F414312

General Info

Members Datasets Scaffolds Average Seq Length
340 182 340 129

Family's Representative Sequence

Representative Sequence 3300009147|Ga0114129_10190020|Ga0114129_101900203
Length 146
Sequence LESGERSPEGCDERRYTVAHSFLSEEWFEAVEGLREEAPEPSAALKDLTINIVVVGGPNGDAEVHMEGGQFERGLVDGAPTKLTVPYDVAKAIFIEGNQQAGMQAFMSGQIRVEGDMTKLMTMQASAGAATPEQQAFQTKLQELTE

Samples

Sample ID Description Type Environment
1 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
2 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
17 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
18 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
19 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
20 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
21 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
22 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
23 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
24 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
25 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
26 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
27 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
28 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
29 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
30 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
31 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
32 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
33 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
34 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
35 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
36 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
37 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
38 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
39 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
40 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
41 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
42 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
43 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
44 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
45 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
46 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
48 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
49 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
50 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
51 3300012503 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_R Metagenome Rhizosphere
52 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
53 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
54 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
55 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
56 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
57 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
58 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
59 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
60 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
61 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
62 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
63 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
64 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
65 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
66 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
67 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
68 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
69 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
70 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
89 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
90 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
91 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
92 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
93 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
94 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
95 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
96 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
97 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
98 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
99 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
100 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
101 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
102 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
103 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
104 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
105 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
106 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
107 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
108 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
109 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
110 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
111 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
112 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
113 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
114 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
115 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
116 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
117 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
118 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
119 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
120 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
121 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
122 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
123 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
124 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
125 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
126 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
127 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
128 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
129 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
130 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
131 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
132 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
