851 3300009545 Unclassified 583
115 Ga0105238_10563948 3300009551 Unclassified 1144
116 Ga0105249_10282920 3300009553 Bacteria 1657
117 Ga0105249_10285362 3300009553 Bacteria 1650
118 Ga0105239_10075441 3300010375 Bacteria 3708
119 Ga0105246_11161827 3300011119 Unclassified 708
120 Ga0157373_10088025 3300013100 Unclassified 2188
121 Ga0157371_10081044 3300013102 Bacteria 2298
122 Ga0157370_10537064 3300013104 Bacteria 1072
123 Ga0157374_10059399 3300013296 Bacteria 3575
124 Ga0157374_10085321 3300013296 Bacteria 3002
125 Ga0157378_10048072 3300013297 Bacteria 3793
126 Ga0157378_10858501 3300013297 Unclassified 936
127 Ga0163162_10146544 3300013306 Bacteria 2477
128 Ga0163162_10311413 3300013306 Unclassified 1707
129 Ga0163162_10581878 3300013306 Bacteria 1246
130 Ga0163162_10798150 3300013306 Bacteria 1061
131 Ga0157372_10160825 3300013307 Bacteria 2595
132 Ga0157375_10049211 3300013308 Bacteria 4128
133 Ga0157375_10649443 3300013308 Bacteria 1211
134 Ga0157375_11061630 3300013308 Bacteria 947
135 Ga0157377_10240279 3300014745 Bacteria 1169
136 Ga0157379_10135811 3300014968 Bacteria 2216
137 Ga0157376_10034004 3300014969 Bacteria 4111
138 Ga0163161_10046436 3300017792 Bacteria 3133
139 Ga0163161_10208831 3300017792 Bacteria 1508
140 Ga0163161_10407356 3300017792 Unclassified 1091
141 Ga0163161_10756339 3300017792 Bacteria 813
142 Ga0207673_1012270 3300025290 Bacteria 1115
143 Ga0207697_10022025 3300025315 Bacteria 2611
144 Ga0207682_10014085 3300025893 Bacteria 3117
145 Ga0207642_10134577 3300025899 Bacteria 1294
146 Ga0207688_10033446 3300025901 Bacteria 2844
147 Ga0207645_10002309 3300025907 Bacteria 15071
148 Ga0207645_10003699 3300025907 Bacteria 11527
149 Ga0207645_10814074 3300025907 Bacteria 635
150 Ga0207643_10035167 3300025908 Bacteria 2808
151 Ga0207643_10558764 3300025908 Bacteria 735
152 Ga0207684_11045134 3300025910 Bacteria 682
153 Ga0207707_10008258 3300025912 Bacteria 9038
154 Ga0207707_10057269 3300025912 Bacteria 3392
155 Ga0207707_10193029 3300025912 Bacteria 1776
156 Ga0207660_10024555 3300025917 Unclassified 4082
157 Ga0207657_10013688 3300025919 Bacteria 7945
158 Ga0207649_10066764 3300025920 Bacteria 2281
159 Ga0207652_10136436 3300025921 Bacteria 2191
160 Ga0207681_10234210 3300025923 Bacteria 1426
161 Ga0207681_10467494 3300025923 Bacteria 1028
162 Ga0207650_10001390 3300025925 Bacteria 17461
163 Ga0207650_10056120 3300025925 Bacteria 2926
164 Ga0207659_10221369 3300025926 Bacteria 1522
165 Ga0207659_10382326 3300025926 Bacteria 1174
166 Ga0207644_10027823 3300025931 Bacteria 3908
167 Ga0207690_10038117 3300025932 Unclassified 3126
168 Ga0207706_10003137 3300025933 Bacteria 15883
169 Ga0207709_10280801 3300025935 Bacteria 1230
170 Ga0207669_10652611 3300025937 Bacteria 861
171 Ga0207704_10030299 3300025938 Bacteria 3032
172 Ga0207704_10155373 3300025938 Bacteria 1621
173 Ga0207704_10392197 3300025938 Unclassified 1093
