F414312
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 340 | 182 | 340 | 129 |
Family's Representative Sequence
| Representative Sequence | 3300009147|Ga0114129_10190020|Ga0114129_101900203 |
| Length | 146 |
| Sequence | LESGERSPEGCDERRYTVAHSFLSEEWFEAVEGLREEAPEPSAALKDLTINIVVVGGPNGDAEVHMEGGQFERGLVDGAPTKLTVPYDVAKAIFIEGNQQAGMQAFMSGQIRVEGDMTKLMTMQASAGAATPEQQAFQTKLQELTE |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 2 | 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 3 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 5 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 6 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 8 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 10 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 22 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 23 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 24 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 25 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 26 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 27 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 29 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 30 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 31 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 32 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 33 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 34 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 35 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 36 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 37 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 38 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 39 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 40 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 41 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 42 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 43 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 44 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 45 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 46 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 47 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 48 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 50 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300012503 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_R | Metagenome | Rhizosphere |
| 52 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 53 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 54 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 55 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 56 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 61 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 62 | 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 63 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 64 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 65 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 66 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 67 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 68 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 69 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 70 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 89 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 90 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 91 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 92 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 93 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 94 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 95 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 96 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 97 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 98 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 99 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 100 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 101 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 102 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 103 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 104 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 105 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 106 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 107 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 108 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 109 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 110 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 111 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 112 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 113 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 114 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 115 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 116 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 117 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 118 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 119 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 120 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 121 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 122 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 131 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 132 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 133 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 134 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 135 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 136 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 137 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 138 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 139 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 140 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 141 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 142 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 143 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 144 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 145 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 146 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 147 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 148 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 149 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 150 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 151 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 152 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 153 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 154 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 155 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 156 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 157 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 158 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 159 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 160 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 161 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 162 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 163 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 164 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 165 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 166 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 167 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 168 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 169 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 170 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 171 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 172 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 173 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 176 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 177 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 178 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 179 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 180 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 181 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 182 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 94.12 |