133 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
134 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
135 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
136 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
137 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
138 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
139 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
140 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
141 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
142 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
143 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
144 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
145 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
146 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
147 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
148 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
149 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
150 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
151 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
152 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
153 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
154 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
155 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
156 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
157 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
158 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
159 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
160 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
161 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
162 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
163 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
164 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
165 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
166 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
167 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
168 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
169 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
170 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
171 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
172 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
173 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
174 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
175 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
176 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
177 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
178 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
179 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
180 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
181 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
182 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.12
Metatranscriptomes 5.88
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.65
Nodule 0
Rhizoplane 0.59
Rhizosphere 90.29
Stem 0
Stem Tuber 0
Unclassified 1.47

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0058863_11958211 3300004799 Bacteria 527
2 Ga0058861_11611134 3300004800 Bacteria 824
3 Ga0058861_11733771 3300004800 Bacteria 617
4 Ga0070658_10006232 3300005327 Bacteria 9661
5 Ga0070683_100811868 3300005329 Bacteria 897
6 Ga0070683_101091172 3300005329 Bacteria 767
7 Ga0070683_102387291 3300005329 Bacteria 507
8 Ga0068869_100868363 3300005334 Bacteria 779
9 Ga0070666_11271933 3300005335 Bacteria 549
10 Ga0070680_100561452 3300005336 Bacteria 979
11 Ga0070680_101482432 3300005336 Bacteria 588
12 Ga0070660_101409295 3300005339 Bacteria 592
13 Ga0070689_101189245 3300005340 Bacteria 684
14 Ga0070661_100133395 3300005344 Unclassified 1867
15 Ga0070661_101450176 3300005344 Unclassified 578
16 Ga0070668_100498972 3300005347 Bacteria 1053
17 Ga0070669_100277065 3300005353 Unclassified 1343
18 Ga0070675_100109982 3300005354 Bacteria 2330
19 Ga0070675_100325552 3300005354 Bacteria 1358
20 Ga0070675_101494141 3300005354 Unclassified 623
21 Ga0070674_101699886 3300005356 Unclassified 571
22 Ga0070674_102054894 3300005356 Unclassified 521
23 Ga0070673_100614988 3300005364 Unclassified 992
24 Ga0070714_100483713 3300005435 Bacteria 1179
25 Ga0070705_101279510 3300005440 Bacteria 607
26 Ga0070708_100006253 3300005445 Bacteria 9469
27 Ga0070708_100013158 3300005445 Bacteria 6770
28 Ga0070708_101153767 3300005445 Bacteria 725
29 Ga0070678_100469706 3300005456 Bacteria 1105
30 Ga0070678_100934636 3300005456 Unclassified 794
31 Ga0070662_100957972 3300005457 Unclassified 732
32 Ga0070681_11045220 3300005458 Bacteria 737
33 Ga0070706_100712408 3300005467 Unclassified 931
34 Ga0070679_101022948 3300005530 Bacteria 770
35 Ga0070684_101097446 3300005535 Bacteria 748
36 Ga0068853_100358342 3300005539 Bacteria 1358
37 Ga0070686_101292298 3300005544 Bacteria 609
38 Ga0070704_100626123 3300005549 Bacteria 948
39 Ga0068856_100104479 3300005614 Bacteria 2827
40 Ga0068852_100656140 3300005616 Unclassified 1057
41 Ga0068859_100188554 3300005617 Bacteria 2146
42 Ga0068858_100807922 3300005842 Bacteria 915
43 Ga0068860_100851546 3300005843 Unclassified 926
44 Ga0081455_10203046 3300005937 Bacteria 1483
45 Ga0081455_10248329 3300005937 Bacteria 1303
46 Ga0081455_10632903 3300005937 Unclassified 692
47 Ga0081538_10058825 3300005981 Bacteria 2225
48 Ga0075365_10008049 3300006038 Bacteria 5952
49 Ga0075365_10047862 3300006038 Bacteria 2812
50 Ga0075365_10087302 3300006038 Bacteria 2121
51 Ga0075365_10117688 3300006038 Bacteria 1831
52 Ga0075365_10344053 3300006038 Bacteria 1051
53 Ga0075363_100190078 3300006048 Bacteria 1171
54 Ga0075364_10156650 3300006051 Bacteria 1536
55 Ga0075364_10452674 3300006051 Bacteria 877
56 Ga0075364_10973941 3300006051 Bacteria 577
57 Ga0075432_10363759 3300006058 Bacteria 616
58 Ga0097621_101763972 3300006237 Unclassified 590
59 Ga0075370_10540869 3300006353 Unclassified 704
60 Ga0075428_100000002 3300006844 Bacteria 546374
61 Ga0075428_100003331 3300006844 Bacteria 17575
62 Ga0075428_100051092 3300006844 Bacteria 4533