174 Ga0207665_10309708 3300025939 Bacteria 1183
175 Ga0207691_10000816 3300025940 Bacteria 31043
176 Ga0207691_10016734 3300025940 Bacteria 6962
177 Ga0207691_10620990 3300025940 Unclassified 914
178 Ga0207689_10297803 3300025942 Bacteria 1337
179 Ga0207661_11002879 3300025944 Bacteria 769
180 Ga0207679_10019075 3300025945 Unclassified 4602
181 Ga0207667_10594491 3300025949 Bacteria 1116
182 Ga0207651_10010253 3300025960 Bacteria 5183
183 Ga0207651_10041412 3300025960 Bacteria 3057
184 Ga0207712_10258305 3300025961 Bacteria 1411
185 Ga0207658_10039069 3300025986 Bacteria 3423
186 Ga0207658_10655440 3300025986 Bacteria 946
187 Ga0207677_10065846 3300026023 Bacteria 2530
188 Ga0207703_11160084 3300026035 Bacteria 742
189 Ga0207639_10229131 3300026041 Bacteria 1609
190 Ga0207678_10045221 3300026067 Unclassified 3808
191 Ga0207641_10214599 3300026088 Bacteria 1781
192 Ga0207648_10026051 3300026089 Bacteria 5200
193 Ga0207674_10033525 3300026116 Bacteria 5376
194 Ga0207674_10095696 3300026116 Bacteria 2955
195 Ga0207675_101258595 3300026118 Bacteria 760
196 Ga0207683_10042093 3300026121 Bacteria 3989
197 Ga0207683_10054468 3300026121 Bacteria 3508
198 Ga0207698_10884304 3300026142 Bacteria 900
199 Ga0209973_1005948 3300027252 Unclassified 1315
200 Ga0209984_1018992 3300027424 Bacteria 932
201 Ga0210000_1025396 3300027462 Bacteria 916
202 Ga0209999_1044528 3300027543 Bacteria 834
203 Ga0209983_1017600 3300027665 Unclassified 1480
204 Ga0209974_10041345 3300027876 Bacteria 1534
205 Ga0268266_10434463 3300028379 Bacteria 1246
206 Ga0268264_10139229 3300028381 Bacteria 2162
207 Ga0265320_10264991 3300031240 Bacteria 761
208 Ga0307413_10674075 3300031824 Bacteria 856
209 Ga0307410_10124087 3300031852 Bacteria 1888
210 Ga0307406_10143872 3300031901 Bacteria 1692
211 Ga0307412_10393141 3300031911 Bacteria 1126
212 Ga0373948_0085243 3300034817 Unclassified 726
213 Ga0373952_0185400 3300035092 Unclassified 602
214 Ga0373932_0053252 3300035112 Unclassified 1207
215 Ga0373939_0046383 3300035114 Bacteria 1330
216 Ga0373960_0115269 3300035121 Bacteria 886
217 Ga0373961_0090940 3300035241 Unclassified 975
218 Ga0373962_0014330 3300035242 Unclassified 2020
219 Ga0373931_0025854 3300035691 Unclassified 2983
220 Ga0373937_0561483 3300036401 Bacteria 1084
221 Ga0373937_0826905 3300036401 Bacteria 874
222 Ga0316584_0712296 3300036712 Unclassified 687
223 Ga0373925_0171062 3300037068 Bacteria 1715
224 Ga0373925_0304369 3300037068 Bacteria 1288
225 Ga0436361_0045431 3300039447 Bacteria 1536
226 Ga0436363_1441381 3300039450 Bacteria 801
227 Ga0436362_0251812 3300039453 Bacteria 585
228 Ga0450910_012214 3300042147 Bacteria 1240
229 Ga0450893_0019590 3300042532 Bacteria 1158
230 Ga0451577_0101676 3300042876 Bacteria 2568
231 Ga0451577_0280309 3300042876 Bacteria 1510
232 Ga0451577_0509386 3300042876 Bacteria 1093
233 Ga0453683_0428360 3300044673 Bacteria 854