| Metatranscriptomes | 5.88 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 7.65 |
| Nodule | 0 |
| Rhizoplane | 0.59 |
| Rhizosphere | 90.29 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.47 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0058863_11958211 | 3300004799 | Bacteria | 527 |
| 2 | Ga0058861_11611134 | 3300004800 | Bacteria | 824 |
| 3 | Ga0058861_11733771 | 3300004800 | Bacteria | 617 |
| 4 | Ga0070658_10006232 | 3300005327 | Bacteria | 9661 |
| 5 | Ga0070683_100811868 | 3300005329 | Bacteria | 897 |
| 6 | Ga0070683_101091172 | 3300005329 | Bacteria | 767 |
| 7 | Ga0070683_102387291 | 3300005329 | Bacteria | 507 |
| 8 | Ga0068869_100868363 | 3300005334 | Bacteria | 779 |
| 9 | Ga0070666_11271933 | 3300005335 | Bacteria | 549 |
| 10 | Ga0070680_100561452 | 3300005336 | Bacteria | 979 |
| 11 | Ga0070680_101482432 | 3300005336 | Bacteria | 588 |
| 12 | Ga0070660_101409295 | 3300005339 | Bacteria | 592 |
| 13 | Ga0070689_101189245 | 3300005340 | Bacteria | 684 |
| 14 | Ga0070661_100133395 | 3300005344 | Unclassified | 1867 |
| 15 | Ga0070661_101450176 | 3300005344 | Unclassified | 578 |
| 16 | Ga0070668_100498972 | 3300005347 | Bacteria | 1053 |
| 17 | Ga0070669_100277065 | 3300005353 | Unclassified | 1343 |
| 18 | Ga0070675_100109982 | 3300005354 | Bacteria | 2330 |
| 19 | Ga0070675_100325552 | 3300005354 | Bacteria | 1358 |
| 20 | Ga0070675_101494141 | 3300005354 | Unclassified | 623 |
| 21 | Ga0070674_101699886 | 3300005356 | Unclassified | 571 |
| 22 | Ga0070674_102054894 | 3300005356 | Unclassified | 521 |
| 23 | Ga0070673_100614988 | 3300005364 | Unclassified | 992 |
| 24 | Ga0070714_100483713 | 3300005435 | Bacteria | 1179 |
| 25 | Ga0070705_101279510 | 3300005440 | Bacteria | 607 |
| 26 | Ga0070708_100006253 | 3300005445 | Bacteria | 9469 |
| 27 | Ga0070708_100013158 | 3300005445 | Bacteria | 6770 |
| 28 | Ga0070708_101153767 | 3300005445 | Bacteria | 725 |
| 29 | Ga0070678_100469706 | 3300005456 | Bacteria | 1105 |
| 30 | Ga0070678_100934636 | 3300005456 | Unclassified | 794 |
| 31 | Ga0070662_100957972 | 3300005457 | Unclassified | 732 |
| 32 | Ga0070681_11045220 | 3300005458 | Bacteria | 737 |
| 33 | Ga0070706_100712408 | 3300005467 | Unclassified | 931 |
| 34 | Ga0070679_101022948 | 3300005530 | Bacteria | 770 |
| 35 | Ga0070684_101097446 | 3300005535 | Bacteria | 748 |
| 36 | Ga0068853_100358342 | 3300005539 | Bacteria | 1358 |
| 37 | Ga0070686_101292298 | 3300005544 | Bacteria | 609 |
| 38 | Ga0070704_100626123 | 3300005549 | Bacteria | 948 |
| 39 | Ga0068856_100104479 | 3300005614 | Bacteria | 2827 |
| 40 | Ga0068852_100656140 | 3300005616 | Unclassified | 1057 |
| 41 | Ga0068859_100188554 | 3300005617 | Bacteria | 2146 |
| 42 | Ga0068858_100807922 | 3300005842 | Bacteria | 915 |
| 43 | Ga0068860_100851546 | 3300005843 | Unclassified | 926 |
| 44 | Ga0081455_10203046 | 3300005937 | Bacteria | 1483 |
| 45 | Ga0081455_10248329 | 3300005937 | Bacteria | 1303 |
| 46 | Ga0081455_10632903 | 3300005937 | Unclassified | 692 |
| 47 | Ga0081538_10058825 | 3300005981 | Bacteria | 2225 |
| 48 | Ga0075365_10008049 | 3300006038 | Bacteria | 5952 |
| 49 | Ga0075365_10047862 | 3300006038 | Bacteria | 2812 |
| 50 | Ga0075365_10087302 | 3300006038 | Bacteria | 2121 |
| 51 | Ga0075365_10117688 | 3300006038 | Bacteria | 1831 |
| 52 | Ga0075365_10344053 | 3300006038 | Bacteria | 1051 |
| 53 | Ga0075363_100190078 | 3300006048 | Bacteria | 1171 |
| 54 | Ga0075364_10156650 | 3300006051 | Bacteria | 1536 |
| 55 | Ga0075364_10452674 | 3300006051 | Bacteria | 877 |
| 56 | Ga0075364_10973941 | 3300006051 | Bacteria | 577 |
| 57 | Ga0075432_10363759 | 3300006058 | Bacteria | 616 |
| 58 | Ga0097621_101763972 | 3300006237 | Unclassified | 590 |
| 59 | Ga0075370_10540869 | 3300006353 | Unclassified | 704 |
| 60 | Ga0075428_100000002 | 3300006844 | Bacteria | 546374 |
| 61 | Ga0075428_100003331 | 3300006844 | Bacteria | 17575 |
| 62 | Ga0075428_100051092 | 3300006844 | Bacteria | 4533 |