63 Ga0075428_100052890 3300006844 Bacteria 4450
64 Ga0075428_100121764 3300006844 Bacteria 2840
65 Ga0075428_100203687 3300006844 Bacteria 2139
66 Ga0075428_100432763 3300006844 Bacteria 1410
67 Ga0075428_100459108 3300006844 Bacteria 1364
68 Ga0075428_100575074 3300006844 Bacteria 1204
69 Ga0075428_102644901 3300006844 Unclassified 512
70 Ga0075430_100009474 3300006846 Bacteria 8230
71 Ga0075430_100025183 3300006846 Bacteria 5060
72 Ga0075430_100034626 3300006846 Bacteria 4287
73 Ga0075430_100163533 3300006846 Bacteria 1852
74 Ga0075430_100194022 3300006846 Bacteria 1687
75 Ga0075430_100219482 3300006846 Bacteria 1578
76 Ga0075430_100333219 3300006846 Bacteria 1254
77 Ga0075431_100001047 3300006847 Bacteria 24688
78 Ga0075431_100029403 3300006847 Bacteria 5657
79 Ga0075431_100048193 3300006847 Bacteria 4394
80 Ga0075431_100094275 3300006847 Bacteria 3089
81 Ga0075431_100113289 3300006847 Bacteria 2799
82 Ga0075431_100141192 3300006847 Bacteria 2482
83 Ga0075431_100146734 3300006847 Bacteria 2431
84 Ga0075431_100216868 3300006847 Bacteria 1953
85 Ga0075431_100420970 3300006847 Bacteria 1335
86 Ga0075433_10945800 3300006852 Bacteria 751
87 Ga0075429_100000556 3300006880 Bacteria 28570
88 Ga0075429_100000896 3300006880 Bacteria 23544
89 Ga0075429_100030653 3300006880 Bacteria 4672
90 Ga0075429_100266311 3300006880 Bacteria 1501
91 Ga0097620_100188550 3300006931 Bacteria 2146
92 Ga0111539_10015662 3300009094 Bacteria 9425
93 Ga0111539_10380421 3300009094 Bacteria 1644
94 Ga0111539_10571837 3300009094 Bacteria 1316
95 Ga0111539_11438781 3300009094 Bacteria 799
96 Ga0105245_10162944 3300009098 Bacteria 2117
97 Ga0105245_10688010 3300009098 Bacteria 1055
98 Ga0114129_10001819 3300009147 Bacteria 29052
99 Ga0114129_10018758 3300009147 Bacteria 9854
100 Ga0114129_10055596 3300009147 Bacteria 5546
101 Ga0114129_10069123 3300009147 Bacteria 4923
102 Ga0114129_10190020 3300009147 Bacteria 2789
103 Ga0114129_10446862 3300009147 Bacteria 1696
104 Ga0105243_12085789 3300009148 Bacteria 602
105 Ga0157313_1058551 3300012503 Bacteria 521
106 Ga0157371_11425034 3300013102 Unclassified 539
107 Ga0157369_10017015 3300013105 Bacteria 8171
108 Ga0157369_10228094 3300013105 Bacteria 1948
109 Ga0157374_10365063 3300013296 Bacteria 1436
110 Ga0157378_10529189 3300013297 Bacteria 1181
111 Ga0157378_11000270 3300013297 Bacteria 870
112 Ga0157378_11108105 3300013297 Bacteria 829
113 Ga0157372_11164595 3300013307 Unclassified 891
114 Ga0157372_12075793 3300013307 Bacteria 653
115 Ga0157375_10589097 3300013308 Bacteria 1272
116 Ga0157375_11137739 3300013308 Unclassified 914
117 Ga0157375_12594725 3300013308 Bacteria 605
118 Ga0157380_11338061 3300014326 Bacteria 765
119 Ga0157380_11508807 3300014326 Bacteria 725
120 Ga0157376_10864039 3300014969 Unclassified 921
121 Ga0197907_10934416 3300020069 Unclassified 1455
122 Ga0197907_11431877 3300020069 Bacteria 571
123 Ga0206356_10090670 3300020070 Bacteria 795
124 Ga0206356_11253760 3300020070 Bacteria 682
125 Ga0206356_11362758 3300020070 Bacteria 917
126 Ga0206349_1844536 3300020075 Unclassified 1190
127 Ga0206355_1652289 3300020076 Bacteria 602
128 Ga0206351_10305649 3300020077 Unclassified 501
129 Ga0206351_10827054 3300020077 Bacteria 623
130 Ga0206352_10515275 3300020078 Bacteria 888
131 Ga0206354_10795115 3300020081 Unclassified 1497
132 Ga0206354_11179138 3300020081 Unclassified 727
133 Ga0206354_11181400 3300020081 Bacteria 537
134 Ga0206353_10414443 3300020082 Unclassified 2176
135 Ga0213876_10019736 3300021384 Bacteria 3560
136 Ga0224712_10033106 3300022467 Unclassified 1889
137 Ga0224712_10036714 3300022467 Bacteria 1818
138 Ga0224712_10412815 3300022467 Bacteria 645
139 Ga0207643_10624937 3300025908 Bacteria 694
140 Ga0207705_10005268 3300025909 Bacteria 9687
141 Ga0207684_10676014 3300025910 Bacteria 879
142 Ga0207707_10770524 3300025912 Bacteria 803
143 Ga0207660_10316011 3300025917 Bacteria 1246
144 Ga0207659_11023041 3300025926 Unclassified 711
145 Ga0207659_11363374 3300025926 Bacteria 608
146 Ga0207690_10776752 3300025932 Bacteria 791
147 Ga0207686_10462914 3300025934 Bacteria 977
148 Ga0207686_11731126 3300025934 Bacteria 517
149 Ga0207670_10652529 3300025936 Unclassified 868
150 Ga0207669_10817599 3300025937 Unclassified 774
151 Ga0207704_10531356 3300025938 Bacteria 953
152 Ga0207661_10671353 3300025944 Bacteria 953
153 Ga0207661_11636278 3300025944 Bacteria 589
154 Ga0207651_10451602 3300025960 Bacteria 1103
155 Ga0207651_11287348 3300025960 Unclassified 657
156 Ga0207640_10406152 3300025981 Bacteria 1110
157 Ga0207703_10669903 3300026035 Bacteria 985
158 Ga0207639_10067450 3300026041 Bacteria 2784
159 Ga0207648_10403330 3300026089 Bacteria 1239
160 Ga0207683_10258930 3300026121 Bacteria 1589
161 Ga0207683_10695241 3300026121 Unclassified 943
162 Ga0209813_10385102 3300027866 Bacteria 562
163 Ga0207428_10020246 3300027907 Bacteria 5655
164 Ga0307413_10054599 3300031824 Bacteria 2425
165 Ga0307410_10006490 3300031852 Bacteria 6317
166 Ga0307407_10037590 3300031903 Bacteria 2676
167 Ga0307412_10170047 3300031911 Bacteria 1629
168 Ga0307409_100010656 3300031995 Bacteria 5735
169 Ga0307409_100393810 3300031995 Bacteria 1321
170 Ga0307416_100224090 3300032002 Bacteria 1806
171 Ga0307411_10062685 3300032005 Bacteria 2481
172 Ga0307415_100073609 3300032126 Bacteria 2411
173 Ga0373946_0128514 3300035171 Bacteria 1164
174 Ga0316574_0609165 3300035398 Bacteria 674
175 Ga0373935_1119487 3300035692 Bacteria 586
176 Ga0436365_0013510 3300039437 Bacteria 17846
177 Ga0436362_0817418 3300039453 Bacteria 1950
178 Ga0439465_0203724 3300041413 Unclassified 722
179 Ga0451837_0014192 3300041494 Bacteria 5174
180 Ga0451853_2104363 3300041512 Bacteria 750
181 Ga0451853_4098489 3300041512 Unclassified 553
182 Ga0450923_141640 3300042125 Bacteria 578
183 Ga0439435_0303379 3300042436 Bacteria 547
184 Ga0466966_0014422 3300044684 Bacteria 5233
185 Ga0466963_0018602 3300044694 Bacteria 4347
186 Ga0466958_0080497 3300045836 Bacteria 2004
187 Ga0466967_0319326 3300045976 Bacteria 1497
188 Ga0466967_0396151 3300045976 Bacteria 1343