234 Ga0466965_0022791 3300044683 Bacteria 3021
235 Ga0453684_0354249 3300044712 Bacteria 1654
236 Ga0453684_0431989 3300044712 Bacteria 1469
237 Ga0453684_0681488 3300044712 Bacteria 1119
238 Ga0466957_0566742 3300044842 Bacteria 793
239 Ga0451576_0301823 3300045051 Bacteria 1675
240 Ga0451576_0614319 3300045051 Bacteria 1142
241 Ga0451576_2004764 3300045051 Bacteria 596
242 Ga0466958_0114625 3300045836 Bacteria 1684
243 Ga0495580_0096958 3300046472 Bacteria 2051
244 Ga0495648_0128550 3300046524 Bacteria 1350
245 Ga0495640_0104139 3300046533 Bacteria 1860
246 Ga0495647_0169885 3300046681 Bacteria 944
247 Ga0495647_0372176 3300046681 Bacteria 653
248 Ga0495658_0068666 3300046683 Bacteria 2053
249 Ga0495670_0046504 3300046691 Bacteria 2168
250 Ga0495674_0479605 3300047319 Bacteria 997
251 Ga0495680_0311159 3300047322 Bacteria 1104
252 Ga0495675_0471041 3300047444 Bacteria 724
253 Ga0495602_0418702 3300048088 Bacteria 952
254 Ga0496100_0017825 3300048903 Bacteria 4200
255 Ga0496100_1474641 3300048903 Unclassified 537
256 Ga0496101_0040825 3300048904 Bacteria 3305
257 Ga0496102_0018848 3300048905 Bacteria 6070
258 Ga0496103_0040411 3300048906 Bacteria 2866
259 Ga0496104_0016890 3300048907 Bacteria 6637
260 Ga0496104_0081665 3300048907 Unclassified 3083
261 Ga0496105_0042030 3300048908 Bacteria 3768
262 Ga0496106_1227041 3300048909 Unclassified 584
263 Ga0496108_1030535 3300048911 Unclassified 702
264 Ga0496109_0539541 3300048912 Bacteria 1100
265 Ga0496110_0087023 3300048913 Bacteria 2790
266 Ga0496111_0686318 3300048914 Bacteria 745
267 Ga0496111_0751409 3300048914 Unclassified 707
268 Ga0496112_0183303 3300048915 Bacteria 2057
269 Ga0496113_0232215 3300048916 Bacteria 1471
270 Ga0496113_0344159 3300048916 Bacteria 1196
271 Ga0501031_0181321 3300049568 Bacteria 1375
272 Ga0501032_0019986 3300049569 Bacteria 4673
273 Ga0501033_0252259 3300049570 Unclassified 1250
274 Ga0501033_0294572 3300049570 Bacteria 1143
275 Ga0501034_0148903 3300049571 Bacteria 2317
276 Ga0501036_0129090 3300049572 Bacteria 2134
277 Ga0501036_0403084 3300049572 Unclassified 1141
278 Ga0501037_0039917 3300049573 Bacteria 3454
279 Ga0501038_0153497 3300049574 Unclassified 1876
280 Ga0501040_0004321 3300049576 Bacteria 9231
281 Ga0501040_0104655 3300049576 Unclassified 1976
282 Ga0501041_0024199 3300049577 Bacteria 3644
283 Ga0501041_0030019 3300049577 Bacteria 3280
284 Ga0501042_0132387 3300049578 Bacteria 1797
285 Ga0501042_0162484 3300049578 Unclassified 1611
286 Ga0501043_0028186 3300049579 Bacteria 4408
287 Ga0501046_0086354 3300049580 Unclassified 2419
288 Ga0501046_0160285 3300049580 Bacteria 1692
289 Ga0501046_0166513 3300049580 Bacteria 1656
290 Ga0501046_0361748 3300049580 Unclassified 1052
291 Ga0501047_0249726 3300049581 Bacteria 1623
292 Ga0501048_0108948 3300049582 Bacteria 1955
293 Ga0501068_0104076 3300049584 Bacteria 1761
294 Ga0501070_0030865 3300049586 Unclassified 4489