| 63 | Ga0075428_100052890 | 3300006844 | Bacteria | 4450 |
| 64 | Ga0075428_100121764 | 3300006844 | Bacteria | 2840 |
| 65 | Ga0075428_100203687 | 3300006844 | Bacteria | 2139 |
| 66 | Ga0075428_100432763 | 3300006844 | Bacteria | 1410 |
| 67 | Ga0075428_100459108 | 3300006844 | Bacteria | 1364 |
| 68 | Ga0075428_100575074 | 3300006844 | Bacteria | 1204 |
| 69 | Ga0075428_102644901 | 3300006844 | Unclassified | 512 |
| 70 | Ga0075430_100009474 | 3300006846 | Bacteria | 8230 |
| 71 | Ga0075430_100025183 | 3300006846 | Bacteria | 5060 |
| 72 | Ga0075430_100034626 | 3300006846 | Bacteria | 4287 |
| 73 | Ga0075430_100163533 | 3300006846 | Bacteria | 1852 |
| 74 | Ga0075430_100194022 | 3300006846 | Bacteria | 1687 |
| 75 | Ga0075430_100219482 | 3300006846 | Bacteria | 1578 |
| 76 | Ga0075430_100333219 | 3300006846 | Bacteria | 1254 |
| 77 | Ga0075431_100001047 | 3300006847 | Bacteria | 24688 |
| 78 | Ga0075431_100029403 | 3300006847 | Bacteria | 5657 |
| 79 | Ga0075431_100048193 | 3300006847 | Bacteria | 4394 |
| 80 | Ga0075431_100094275 | 3300006847 | Bacteria | 3089 |
| 81 | Ga0075431_100113289 | 3300006847 | Bacteria | 2799 |
| 82 | Ga0075431_100141192 | 3300006847 | Bacteria | 2482 |
| 83 | Ga0075431_100146734 | 3300006847 | Bacteria | 2431 |
| 84 | Ga0075431_100216868 | 3300006847 | Bacteria | 1953 |
| 85 | Ga0075431_100420970 | 3300006847 | Bacteria | 1335 |
| 86 | Ga0075433_10945800 | 3300006852 | Bacteria | 751 |
| 87 | Ga0075429_100000556 | 3300006880 | Bacteria | 28570 |
| 88 | Ga0075429_100000896 | 3300006880 | Bacteria | 23544 |
| 89 | Ga0075429_100030653 | 3300006880 | Bacteria | 4672 |
| 90 | Ga0075429_100266311 | 3300006880 | Bacteria | 1501 |
| 91 | Ga0097620_100188550 | 3300006931 | Bacteria | 2146 |
| 92 | Ga0111539_10015662 | 3300009094 | Bacteria | 9425 |
| 93 | Ga0111539_10380421 | 3300009094 | Bacteria | 1644 |
| 94 | Ga0111539_10571837 | 3300009094 | Bacteria | 1316 |
| 95 | Ga0111539_11438781 | 3300009094 | Bacteria | 799 |
| 96 | Ga0105245_10162944 | 3300009098 | Bacteria | 2117 |
| 97 | Ga0105245_10688010 | 3300009098 | Bacteria | 1055 |
| 98 | Ga0114129_10001819 | 3300009147 | Bacteria | 29052 |
| 99 | Ga0114129_10018758 | 3300009147 | Bacteria | 9854 |
| 100 | Ga0114129_10055596 | 3300009147 | Bacteria | 5546 |
| 101 | Ga0114129_10069123 | 3300009147 | Bacteria | 4923 |
| 102 | Ga0114129_10190020 | 3300009147 | Bacteria | 2789 |
| 103 | Ga0114129_10446862 | 3300009147 | Bacteria | 1696 |
| 104 | Ga0105243_12085789 | 3300009148 | Bacteria | 602 |
| 105 | Ga0157313_1058551 | 3300012503 | Bacteria | 521 |
| 106 | Ga0157371_11425034 | 3300013102 | Unclassified | 539 |
| 107 | Ga0157369_10017015 | 3300013105 | Bacteria | 8171 |
| 108 | Ga0157369_10228094 | 3300013105 | Bacteria | 1948 |
| 109 | Ga0157374_10365063 | 3300013296 | Bacteria | 1436 |
| 110 | Ga0157378_10529189 | 3300013297 | Bacteria | 1181 |
| 111 | Ga0157378_11000270 | 3300013297 | Bacteria | 870 |
| 112 | Ga0157378_11108105 | 3300013297 | Bacteria | 829 |
| 113 | Ga0157372_11164595 | 3300013307 | Unclassified | 891 |
| 114 | Ga0157372_12075793 | 3300013307 | Bacteria | 653 |
| 115 | Ga0157375_10589097 | 3300013308 | Bacteria | 1272 |
| 116 | Ga0157375_11137739 | 3300013308 | Unclassified | 914 |
| 117 | Ga0157375_12594725 | 3300013308 | Bacteria | 605 |
| 118 | Ga0157380_11338061 | 3300014326 | Bacteria | 765 |
| 119 | Ga0157380_11508807 | 3300014326 | Bacteria | 725 |
| 120 | Ga0157376_10864039 | 3300014969 | Unclassified | 921 |
| 121 | Ga0197907_10934416 | 3300020069 | Unclassified | 1455 |
| 122 | Ga0197907_11431877 | 3300020069 | Bacteria | 571 |
| 123 | Ga0206356_10090670 | 3300020070 | Bacteria | 795 |
| 124 | Ga0206356_11253760 | 3300020070 | Bacteria | 682 |
| 125 | Ga0206356_11362758 | 3300020070 | Bacteria | 917 |
| 126 | Ga0206349_1844536 | 3300020075 | Unclassified | 1190 |
| 127 | Ga0206355_1652289 | 3300020076 | Bacteria | 602 |
| 128 | Ga0206351_10305649 | 3300020077 | Unclassified | 501 |
| 129 | Ga0206351_10827054 | 3300020077 | Bacteria | 623 |
| 130 | Ga0206352_10515275 | 3300020078 | Bacteria | 888 |