189 Ga0495629_0237675 3300046459 Bacteria 1255
190 Ga0495639_0064761 3300046475 Bacteria 1681
191 Ga0495628_0245478 3300046516 Bacteria 1338
192 Ga0495644_0373173 3300046523 Unclassified 563
193 Ga0495586_0048271 3300046535 Unclassified 2300
194 Ga0495586_0414657 3300046535 Unclassified 775
195 Ga0495621_0230464 3300046539 Bacteria 752
196 Ga0495645_0348429 3300046543 Bacteria 955
197 Ga0495634_0009347 3300046642 Bacteria 7233
198 Ga0495588_0258536 3300046674 Bacteria 918
199 Ga0495647_0061969 3300046681 Bacteria 1478
200 Ga0495658_0247937 3300046683 Unclassified 1119
201 Ga0495658_0347892 3300046683 Unclassified 942
202 Ga0495613_0039109 3300046689 Bacteria 3516
203 Ga0495613_0225034 3300046689 Bacteria 1316
204 Ga0495624_0195860 3300046690 Bacteria 1228
205 Ga0495589_0382657 3300046794 Bacteria 647
206 Ga0495674_1330158 3300047319 Unclassified 538
207 Ga0495676_0302053 3300047321 Bacteria 1079
208 Ga0495680_0079012 3300047322 Unclassified 2489
209 Ga0495593_0326493 3300047673 Bacteria 767
210 Ga0496106_1137214 3300048909 Bacteria 611
211 Ga0496109_0490422 3300048912 Bacteria 1160
212 Ga0501032_0399049 3300049569 Bacteria 883
213 Ga0501033_0008893 3300049570 Bacteria 7757
214 Ga0501033_0026515 3300049570 Bacteria 4361
215 Ga0501034_0000255 3300049571 Bacteria 97887
216 Ga0501034_0001375 3300049571 Bacteria 32685
217 Ga0501034_0001825 3300049571 Bacteria 27031
218 Ga0501036_0014678 3300049572 Bacteria 6529
219 Ga0501036_1208985 3300049572 Bacteria 616
220 Ga0501037_0116331 3300049573 Bacteria 1924
221 Ga0501038_0654194 3300049574 Unclassified 791
222 Ga0501038_0776527 3300049574 Unclassified 713
223 Ga0501039_0030027 3300049575 Bacteria 4188
224 Ga0501040_0012445 3300049576 Bacteria 5575
225 Ga0501041_0041136 3300049577 Bacteria 2806
226 Ga0501043_1024080 3300049579 Bacteria 587
227 Ga0501046_0162319 3300049580 Bacteria 1680
228 Ga0501046_0790558 3300049580 Bacteria 665
229 Ga0501047_0068125 3300049581 Bacteria 3429
230 Ga0501048_0106354 3300049582 Bacteria 1980
231 Ga0501068_0006888 3300049584 Bacteria 6284
232 Ga0501068_0007529 3300049584 Bacteria 6025
233 Ga0501068_0094519 3300049584 Bacteria 1848
234 Ga0501068_0415358 3300049584 Bacteria 868
235 Ga0501068_0543290 3300049584 Bacteria 755
236 Ga0501069_0000041 3300049585 Bacteria 79028
237 Ga0501069_0005758 3300049585 Bacteria 6457
238 Ga0501069_0025361 3300049585 Bacteria 3240
239 Ga0501070_0000013 3300049586 Bacteria 180554
240 Ga0501070_0006607 3300049586 Bacteria 9868
241 Ga0501070_0023620 3300049586 Bacteria 5151
242 Ga0501070_0026321 3300049586 Bacteria 4882
243 Ga0501071_0005449 3300049587 Bacteria 8181
244 Ga0501071_0011076 3300049587 Bacteria 6061
245 Ga0501071_0011156 3300049587 Bacteria 6042
246 Ga0501071_0042618 3300049587 Bacteria 3253
247 Ga0501071_0382150 3300049587 Bacteria 1074
248 Ga0501071_0506450 3300049587 Bacteria 926
249 Ga0501071_1035554 3300049587 Bacteria 634
250 Ga0501071_1259792 3300049587 Bacteria 571
251 Ga0501071_1464188 3300049587 Bacteria 527
252 Ga0501071_1559327 3300049587 Bacteria 510
253 Ga0501072_0003020 3300049588 Bacteria 12693
254 Ga0501072_0005578 3300049588 Bacteria 9573
255 Ga0501072_0013346 3300049588 Bacteria 6289
256 Ga0501072_0017545 3300049588 Bacteria 5501
257 Ga0501072_0063846 3300049588 Bacteria 2905
258 Ga0501073_0008360 3300049589 Bacteria 7675
259 Ga0501073_0012898 3300049589 Bacteria 6093
260 Ga0501073_0023141 3300049589 Bacteria 4466
261 Ga0501073_0544846 3300049589 Bacteria 802
262 Ga0501073_0784470 3300049589 Bacteria 657
263 Ga0501074_0003351 3300049590 Bacteria 11349
264 Ga0501074_0017212 3300049590 Bacteria 5245
265 Ga0501074_0056993 3300049590 Bacteria 2815
266 Ga0501075_0005888 3300049591 Bacteria 8384
267 Ga0501076_0013506 3300049592 Bacteria 6123
268 Ga0501077_0045396 3300049593 Bacteria 2791
269 Ga0501079_0028416 3300049741 Bacteria 4291
270 Ga0501079_0033795 3300049741 Bacteria 3935
271 Ga0501080_0016998 3300049742 Bacteria 6718
272 Ga0501080_0024522 3300049742 Bacteria 5591
273 Ga0501080_0027005 3300049742 Bacteria 5338
274 Ga0501080_0293019 3300049742 Bacteria 1477
275 Ga0501080_1525367 3300049742 Bacteria 567
276 Ga0501081_0112772 3300049743 Bacteria 1930
277 Ga0501083_0014495 3300049744 Bacteria 5511
278 Ga0501083_0026609 3300049744 Bacteria 3996
279 Ga0501083_0080837 3300049744 Bacteria 2155
280 Ga0501083_0449893 3300049744 Bacteria 838
281 Ga0501035_0050252 3300049822 Bacteria 3737
282 Ga0501044_0042513 3300049823 Bacteria 4726
283 Ga0501045_0030891 3300049824 Bacteria 3878
284 nmdc:mga03n38_203150_c1 3300050490 Bacteria 1026
285 nmdc:mga00v17_3623_c1 3300050491 Bacteria 7982
286 nmdc:mga00v17_465788_c1 3300050491 Bacteria 820
287 nmdc:mga0yw44_135024_c1 3300050492 Bacteria 1600
288 nmdc:mga0yw44_167559_c1 3300050492 Bacteria 1441
289 nmdc:mga0yw44_250650_c1 3300050492 Bacteria 1178
290 nmdc:mga0yw44_593712_c1 3300050492 Bacteria 752
291 nmdc:mga0yw44_62676_c1 3300050492 Bacteria 2284
292 nmdc:mga0yw44_708986_c1 3300050492 Bacteria 683
293 nmdc:mga0yw44_82504_c1 3300050492 Bacteria 2017
294 nmdc:mga04h51_268212_c1 3300050495 Bacteria 688
295 nmdc:mga07m45_412339_c1 3300050496 Unclassified 784
296 nmdc:mga05p37_130377_c1 3300050507 Bacteria 3085
297 nmdc:mga05p37_1372985_c1 3300050507 Unclassified 714
298 nmdc:mga05p37_15909_c1 3300050507 Bacteria 9050
299 nmdc:mga05p37_262527_c1 3300050507 Bacteria 2066
300 nmdc:mga05p37_30095_c1 3300050507 Bacteria 6625
301 nmdc:mga05p37_85253_c1 3300050507 Bacteria 3892
302 nmdc:mga09592_114797_c1 3300050508 Bacteria 2311
303 nmdc:mga09592_11813_c1 3300050508 Bacteria 5074
304 nmdc:mga09592_289569_c1 3300050508 Bacteria 1420
305 nmdc:mga09592_307_c1 3300050508 Bacteria 35790
306 nmdc:mga09592_427947_c1 3300050508 Bacteria 1143
307 nmdc:mga0qj67_129904_c1 3300050509 Bacteria 2040
308 nmdc:mga0qj67_51255_c1 3300050509 Bacteria 3263
309 nmdc:mga0qj67_51371_c1 3300050509 Bacteria 3260
310 nmdc:mga0qj67_66496_c1 3300050509 Bacteria 2871
311 nmdc:mga0qj67_691730_c1 3300050509 Bacteria 812
312 nmdc:mga0qj67_76360_c1 3300050509 Bacteria 2679
313 nmdc:mga0qj67_827782_c1 3300050509 Bacteria 732
314 nmdc:mga06r32_104875_c1 3300050510 Bacteria 2777