295 Ga0501071_0130568 3300049587 Unclassified 1866
296 Ga0501072_0186298 3300049588 Bacteria 1655
297 Ga0501072_0194240 3300049588 Bacteria 1619
298 Ga0501072_0264384 3300049588 Bacteria 1369
299 Ga0501073_0294057 3300049589 Bacteria 1120
300 Ga0501074_0072615 3300049590 Unclassified 2472
301 Ga0501074_0473617 3300049590 Bacteria 888
302 Ga0501075_0005663 3300049591 Bacteria 8550
303 Ga0501075_0058706 3300049591 Unclassified 2897
304 Ga0501076_0087382 3300049592 Unclassified 2506
305 Ga0501076_0198859 3300049592 Unclassified 1636
306 Ga0501076_1131574 3300049592 Bacteria 644
307 Ga0501077_0050605 3300049593 Unclassified 2640
308 Ga0501077_0402953 3300049593 Bacteria 874
309 Ga0501079_0203748 3300049741 Bacteria 1545
310 Ga0501080_0167415 3300049742 Unclassified 2028
311 Ga0501080_0208232 3300049742 Bacteria 1793
312 Ga0501080_0508034 3300049742 Bacteria 1076
313 Ga0501081_0001591 3300049743 Bacteria 14001
314 Ga0501081_0090459 3300049743 Bacteria 2151
315 Ga0501083_0092598 3300049744 Bacteria 1995
316 Ga0501083_0101967 3300049744 Bacteria 1892
317 Ga0501044_0601849 3300049823 Bacteria 992
318 Ga0501045_0008756 3300049824 Bacteria 7060
319 Ga0501045_0754498 3300049824 Unclassified 717
320 nmdc:mga03683_9442_c1 3300050489 Bacteria 3470
321 nmdc:mga03n38_112581_c1 3300050490 Bacteria 1327
322 nmdc:mga0k408_21448_c1 3300050493 Bacteria 3628
323 nmdc:mga05p37_130035_c1 3300050507 Unclassified 3089
324 nmdc:mga05p37_24565_c1 3300050507 Bacteria 7326
325 nmdc:mga05p37_365821_c1 3300050507 Bacteria 1694
326 nmdc:mga0qj67_949550_c1 3300050509 Unclassified 676
327 nmdc:mga06r32_699063_c1 3300050510 Unclassified 980
328 nmdc:mga0n895_207156_c1 3300050512 Bacteria 1991
329 nmdc:mga0rr50_649028_c1 3300050513 Unclassified 900
330 nmdc:mga0a205_25914_c1 3300050515 Bacteria 5586
331 nmdc:mga0a205_416728_c1 3300050515 Bacteria 1205
332 nmdc:mga0sz30_237279_c1 3300050516 Bacteria 811
333 Ga0500658_0130895 3300053134 Bacteria 1119
334 Ga0500604_0044953 3300053151 Bacteria 1346
335 Ga0500627_0014019 3300053158 Bacteria 3060
336 Ga0501084_0205142 3300054114 Bacteria 1663
337 Ga0501082_0008014 3300060353 Bacteria 9120
338 Ga0501082_0441665 3300060353 Bacteria 1136
339 Ga0530510_0053657 3300061734 Unclassified 2913
340 Ga0530510_0058779 3300061734 Unclassified 2780
341 Ga0209971_1009835
342 Ga0065712_10006369
343 Ga0065715_10022370
344 Ga0070676_10010628
345 Ga0070676_10018264
346 Ga0070676_10746594
347 Ga0070683_100595087
348 Ga0070690_100606158
349 Ga0070690_100638725
350 Ga0070670_100013736
351 Ga0070677_10017808
352 Ga0068869_100023573
353 Ga0070666_10042101
354 Ga0070680_100062155
355 Ga0068868_100016658
356 Ga0068868_100159192
357 Ga0070689_100240838
358 Ga0070691_10115939
359 Ga0070661_100153884
360 Ga0070668_100142767
361 Ga0070669_100595230
362 Ga0070675_100081191
363 Ga0070675_100446483
364 Ga0070671_100023841
365 Ga0070673_100058828
366 Ga0070673_100178501