| 131 | Ga0206354_10795115 | 3300020081 | Unclassified | 1497 |
| 132 | Ga0206354_11179138 | 3300020081 | Unclassified | 727 |
| 133 | Ga0206354_11181400 | 3300020081 | Bacteria | 537 |
| 134 | Ga0206353_10414443 | 3300020082 | Unclassified | 2176 |
| 135 | Ga0213876_10019736 | 3300021384 | Bacteria | 3560 |
| 136 | Ga0224712_10033106 | 3300022467 | Unclassified | 1889 |
| 137 | Ga0224712_10036714 | 3300022467 | Bacteria | 1818 |
| 138 | Ga0224712_10412815 | 3300022467 | Bacteria | 645 |
| 139 | Ga0207643_10624937 | 3300025908 | Bacteria | 694 |
| 140 | Ga0207705_10005268 | 3300025909 | Bacteria | 9687 |
| 141 | Ga0207684_10676014 | 3300025910 | Bacteria | 879 |
| 142 | Ga0207707_10770524 | 3300025912 | Bacteria | 803 |
| 143 | Ga0207660_10316011 | 3300025917 | Bacteria | 1246 |
| 144 | Ga0207659_11023041 | 3300025926 | Unclassified | 711 |
| 145 | Ga0207659_11363374 | 3300025926 | Bacteria | 608 |
| 146 | Ga0207690_10776752 | 3300025932 | Bacteria | 791 |
| 147 | Ga0207686_10462914 | 3300025934 | Bacteria | 977 |
| 148 | Ga0207686_11731126 | 3300025934 | Bacteria | 517 |
| 149 | Ga0207670_10652529 | 3300025936 | Unclassified | 868 |
| 150 | Ga0207669_10817599 | 3300025937 | Unclassified | 774 |
| 151 | Ga0207704_10531356 | 3300025938 | Bacteria | 953 |
| 152 | Ga0207661_10671353 | 3300025944 | Bacteria | 953 |
| 153 | Ga0207661_11636278 | 3300025944 | Bacteria | 589 |
| 154 | Ga0207651_10451602 | 3300025960 | Bacteria | 1103 |
| 155 | Ga0207651_11287348 | 3300025960 | Unclassified | 657 |
| 156 | Ga0207640_10406152 | 3300025981 | Bacteria | 1110 |
| 157 | Ga0207703_10669903 | 3300026035 | Bacteria | 985 |
| 158 | Ga0207639_10067450 | 3300026041 | Bacteria | 2784 |
| 159 | Ga0207648_10403330 | 3300026089 | Bacteria | 1239 |
| 160 | Ga0207683_10258930 | 3300026121 | Bacteria | 1589 |
| 161 | Ga0207683_10695241 | 3300026121 | Unclassified | 943 |
| 162 | Ga0209813_10385102 | 3300027866 | Bacteria | 562 |
| 163 | Ga0207428_10020246 | 3300027907 | Bacteria | 5655 |
| 164 | Ga0307413_10054599 | 3300031824 | Bacteria | 2425 |
| 165 | Ga0307410_10006490 | 3300031852 | Bacteria | 6317 |
| 166 | Ga0307407_10037590 | 3300031903 | Bacteria | 2676 |
| 167 | Ga0307412_10170047 | 3300031911 | Bacteria | 1629 |
| 168 | Ga0307409_100010656 | 3300031995 | Bacteria | 5735 |
| 169 | Ga0307409_100393810 | 3300031995 | Bacteria | 1321 |
| 170 | Ga0307416_100224090 | 3300032002 | Bacteria | 1806 |
| 171 | Ga0307411_10062685 | 3300032005 | Bacteria | 2481 |
| 172 | Ga0307415_100073609 | 3300032126 | Bacteria | 2411 |
| 173 | Ga0373946_0128514 | 3300035171 | Bacteria | 1164 |
| 174 | Ga0316574_0609165 | 3300035398 | Bacteria | 674 |
| 175 | Ga0373935_1119487 | 3300035692 | Bacteria | 586 |
| 176 | Ga0436365_0013510 | 3300039437 | Bacteria | 17846 |
| 177 | Ga0436362_0817418 | 3300039453 | Bacteria | 1950 |
| 178 | Ga0439465_0203724 | 3300041413 | Unclassified | 722 |
| 179 | Ga0451837_0014192 | 3300041494 | Bacteria | 5174 |
| 180 | Ga0451853_2104363 | 3300041512 | Bacteria | 750 |
| 181 | Ga0451853_4098489 | 3300041512 | Unclassified | 553 |
| 182 | Ga0450923_141640 | 3300042125 | Bacteria | 578 |
| 183 | Ga0439435_0303379 | 3300042436 | Bacteria | 547 |
| 184 | Ga0466966_0014422 | 3300044684 | Bacteria | 5233 |
| 185 | Ga0466963_0018602 | 3300044694 | Bacteria | 4347 |
| 186 | Ga0466958_0080497 | 3300045836 | Bacteria | 2004 |
| 187 | Ga0466967_0319326 | 3300045976 | Bacteria | 1497 |
| 188 | Ga0466967_0396151 | 3300045976 | Bacteria | 1343 |
| 189 | Ga0495629_0237675 | 3300046459 | Bacteria | 1255 |
| 190 | Ga0495639_0064761 | 3300046475 | Bacteria | 1681 |
| 191 | Ga0495628_0245478 | 3300046516 | Bacteria | 1338 |
| 192 | Ga0495644_0373173 | 3300046523 | Unclassified | 563 |
| 193 | Ga0495586_0048271 | 3300046535 | Unclassified | 2300 |
| 194 | Ga0495586_0414657 | 3300046535 | Unclassified | 775 |
| 195 | Ga0495621_0230464 | 3300046539 | Bacteria | 752 |
| 196 | Ga0495645_0348429 | 3300046543 | Bacteria | 955 |
| 197 | Ga0495634_0009347 | 3300046642 | Bacteria | 7233 |