315 nmdc:mga06r32_128289_c1 3300050510 Bacteria 2506
316 nmdc:mga06r32_153_c1 3300050510 Bacteria 52808
317 nmdc:mga06r32_1822270_c1 3300050510 Unclassified 544
318 nmdc:mga06r32_19152_c1 3300050510 Bacteria 6281
319 nmdc:mga06r32_2059394_c1 3300050510 Bacteria 504
320 nmdc:mga06r32_23807_c1 3300050510 Bacteria 5673
321 nmdc:mga06r32_46741_c1 3300050510 Bacteria 4131
322 nmdc:mga08y16_1041558_c1 3300050511 Bacteria 796
323 nmdc:mga08y16_121448_c1 3300050511 Bacteria 2719
324 nmdc:mga08y16_279316_c1 3300050511 Bacteria 1723
325 nmdc:mga08y16_345284_c1 3300050511 Bacteria 1530
326 nmdc:mga08y16_444794_c1 3300050511 Unclassified 1322
327 nmdc:mga08y16_62065_c1 3300050511 Bacteria 3903
328 nmdc:mga0a205_1572468_c1 3300050515 Bacteria 506
329 Ga0495601_0014400 3300053077 Bacteria 4766
330 Ga0495612_0180066 3300053078 Unclassified 928
331 Ga0500566_0130348 3300053094 Unclassified 1346
332 Ga0500593_061852 3300053117 Bacteria 1644
333 Ga0500616_0034832 3300053153 Bacteria 2741
334 Ga0501084_0003856 3300054114 Bacteria 12208
335 Ga0501084_0317241 3300054114 Bacteria 1316
336 Ga0590071_083263 3300059421 Bacteria 796
337 Ga0590077_033254 3300059426 Bacteria 1131
338 Ga0590077_109437 3300059426 Bacteria 649
339 Ga0501082_0056705 3300060353 Bacteria 3375
340 Ga0530510_0004141 3300061734 Bacteria 10015

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025944 Ga0207661_11636278 Ga0207661_116362781 88
2 3300047319 Ga0495674_1330158 Ga0495674_1330158_38_367 100
3 3300009098 Ga0105245_10162944 Ga0105245_101629442 113
4 3300009148 Ga0105243_12085789 Ga0105243_120857891 113
5 3300013308 Ga0157375_12594725 Ga0157375_125947251 113
6 3300039437 Ga0436365_0013510 Ga0436365_0013510_5244_5627 113
7 3300041494 Ga0451837_0014192 Ga0451837_0014192_1340_1720 113
8 3300049571 Ga0501034_0001825 Ga0501034_0001825_3983_4384 113
9 3300049587 Ga0501071_0042618 Ga0501071_0042618_373_756 113
10 3300049587 Ga0501071_1464188 Ga0501071_1464188_101_502 113
11 3300049588 Ga0501072_0003020 Ga0501072_0003020_7307_7708 113
12 3300049588 Ga0501072_0013346 Ga0501072_0013346_3088_3471 113
13 3300049589 Ga0501073_0023141 Ga0501073_0023141_3901_4302 113
14 3300049589 Ga0501073_0544846 Ga0501073_0544846_290_682 113
15 3300049589 Ga0501073_0784470 Ga0501073_0784470_260_643 113
16 3300049590 Ga0501074_0056993 Ga0501074_0056993_473_874 113
17 3300049742 Ga0501080_0293019 Ga0501080_0293019_923_1306 113
18 3300005329 Ga0070683_101091172 Ga0070683_1010911721 114
19 3300005535 Ga0070684_101097446 Ga0070684_1010974462 114
20 3300009098 Ga0105245_10688010 Ga0105245_106880102 114
21 3300013297 Ga0157378_11000270 Ga0157378_110002702 114
22 3300025944 Ga0207661_10671353 Ga0207661_106713532 114
23 3300035171 Ga0373946_0128514 Ga0373946_0128514_97_489 114
24 3300035692 Ga0373935_1119487 Ga0373935_1119487_144_536 114
25 3300050492 nmdc:mga0yw44_708986_c1 nmdc:mga0yw44_708986_c1_82_474 114
26 3300005937 Ga0081455_10203046 Ga0081455_102030462 115
27 3300006844 Ga0075428_100459108 Ga0075428_1004591082 115
28 3300006846 Ga0075430_100194022 Ga0075430_1001940221 115
29 3300006847 Ga0075431_100094275 Ga0075431_1000942754 115
30 3300006880 Ga0075429_100266311 Ga0075429_1002663112 115
31 3300009147 Ga0114129_10446862 Ga0114129_104468622 115
32 3300012503 Ga0157313_1058551 Ga0157313_10585511 115
33 3300014326 Ga0157380_11508807 Ga0157380_115088072 115
34 3300046523 Ga0495644_0373173 Ga0495644_0373173_129_527 115
35 3300050507 nmdc:mga05p37_1372985_c1 nmdc:mga05p37_1372985_c1_28_408 115
36 3300050508 nmdc:mga09592_289569_c1 nmdc:mga09592_289569_c1_84_464 115
37 3300050509 nmdc:mga0qj67_827782_c1 nmdc:mga0qj67_827782_c1_77_457 115
38 3300005356 Ga0070674_102054894 Ga0070674_1020548941 116
39 3300049570 Ga0501033_0008893 Ga0501033_0008893_4296_4706 116
40 3300049580 Ga0501046_0790558 Ga0501046_0790558_65_475 116
41 3300049581 Ga0501047_0068125 Ga0501047_0068125_1139_1549 116
42 3300049585 Ga0501069_0025361 Ga0501069_0025361_2236_2646 116
43 3300049823 Ga0501044_0042513 Ga0501044_0042513_3648_4058 116
44 3300006038 Ga0075365_10047862 Ga0075365_100478622 117
45 3300031911 Ga0307412_10170047 Ga0307412_101700472 117
46 3300050492 nmdc:mga0yw44_82504_c1 nmdc:mga0yw44_82504_c1_69_461 117
47 3300006038 Ga0075365_10087302 Ga0075365_100873022 118
48 3300006038 Ga0075365_10117688 Ga0075365_101176882 118
49 3300006353 Ga0075370_10540869 Ga0075370_105408691 118
50 3300031995 Ga0307409_100393810 Ga0307409_1003938102 118
51 3300050492 nmdc:mga0yw44_135024_c1 nmdc:mga0yw44_135024_c1_181_558 118
52 3300050492 nmdc:mga0yw44_250650_c1 nmdc:mga0yw44_250650_c1_322_699 118
53 3300050492 nmdc:mga0yw44_62676_c1 nmdc:mga0yw44_62676_c1_415_795 118
54 3300050496 nmdc:mga07m45_412339_c1 nmdc:mga07m45_412339_c1_313_690 118
55 3300006038 Ga0075365_10344053 Ga0075365_103440532 119
56 3300006844 Ga0075428_100203687 Ga0075428_1002036872 119
57 3300006846 Ga0075430_100034626 Ga0075430_1000346264 119
58 3300006847 Ga0075431_100113289 Ga0075431_1001132891 119
59 3300006852 Ga0075433_10945800 Ga0075433_109458001 119
60 3300009147 Ga0114129_10018758 Ga0114129_100187585 119
61 3300050509 nmdc:mga0qj67_76360_c1 nmdc:mga0qj67_76360_c1_1230_1610 119
62 3300050511 nmdc:mga08y16_345284_c1 nmdc:mga08y16_345284_c1_13_393 119
63 3300050515 nmdc:mga0a205_1572468_c1 nmdc:mga0a205_1572468_c1_99_479 119
64 3300005329 Ga0070683_102387291 Ga0070683_1023872911 120
65 3300005336 Ga0070680_100561452 Ga0070680_1005614522 120
66 3300005530 Ga0070679_101022948 Ga0070679_1010229481 120
67 3300005539 Ga0068853_100358342 Ga0068853_1003583422 120
68 3300005614 Ga0068856_100104479 Ga0068856_1001044794 120
69 3300005616 Ga0068852_100656140 Ga0068852_1006561401 120
70 3300013105 Ga0157369_10228094 Ga0157369_102280942 120
71 3300020070 Ga0206356_11362758 Ga0206356_113627581 120
72 3300025912 Ga0207707_10770524 Ga0207707_107705242 120
73 3300025981 Ga0207640_10406152 Ga0207640_104061521 120
74 3300026041 Ga0207639_10067450 Ga0207639_100674502 120
75 3300041512 Ga0451853_2104363 Ga0451853_2104363_282_659 121
76 3300004800 Ga0058861_11611134 Ga0058861_116111341 122
77 3300005327 Ga0070658_10006232 Ga0070658_100062325 122