367 Ga0070688_100593777
368 Ga0070659_100111603
369 Ga0070667_100031342
370 Ga0070667_100049804
371 Ga0070667_100151412
372 Ga0070701_10663741
373 Ga0070705_100095430
374 Ga0070700_100007441
375 Ga0070700_100572210
376 Ga0070694_100087188
377 Ga0070708_100153215
378 Ga0070678_100563798
379 Ga0070678_101140231
380 Ga0070681_10016699
381 Ga0070681_10030196
382 Ga0070681_10075544
383 Ga0070681_10100990
384 Ga0068867_100001303
385 Ga0068867_100260721
386 Ga0070707_100159221
387 Ga0070698_100239336
388 Ga0070679_100122104
389 Ga0070679_100223583
390 Ga0070684_101051899
391 Ga0070697_100205182
392 Ga0070697_100271441
393 Ga0070697_100568779
394 Ga0068853_100123786
395 Ga0070672_100010245
396 Ga0070672_100030051
397 Ga0070686_100282497
398 Ga0070695_100040001
399 Ga0070696_100068651
400 Ga0070696_100088236
401 Ga0070696_100103356
402 Ga0070696_101483129
403 Ga0070665_100188608
404 Ga0070704_100092476
405 Ga0068855_100418233
406 Ga0070664_100001008
407 Ga0068857_100066920
408 Ga0068857_100152257
409 Ga0068857_102111445
410 Ga0068854_100115120
411 Ga0068856_100279032
412 Ga0068856_100560811
413 Ga0068859_100138878
414 Ga0068859_100197503
415 Ga0068859_100753343
416 Ga0068864_100125558
417 Ga0068864_100458506
418 Ga0068866_10105613
419 Ga0068861_100550965
420 Ga0068870_10189434
421 Ga0068870_10329388
422 Ga0068863_100177209
423 Ga0068863_100776120
424 Ga0068858_101061042
425 Ga0068860_100169825
426 Ga0081538_10222496
427 Ga0075362_10016256
428 Ga0075369_10246570
429 Ga0097621_100175393
430 Ga0097621_101130370
431 Ga0068871_100067417
432 Ga0075428_100298833
433 Ga0075431_100027906
434 Ga0075431_100236035
435 Ga0075431_100544099
436 Ga0075433_10073810
437 Ga0075433_10773972
438 Ga0075434_100056400
439 Ga0068865_100088454
440 Ga0097620_100138882
441 Ga0097620_100197520
442 Ga0097620_100753363
443 Ga0075435_100354018
444 Ga0105244_10355197
445 Ga0105240_10241860
446 Ga0105245_10086054
447 Ga0114129_10154178
448 Ga0114129_10180129
449 Ga0114129_10328289
450 Ga0105243_10034087
451 Ga0105242_10154366
452 Ga0105242_10611026
453 Ga0105248_10622503
454 Ga0105237_12036851
455 Ga0105238_10563948
456 Ga0105249_10282920
457 Ga0105249_10285362
458 Ga0105239_10075441
459 Ga0105246_11161827
460 Ga0157373_10088025
461 Ga0157371_10081044
462 Ga0157370_10537064
463 Ga0157374_10059399
464 Ga0157374_10085321
465 Ga0157378_10048072
466 Ga0157378_10858501
467 Ga0163162_10146544
468 Ga0163162_10311413
469 Ga0163162_10581878
470 Ga0163162_10798150
471 Ga0157372_10160825
472 Ga0157375_10049211
473 Ga0157375_10649443
474 Ga0157375_11061630
475 Ga0157377_10240279
476 Ga0157379_10135811
477 Ga0157376_10034004
478 Ga0163161_10046436
479 Ga0163161_10208831
480 Ga0163161_10407356
481 Ga0163161_10756339
482 Ga0207673_1012270
483 Ga0207697_10022025
484 Ga0207682_10014085
485 Ga0207642_10134577
486 Ga0207688_10033446
487 Ga0207645_10002309
488 Ga0207645_10003699
489 Ga0207645_10814074