78 3300005339 Ga0070660_101409295 Ga0070660_1014092951 122
79 3300005344 Ga0070661_101450176 Ga0070661_1014501761 122
80 3300005435 Ga0070714_100483713 Ga0070714_1004837132 122
81 3300005458 Ga0070681_11045220 Ga0070681_110452201 122
82 3300006844 Ga0075428_100000002 Ga0075428_100000002305 122
83 3300013105 Ga0157369_10017015 Ga0157369_100170154 122
84 3300020069 Ga0197907_10934416 Ga0197907_109344162 122
85 3300020070 Ga0206356_10090670 Ga0206356_100906701 122
86 3300020075 Ga0206349_1844536 Ga0206349_18445362 122
87 3300020077 Ga0206351_10827054 Ga0206351_108270541 122
88 3300020078 Ga0206352_10515275 Ga0206352_105152753 122
89 3300020081 Ga0206354_10795115 Ga0206354_107951152 122
90 3300020082 Ga0206353_10414443 Ga0206353_104144433 122
91 3300021384 Ga0213876_10019736 Ga0213876_100197362 122
92 3300022467 Ga0224712_10033106 Ga0224712_100331062 122
93 3300025909 Ga0207705_10005268 Ga0207705_100052685 122
94 3300025917 Ga0207660_10316011 Ga0207660_103160112 122
95 3300039453 Ga0436362_0817418 Ga0436362_0817418_1385_1765 122
96 3300049587 Ga0501071_1559327 Ga0501071_1559327_96_482 122
97 3300005329 Ga0070683_100811868 Ga0070683_1008118681 123
98 3300005335 Ga0070666_11271933 Ga0070666_112719331 123
99 3300005336 Ga0070680_101482432 Ga0070680_1014824321 123
100 3300005445 Ga0070708_101153767 Ga0070708_1011537671 123
101 3300005549 Ga0070704_100626123 Ga0070704_1006261231 123
102 3300006038 Ga0075365_10008049 Ga0075365_100080495 123
103 3300006051 Ga0075364_10973941 Ga0075364_109739411 123
104 3300006237 Ga0097621_101763972 Ga0097621_1017639721 123
105 3300009094 Ga0111539_10380421 Ga0111539_103804212 123
106 3300013307 Ga0157372_12075793 Ga0157372_120757931 123
107 3300022467 Ga0224712_10036714 Ga0224712_100367142 123
108 3300042125 Ga0450923_141640 Ga0450923_141640_96_485 123
109 3300045976 Ga0466967_0319326 Ga0466967_0319326_938_1324 123
110 3300046535 Ga0495586_0048271 Ga0495586_0048271_446_832 123
111 3300046642 Ga0495634_0009347 Ga0495634_0009347_3587_3973 123
112 3300046689 Ga0495613_0039109 Ga0495613_0039109_3084_3470 123
113 3300046794 Ga0495589_0382657 Ga0495589_0382657_17_424 123
114 3300047322 Ga0495680_0079012 Ga0495680_0079012_666_1052 123
115 3300049571 Ga0501034_0001375 Ga0501034_0001375_16973_17377 123
116 3300049572 Ga0501036_1208985 Ga0501036_1208985_79_486 123
117 3300049573 Ga0501037_0116331 Ga0501037_0116331_19_423 123
118 3300049579 Ga0501043_1024080 Ga0501043_1024080_53_466 123
119 3300049584 Ga0501068_0006888 Ga0501068_0006888_2822_3226 123
120 3300049584 Ga0501068_0007529 Ga0501068_0007529_2793_3197 123
121 3300049585 Ga0501069_0000041 Ga0501069_0000041_67851_68240 123
122 3300049585 Ga0501069_0005758 Ga0501069_0005758_2035_2439 123
123 3300049586 Ga0501070_0000013 Ga0501070_0000013_10627_11016 123
124 3300049586 Ga0501070_0006607 Ga0501070_0006607_3811_4215 123
125 3300049586 Ga0501070_0026321 Ga0501070_0026321_3748_4152 123
126 3300049587 Ga0501071_0005449 Ga0501071_0005449_3286_3675 123
127 3300049587 Ga0501071_0011076 Ga0501071_0011076_5614_6018 123
128 3300049587 Ga0501071_1259792 Ga0501071_1259792_120_527 123
129 3300049588 Ga0501072_0017545 Ga0501072_0017545_4631_5035 123
130 3300049589 Ga0501073_0008360 Ga0501073_0008360_1889_2293 123
131 3300049589 Ga0501073_0012898 Ga0501073_0012898_365_769 123
132 3300049590 Ga0501074_0003351 Ga0501074_0003351_7630_8034 123
133 3300049741 Ga0501079_0033795 Ga0501079_0033795_3388_3792 123
134 3300049742 Ga0501080_0016998 Ga0501080_0016998_2891_3280 123
135 3300049742 Ga0501080_0024522 Ga0501080_0024522_1660_2064 123
136 3300049742 Ga0501080_0027005 Ga0501080_0027005_3570_3974 123
137 3300049744 Ga0501083_0014495 Ga0501083_0014495_3984_4388 123
138 3300049744 Ga0501083_0026609 Ga0501083_0026609_860_1264 123
139 3300049744 Ga0501083_0080837 Ga0501083_0080837_500_904 123
140 3300050492 nmdc:mga0yw44_167559_c1 nmdc:mga0yw44_167559_c1_129_539 123
141 3300050511 nmdc:mga08y16_1041558_c1 nmdc:mga08y16_1041558_c1_74_493 123
142 3300053094 Ga0500566_0130348 Ga0500566_0130348_17_403 123
143 3300053117 Ga0500593_061852 Ga0500593_061852_323_727 123
144 3300053153 Ga0500616_0034832 Ga0500616_0034832_1709_2116 123
145 3300054114 Ga0501084_0003856 Ga0501084_0003856_6456_6860 123
146 3300059426 Ga0590077_109437 Ga0590077_109437_180_584 123
147 3300005340 Ga0070689_101189245 Ga0070689_1011892452 124
148 3300005344 Ga0070661_100133395 Ga0070661_1001333952 124
149 3300005347 Ga0070668_100498972 Ga0070668_1004989721 124
150 3300005353 Ga0070669_100277065 Ga0070669_1002770652 124
151 3300005354 Ga0070675_100109982 Ga0070675_1001099821 124
152 3300005354 Ga0070675_100325552 Ga0070675_1003255522 124
153 3300005356 Ga0070674_101699886 Ga0070674_1016998861 124
154 3300005364 Ga0070673_100614988 Ga0070673_1006149882 124
155 3300005456 Ga0070678_100469706 Ga0070678_1004697062 124
156 3300005457 Ga0070662_100957972 Ga0070662_1009579722 124
157 3300005544 Ga0070686_101292298 Ga0070686_1012922982 124
158 3300005617 Ga0068859_100188554 Ga0068859_1001885542 124
159 3300005842 Ga0068858_100807922 Ga0068858_1008079222 124
160 3300005843 Ga0068860_100851546 Ga0068860_1008515462 124
161 3300005937 Ga0081455_10248329 Ga0081455_102483292 124
162 3300005937 Ga0081455_10632903 Ga0081455_106329032 124
163 3300005981 Ga0081538_10058825 Ga0081538_100588252 124
164 3300006844 Ga0075428_100003331 Ga0075428_10000333118 124
165 3300006844 Ga0075428_100051092 Ga0075428_1000510923 124
166 3300006844 Ga0075428_100052890 Ga0075428_1000528903 124
167 3300006844 Ga0075428_100432763 Ga0075428_1004327632 124
168 3300006846 Ga0075430_100009474 Ga0075430_1000094747 124
169 3300006846 Ga0075430_100025183 Ga0075430_1000251832 124
170 3300006846 Ga0075430_100163533 Ga0075430_1001635332 124
171 3300006847 Ga0075431_100001047 Ga0075431_10000104713 124
172 3300006847 Ga0075431_100048193 Ga0075431_1000481932 124
173 3300006847 Ga0075431_100141192 Ga0075431_1001411923 124
174 3300006847 Ga0075431_100146734 Ga0075431_1001467342 124
175 3300006847 Ga0075431_100216868 Ga0075431_1002168682 124
176 3300006880 Ga0075429_100000556 Ga0075429_1000005568 124