490 Ga0207643_10035167
491 Ga0207643_10558764
492 Ga0207684_11045134
493 Ga0207707_10008258
494 Ga0207707_10057269
495 Ga0207707_10193029
496 Ga0207660_10024555
497 Ga0207657_10013688
498 Ga0207649_10066764
499 Ga0207652_10136436
500 Ga0207681_10234210
501 Ga0207681_10467494
502 Ga0207650_10001390
503 Ga0207650_10056120
504 Ga0207659_10221369
505 Ga0207659_10382326
506 Ga0207644_10027823
507 Ga0207690_10038117
508 Ga0207706_10003137
509 Ga0207709_10280801
510 Ga0207669_10652611
511 Ga0207704_10030299
512 Ga0207704_10155373
513 Ga0207704_10392197
514 Ga0207665_10309708
515 Ga0207691_10000816
516 Ga0207691_10016734
517 Ga0207691_10620990
518 Ga0207689_10297803
519 Ga0207661_11002879
520 Ga0207679_10019075
521 Ga0207667_10594491
522 Ga0207651_10010253
523 Ga0207651_10041412
524 Ga0207712_10258305
525 Ga0207658_10039069
526 Ga0207658_10655440
527 Ga0207677_10065846
528 Ga0207703_11160084
529 Ga0207639_10229131
530 Ga0207678_10045221
531 Ga0207641_10214599
532 Ga0207648_10026051
533 Ga0207674_10033525
534 Ga0207674_10095696
535 Ga0207675_101258595
536 Ga0207683_10042093
537 Ga0207683_10054468
538 Ga0207698_10884304
539 Ga0209973_1005948
540 Ga0209984_1018992
541 Ga0210000_1025396
542 Ga0209999_1044528
543 Ga0209983_1017600
544 Ga0209974_10041345
545 Ga0268266_10434463
546 Ga0268264_10139229
547 Ga0265320_10264991
548 Ga0307413_10674075
549 Ga0307410_10124087
550 Ga0307406_10143872
551 Ga0307412_10393141
552 Ga0373948_0085243
553 Ga0373952_0185400
554 Ga0373932_0053252
555 Ga0373939_0046383
556 Ga0373960_0115269
557 Ga0373961_0090940
558 Ga0373962_0014330
559 Ga0373931_0025854
560 Ga0373937_0561483
561 Ga0373937_0826905
562 Ga0316584_0712296
563 Ga0373925_0171062
564 Ga0373925_0304369
565 Ga0436361_0045431
566 Ga0436363_1441381
567 Ga0436362_0251812
568 Ga0450910_012214
569 Ga0450893_0019590
570 Ga0451577_0101676
571 Ga0451577_0280309
572 Ga0451577_0509386
573 Ga0453683_0428360
574 Ga0466965_0022791
575 Ga0453684_0354249
576 Ga0453684_0431989
577 Ga0453684_0681488
578 Ga0466957_0566742
579 Ga0451576_0301823
580 Ga0451576_0614319
581 Ga0451576_2004764
582 Ga0466958_0114625
583 Ga0495580_0096958
584 Ga0495648_0128550
585 Ga0495640_0104139
586 Ga0495647_0169885
587 Ga0495647_0372176
588 Ga0495658_0068666
589 Ga0495670_0046504
590 Ga0495674_0479605
591 Ga0495680_0311159
592 Ga0495675_0471041
593 Ga0495602_0418702
594 Ga0496100_0017825
595 Ga0496100_1474641
596 Ga0496101_0040825
597 Ga0496102_0018848
598 Ga0496103_0040411
599 Ga0496104_0016890
600 Ga0496104_0081665
601 Ga0496105_0042030
602 Ga0496106_1227041
603 Ga0496108_1030535
604 Ga0496109_0539541
605 Ga0496110_0087023
606 Ga0496111_0686318
607 Ga0496111_0751409
608 Ga0496112_0183303
609 Ga0496113_0232215
610 Ga0496113_0344159
611 Ga0501031_0181321
612 Ga0501032_0019986
613 Ga0501033_0252259
614 Ga0501033_0294572
615 Ga0501034_0148903
616 Ga0501036_0129090
617 Ga0501036_0403084