177 3300006880 Ga0075429_100000896 Ga0075429_1000008964 124
178 3300006931 Ga0097620_100188550 Ga0097620_1001885502 124
179 3300009094 Ga0111539_10015662 Ga0111539_100156627 124
180 3300009094 Ga0111539_10571837 Ga0111539_105718372 124
181 3300009094 Ga0111539_11438781 Ga0111539_114387812 124
182 3300009147 Ga0114129_10001819 Ga0114129_100018193 124
183 3300009147 Ga0114129_10055596 Ga0114129_100555966 124
184 3300009147 Ga0114129_10069123 Ga0114129_100691235 124
185 3300013102 Ga0157371_11425034 Ga0157371_114250341 124
186 3300013296 Ga0157374_10365063 Ga0157374_103650632 124
187 3300013297 Ga0157378_10529189 Ga0157378_105291892 124
188 3300013308 Ga0157375_11137739 Ga0157375_111377392 124
189 3300014326 Ga0157380_11338061 Ga0157380_113380611 124
190 3300020081 Ga0206354_11179138 Ga0206354_111791381 124
191 3300025926 Ga0207659_11023041 Ga0207659_110230412 124
192 3300025926 Ga0207659_11363374 Ga0207659_113633741 124
193 3300025932 Ga0207690_10776752 Ga0207690_107767522 124
194 3300025934 Ga0207686_11731126 Ga0207686_117311261 124
195 3300025936 Ga0207670_10652529 Ga0207670_106525291 124
196 3300025937 Ga0207669_10817599 Ga0207669_108175992 124
197 3300025960 Ga0207651_10451602 Ga0207651_104516022 124
198 3300025960 Ga0207651_11287348 Ga0207651_112873481 124
199 3300026035 Ga0207703_10669903 Ga0207703_106699032 124
200 3300026121 Ga0207683_10258930 Ga0207683_102589302 124
201 3300027907 Ga0207428_10020246 Ga0207428_100202461 124
202 3300031824 Ga0307413_10054599 Ga0307413_100545992 124
203 3300031852 Ga0307410_10006490 Ga0307410_100064903 124
204 3300031903 Ga0307407_10037590 Ga0307407_100375902 124
205 3300031995 Ga0307409_100010656 Ga0307409_1000106564 124
206 3300032002 Ga0307416_100224090 Ga0307416_1002240902 124
207 3300032005 Ga0307411_10062685 Ga0307411_100626851 124
208 3300032126 Ga0307415_100073609 Ga0307415_1000736093 124
209 3300035398 Ga0316574_0609165 Ga0316574_0609165_108_524 124
210 3300041413 Ga0439465_0203724 Ga0439465_0203724_69_455 124
211 3300041512 Ga0451853_4098489 Ga0451853_4098489_62_505 124
212 3300042436 Ga0439435_0303379 Ga0439435_0303379_113_499 124
213 3300044684 Ga0466966_0014422 Ga0466966_0014422_3658_4044 124
214 3300044694 Ga0466963_0018602 Ga0466963_0018602_944_1336 124
215 3300045836 Ga0466958_0080497 Ga0466958_0080497_662_1054 124
216 3300045976 Ga0466967_0396151 Ga0466967_0396151_638_1036 124
217 3300046459 Ga0495629_0237675 Ga0495629_0237675_474_866 124
218 3300046475 Ga0495639_0064761 Ga0495639_0064761_941_1330 124
219 3300046516 Ga0495628_0245478 Ga0495628_0245478_143_544 124
220 3300046535 Ga0495586_0414657 Ga0495586_0414657_138_530 124
221 3300046543 Ga0495645_0348429 Ga0495645_0348429_427_828 124
222 3300046674 Ga0495588_0258536 Ga0495588_0258536_204_596 124
223 3300046681 Ga0495647_0061969 Ga0495647_0061969_916_1305 124
224 3300046683 Ga0495658_0247937 Ga0495658_0247937_600_992 124
225 3300046683 Ga0495658_0347892 Ga0495658_0347892_388_777 124
226 3300046689 Ga0495613_0225034 Ga0495613_0225034_303_695 124
227 3300046690 Ga0495624_0195860 Ga0495624_0195860_205_594 124
228 3300047321 Ga0495676_0302053 Ga0495676_0302053_659_1048 124
229 3300047673 Ga0495593_0326493 Ga0495593_0326493_347_739 124
230 3300048909 Ga0496106_1137214 Ga0496106_1137214_43_435 124
231 3300048912 Ga0496109_0490422 Ga0496109_0490422_605_997 124
232 3300049569 Ga0501032_0399049 Ga0501032_0399049_89_475 124
233 3300049570 Ga0501033_0026515 Ga0501033_0026515_1723_2109 124
234 3300049572 Ga0501036_0014678 Ga0501036_0014678_2253_2639 124
235 3300049574 Ga0501038_0654194 Ga0501038_0654194_387_779 124
236 3300049574 Ga0501038_0776527 Ga0501038_0776527_235_621 124
237 3300049575 Ga0501039_0030027 Ga0501039_0030027_2174_2560 124
238 3300049576 Ga0501040_0012445 Ga0501040_0012445_1248_1634 124
239 3300049577 Ga0501041_0041136 Ga0501041_0041136_1516_1902 124
240 3300049580 Ga0501046_0162319 Ga0501046_0162319_1235_1621 124
241 3300049582 Ga0501048_0106354 Ga0501048_0106354_161_547 124
242 3300049584 Ga0501068_0415358 Ga0501068_0415358_55_441 124
243 3300049584 Ga0501068_0543290 Ga0501068_0543290_316_702 124
244 3300049587 Ga0501071_0011156 Ga0501071_0011156_5597_5983 124
245 3300049587 Ga0501071_0382150 Ga0501071_0382150_185_574 124
246 3300049587 Ga0501071_0506450 Ga0501071_0506450_84_479 124
247 3300049587 Ga0501071_1035554 Ga0501071_1035554_21_419 124
248 3300049588 Ga0501072_0063846 Ga0501072_0063846_24_410 124
249 3300049590 Ga0501074_0017212 Ga0501074_0017212_72_458 124
250 3300049591 Ga0501075_0005888 Ga0501075_0005888_7874_8260 124
251 3300049592 Ga0501076_0013506 Ga0501076_0013506_3905_4291 124
252 3300049593 Ga0501077_0045396 Ga0501077_0045396_408_794 124
253 3300049741 Ga0501079_0028416 Ga0501079_0028416_1109_1495 124
254 3300049742 Ga0501080_1525367 Ga0501080_1525367_88_474 124
255 3300049743 Ga0501081_0112772 Ga0501081_0112772_301_687 124
256 3300049744 Ga0501083_0449893 Ga0501083_0449893_275_661 124
257 3300049822 Ga0501035_0050252 Ga0501035_0050252_2427_2813 124
258 3300049824 Ga0501045_0030891 Ga0501045_0030891_2140_2526 124
259 3300050507 nmdc:mga05p37_130377_c1 nmdc:mga05p37_130377_c1_1949_2335 124
260 3300050507 nmdc:mga05p37_15909_c1 nmdc:mga05p37_15909_c1_831_1217 124
261 3300050507 nmdc:mga05p37_30095_c1 nmdc:mga05p37_30095_c1_5153_5539 124
262 3300050507 nmdc:mga05p37_85253_c1 nmdc:mga05p37_85253_c1_2858_3244 124
263 3300050508 nmdc:mga09592_114797_c1 nmdc:mga09592_114797_c1_1473_1859 124
264 3300050508 nmdc:mga09592_307_c1 nmdc:mga09592_307_c1_18885_19271 124
265 3300050508 nmdc:mga09592_427947_c1 nmdc:mga09592_427947_c1_306_692 124
266 3300050509 nmdc:mga0qj67_129904_c1 nmdc:mga0qj67_129904_c1_1062_1448 124
267 3300050509 nmdc:mga0qj67_51371_c1 nmdc:mga0qj67_51371_c1_2580_2966 124
268 3300050509 nmdc:mga0qj67_691730_c1 nmdc:mga0qj67_691730_c1_284_670 124
269 3300050510 nmdc:mga06r32_104875_c1 nmdc:mga06r32_104875_c1_1252_1638 124
270 3300050510 nmdc:mga06r32_128289_c1 nmdc:mga06r32_128289_c1_1046_1432 124
271 3300050510 nmdc:mga06r32_153_c1 nmdc:mga06r32_153_c1_49943_50329 124
272 3300050510 nmdc:mga06r32_1822270_c1 nmdc:mga06r32_1822270_c1_53_439 124