618 Ga0501037_0039917
619 Ga0501038_0153497
620 Ga0501040_0004321
621 Ga0501040_0104655
622 Ga0501041_0024199
623 Ga0501041_0030019
624 Ga0501042_0132387
625 Ga0501042_0162484
626 Ga0501043_0028186
627 Ga0501046_0086354
628 Ga0501046_0160285
629 Ga0501046_0166513
630 Ga0501046_0361748
631 Ga0501047_0249726
632 Ga0501048_0108948
633 Ga0501068_0104076
634 Ga0501070_0030865
635 Ga0501071_0130568
636 Ga0501072_0186298
637 Ga0501072_0194240
638 Ga0501072_0264384
639 Ga0501073_0294057
640 Ga0501074_0072615
641 Ga0501074_0473617
642 Ga0501075_0005663
643 Ga0501075_0058706
644 Ga0501076_0087382
645 Ga0501076_0198859
646 Ga0501076_1131574
647 Ga0501077_0050605
648 Ga0501077_0402953
649 Ga0501079_0203748
650 Ga0501080_0167415
651 Ga0501080_0208232
652 Ga0501080_0508034
653 Ga0501081_0001591
654 Ga0501081_0090459
655 Ga0501083_0092598
656 Ga0501083_0101967
657 Ga0501044_0601849
658 Ga0501045_0008756
659 Ga0501045_0754498
660 nmdc:mga03683_9442_c1
661 nmdc:mga03n38_112581_c1
662 nmdc:mga0k408_21448_c1
663 nmdc:mga05p37_130035_c1
664 nmdc:mga05p37_24565_c1
665 nmdc:mga05p37_365821_c1
666 nmdc:mga0qj67_949550_c1
667 nmdc:mga06r32_699063_c1
668 nmdc:mga0n895_207156_c1
669 nmdc:mga0rr50_649028_c1
670 nmdc:mga0a205_25914_c1
671 nmdc:mga0a205_416728_c1
672 nmdc:mga0sz30_237279_c1
673 Ga0500658_0130895
674 Ga0500604_0044953
675 Ga0500627_0014019
676 Ga0501084_0205142
677 Ga0501082_0008014
678 Ga0501082_0441665
679 Ga0530510_0053657
680 Ga0530510_0058779

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03358

FMN_red

NADPH-dependent FMN reductase

77

166

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
4laf-assembly1.cif.gz_D crystal structure of pnpb complex with fmn 0.8446 2 156
7q6m-assembly1.cif.gz_D structure of wrba from yersinia pseudotuberculosis in p1 0.8402 1 160
4laf-assembly1.cif.gz_C crystal structure of pnpb complex with fmn 0.8348 1 163
4la4-assembly1.cif.gz_A crystal structure of native pnpb 0.8328 1 162
4la4-assembly1.cif.gz_B-2 crystal structure of native pnpb 0.8309 1 162
ID Description Score Start End Superfamily
af_O33313_1_149_3.40.50.360 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.875 1 158 3.40.50.360
af_O33313_1_149_3.40.50.360 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.8643 1 158 3.40.50.360
4la4A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.8328 1 162 3.40.50.360
4la4A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.8234 1 162 3.40.50.360
af_A0A0R0H261_1_202_3.40.50.360 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.8225 1 156 3.40.50.360
ID Description Score Start End GO Terms
AF-A0A348W2W0-F1-model_v4 deleted 0.9934 1 60
AF-A0A348W2W0-F1-model_v4 deleted 0.9464 1 60
AF-A0A7Y3J3Y9-F1-model_v4 Flavodoxin family protein 0.9441 1 163 GO:0010181
GO:0016491
AF-A0A562ZRT7-F1-model_v4 Flavodoxin family protein 0.9437 2 163 GO:0010181
GO:0016491
AF-A0A1J0V4F9-F1-model_v4 deleted 0.9418 2 163

Map