273 3300050510 nmdc:mga06r32_19152_c1 nmdc:mga06r32_19152_c1_2511_2897 124
274 3300050510 nmdc:mga06r32_46741_c1 nmdc:mga06r32_46741_c1_2915_3301 124
275 3300050511 nmdc:mga08y16_121448_c1 nmdc:mga08y16_121448_c1_1254_1640 124
276 3300050511 nmdc:mga08y16_279316_c1 nmdc:mga08y16_279316_c1_758_1144 124
277 3300050511 nmdc:mga08y16_444794_c1 nmdc:mga08y16_444794_c1_420_818 124
278 3300050511 nmdc:mga08y16_62065_c1 nmdc:mga08y16_62065_c1_135_521 124
279 3300053077 Ga0495601_0014400 Ga0495601_0014400_43_444 124
280 3300053078 Ga0495612_0180066 Ga0495612_0180066_409_810 124
281 3300054114 Ga0501084_0317241 Ga0501084_0317241_596_982 124
282 3300059421 Ga0590071_083263 Ga0590071_083263_244_630 124
283 3300059426 Ga0590077_033254 Ga0590077_033254_708_1094 124
284 3300060353 Ga0501082_0056705 Ga0501082_0056705_100_486 124
285 3300061734 Ga0530510_0004141 Ga0530510_0004141_872_1258 124
286 3300004799 Ga0058863_11958211 Ga0058863_119582111 125
287 3300004800 Ga0058861_11733771 Ga0058861_117337711 125
288 3300005334 Ga0068869_100868363 Ga0068869_1008683631 125
289 3300005354 Ga0070675_101494141 Ga0070675_1014941411 125
290 3300005440 Ga0070705_101279510 Ga0070705_1012795101 125
291 3300005445 Ga0070708_100006253 Ga0070708_1000062535 125
292 3300005445 Ga0070708_100013158 Ga0070708_1000131582 125
293 3300005456 Ga0070678_100934636 Ga0070678_1009346362 125
294 3300005467 Ga0070706_100712408 Ga0070706_1007124081 125
295 3300006048 Ga0075363_100190078 Ga0075363_1001900782 125
296 3300006051 Ga0075364_10156650 Ga0075364_101566501 125
297 3300006051 Ga0075364_10452674 Ga0075364_104526742 125
298 3300006058 Ga0075432_10363759 Ga0075432_103637591 125
299 3300006844 Ga0075428_100121764 Ga0075428_1001217641 125
300 3300006844 Ga0075428_100575074 Ga0075428_1005750742 125
301 3300006844 Ga0075428_102644901 Ga0075428_1026449011 125
302 3300006846 Ga0075430_100219482 Ga0075430_1002194823 125
303 3300006846 Ga0075430_100333219 Ga0075430_1003332192 125
304 3300006847 Ga0075431_100029403 Ga0075431_1000294036 125
305 3300006847 Ga0075431_100420970 Ga0075431_1004209702 125
306 3300006880 Ga0075429_100030653 Ga0075429_1000306535 125
307 3300009147 Ga0114129_10190020 Ga0114129_101900203 125
308 3300013297 Ga0157378_11108105 Ga0157378_111081052 125
309 3300013307 Ga0157372_11164595 Ga0157372_111645952 125
310 3300013308 Ga0157375_10589097 Ga0157375_105890972 125
311 3300014969 Ga0157376_10864039 Ga0157376_108640391 125
312 3300020069 Ga0197907_11431877 Ga0197907_114318771 125
313 3300020070 Ga0206356_11253760 Ga0206356_112537601 125
314 3300020076 Ga0206355_1652289 Ga0206355_16522892 125
315 3300020077 Ga0206351_10305649 Ga0206351_103056491 125
316 3300020081 Ga0206354_11181400 Ga0206354_111814001 125
317 3300022467 Ga0224712_10412815 Ga0224712_104128151 125
318 3300025908 Ga0207643_10624937 Ga0207643_106249371 125
319 3300025910 Ga0207684_10676014 Ga0207684_106760141 125
320 3300025934 Ga0207686_10462914 Ga0207686_104629142 125
321 3300025938 Ga0207704_10531356 Ga0207704_105313562 125
322 3300026089 Ga0207648_10403330 Ga0207648_104033302 125
323 3300026121 Ga0207683_10695241 Ga0207683_106952412 125
324 3300027866 Ga0209813_10385102 Ga0209813_103851021 125
325 3300046539 Ga0495621_0230464 Ga0495621_0230464_179_571 125
326 3300049571 Ga0501034_0000255 Ga0501034_0000255_32117_32509 125
327 3300049584 Ga0501068_0094519 Ga0501068_0094519_340_747 125
328 3300049586 Ga0501070_0023620 Ga0501070_0023620_3720_4112 125
329 3300049588 Ga0501072_0005578 Ga0501072_0005578_9149_9541 125
330 3300050490 nmdc:mga03n38_203150_c1 nmdc:mga03n38_203150_c1_312_704 125
331 3300050491 nmdc:mga00v17_3623_c1 nmdc:mga00v17_3623_c1_1023_1421 125
332 3300050491 nmdc:mga00v17_465788_c1 nmdc:mga00v17_465788_c1_84_476 125
333 3300050492 nmdc:mga0yw44_593712_c1 nmdc:mga0yw44_593712_c1_178_570 125
334 3300050495 nmdc:mga04h51_268212_c1 nmdc:mga04h51_268212_c1_225_623 125
335 3300050507 nmdc:mga05p37_262527_c1 nmdc:mga05p37_262527_c1_1264_1653 125
336 3300050508 nmdc:mga09592_11813_c1 nmdc:mga09592_11813_c1_1138_1527 125
337 3300050509 nmdc:mga0qj67_51255_c1 nmdc:mga0qj67_51255_c1_2447_2839 125
338 3300050509 nmdc:mga0qj67_66496_c1 nmdc:mga0qj67_66496_c1_2232_2621 125
339 3300050510 nmdc:mga06r32_2059394_c1 nmdc:mga06r32_2059394_c1_57_449 125
340 3300050510 nmdc:mga06r32_23807_c1 nmdc:mga06r32_23807_c1_3516_3905 125

Structural Annotation

Top 5 Hits

ID Description Score Start End
6yca-assembly1.cif.gz_A crystal structure of eis1 from mycobacterium abscessus 0.7285 29 99
6yca-assembly1.cif.gz_D crystal structure of eis1 from mycobacterium abscessus 0.7256 29 99
6yca-assembly1.cif.gz_F crystal structure of eis1 from mycobacterium abscessus 0.7244 29 99
6yca-assembly1.cif.gz_B crystal structure of eis1 from mycobacterium abscessus 0.7196 29 99
6yca-assembly1.cif.gz_E crystal structure of eis1 from mycobacterium abscessus 0.7157 29 99
ID Description Score Start End Superfamily
1iktA00 Alpha Beta;2-Layer Sandwich;Nonspecific Lipid-transfer Protein; Chain A;SCP2 sterol-binding domain 0.7055 11 106 3.30.1050.10
af_Q21481_314_431_3.30.1050.10 Alpha Beta;2-Layer Sandwich;Nonspecific Lipid-transfer Protein; Chain A;SCP2 sterol-binding domain 0.6972 9 108 3.30.1050.10
af_Q10KK9_14_236_2.120.10.80 Mainly Beta;6 Propeller;Neuraminidase;Kelch-type beta propeller 0.6819 32 54 2.120.10.80
3bksA00 Alpha Beta;2-Layer Sandwich;Nonspecific Lipid-transfer Protein; Chain A;SCP2 sterol-binding domain 0.6803 8 107 3.30.1050.10
af_Q54PA2_138_240_3.30.1050.10 Alpha Beta;2-Layer Sandwich;Nonspecific Lipid-transfer Protein; Chain A;SCP2 sterol-binding domain 0.678 9 114 3.30.1050.10
ID Description Score Start End GO Terms
AF-A0A538B5K7-F1-model_v4 SCP-2 sterol transfer family protein 0.8909 1 104
AF-A0A538B5K7-F1-model_v4 SCP-2 sterol transfer family protein 0.8751 1 104
AF-A0A7V9SNN2-F1-model_v4 SCP2 sterol-binding domain-containing protein 0.8738 1 125
AF-A0A6J4I0I1-F1-model_v4 SCP2 domain-containing protein 0.8691 1 125
AF-A0A399Y2L1-F1-model_v4 SCP-2 sterol transfer family protein 0.869 2 125

Feature Viewer

pLDDT pTM Quality
82.66 0.73 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map