| 198 | Ga0495588_0258536 | 3300046674 | Bacteria | 918 |
| 199 | Ga0495647_0061969 | 3300046681 | Bacteria | 1478 |
| 200 | Ga0495658_0247937 | 3300046683 | Unclassified | 1119 |
| 201 | Ga0495658_0347892 | 3300046683 | Unclassified | 942 |
| 202 | Ga0495613_0039109 | 3300046689 | Bacteria | 3516 |
| 203 | Ga0495613_0225034 | 3300046689 | Bacteria | 1316 |
| 204 | Ga0495624_0195860 | 3300046690 | Bacteria | 1228 |
| 205 | Ga0495589_0382657 | 3300046794 | Bacteria | 647 |
| 206 | Ga0495674_1330158 | 3300047319 | Unclassified | 538 |
| 207 | Ga0495676_0302053 | 3300047321 | Bacteria | 1079 |
| 208 | Ga0495680_0079012 | 3300047322 | Unclassified | 2489 |
| 209 | Ga0495593_0326493 | 3300047673 | Bacteria | 767 |
| 210 | Ga0496106_1137214 | 3300048909 | Bacteria | 611 |
| 211 | Ga0496109_0490422 | 3300048912 | Bacteria | 1160 |
| 212 | Ga0501032_0399049 | 3300049569 | Bacteria | 883 |
| 213 | Ga0501033_0008893 | 3300049570 | Bacteria | 7757 |
| 214 | Ga0501033_0026515 | 3300049570 | Bacteria | 4361 |
| 215 | Ga0501034_0000255 | 3300049571 | Bacteria | 97887 |
| 216 | Ga0501034_0001375 | 3300049571 | Bacteria | 32685 |
| 217 | Ga0501034_0001825 | 3300049571 | Bacteria | 27031 |
| 218 | Ga0501036_0014678 | 3300049572 | Bacteria | 6529 |
| 219 | Ga0501036_1208985 | 3300049572 | Bacteria | 616 |
| 220 | Ga0501037_0116331 | 3300049573 | Bacteria | 1924 |
| 221 | Ga0501038_0654194 | 3300049574 | Unclassified | 791 |
| 222 | Ga0501038_0776527 | 3300049574 | Unclassified | 713 |
| 223 | Ga0501039_0030027 | 3300049575 | Bacteria | 4188 |
| 224 | Ga0501040_0012445 | 3300049576 | Bacteria | 5575 |
| 225 | Ga0501041_0041136 | 3300049577 | Bacteria | 2806 |
| 226 | Ga0501043_1024080 | 3300049579 | Bacteria | 587 |
| 227 | Ga0501046_0162319 | 3300049580 | Bacteria | 1680 |
| 228 | Ga0501046_0790558 | 3300049580 | Bacteria | 665 |
| 229 | Ga0501047_0068125 | 3300049581 | Bacteria | 3429 |
| 230 | Ga0501048_0106354 | 3300049582 | Bacteria | 1980 |
| 231 | Ga0501068_0006888 | 3300049584 | Bacteria | 6284 |
| 232 | Ga0501068_0007529 | 3300049584 | Bacteria | 6025 |
| 233 | Ga0501068_0094519 | 3300049584 | Bacteria | 1848 |
| 234 | Ga0501068_0415358 | 3300049584 | Bacteria | 868 |
| 235 | Ga0501068_0543290 | 3300049584 | Bacteria | 755 |
| 236 | Ga0501069_0000041 | 3300049585 | Bacteria | 79028 |
| 237 | Ga0501069_0005758 | 3300049585 | Bacteria | 6457 |
| 238 | Ga0501069_0025361 | 3300049585 | Bacteria | 3240 |
| 239 | Ga0501070_0000013 | 3300049586 | Bacteria | 180554 |
| 240 | Ga0501070_0006607 | 3300049586 | Bacteria | 9868 |
| 241 | Ga0501070_0023620 | 3300049586 | Bacteria | 5151 |
| 242 | Ga0501070_0026321 | 3300049586 | Bacteria | 4882 |
| 243 | Ga0501071_0005449 | 3300049587 | Bacteria | 8181 |
| 244 | Ga0501071_0011076 | 3300049587 | Bacteria | 6061 |
| 245 | Ga0501071_0011156 | 3300049587 | Bacteria | 6042 |
| 246 | Ga0501071_0042618 | 3300049587 | Bacteria | 3253 |
| 247 | Ga0501071_0382150 | 3300049587 | Bacteria | 1074 |
| 248 | Ga0501071_0506450 | 3300049587 | Bacteria | 926 |
| 249 | Ga0501071_1035554 | 3300049587 | Bacteria | 634 |
| 250 | Ga0501071_1259792 | 3300049587 | Bacteria | 571 |
| 251 | Ga0501071_1464188 | 3300049587 | Bacteria | 527 |
| 252 | Ga0501071_1559327 | 3300049587 | Bacteria | 510 |
| 253 | Ga0501072_0003020 | 3300049588 | Bacteria | 12693 |
| 254 | Ga0501072_0005578 | 3300049588 | Bacteria | 9573 |
| 255 | Ga0501072_0013346 | 3300049588 | Bacteria | 6289 |
| 256 | Ga0501072_0017545 | 3300049588 | Bacteria | 5501 |
| 257 | Ga0501072_0063846 | 3300049588 | Bacteria | 2905 |
| 258 | Ga0501073_0008360 | 3300049589 | Bacteria | 7675 |
| 259 | Ga0501073_0012898 | 3300049589 | Bacteria | 6093 |
| 260 | Ga0501073_0023141 | 3300049589 | Bacteria | 4466 |
| 261 | Ga0501073_0544846 | 3300049589 | Bacteria | 802 |
| 262 | Ga0501073_0784470 | 3300049589 | Bacteria | 657 |
| 263 | Ga0501074_0003351 | 3300049590 | Bacteria | 11349 |
| 264 | Ga0501074_0017212 | 3300049590 | Bacteria | 5245 |
| 265 | Ga0501074_0056993 | 3300049590 | Bacteria | 2815 |
| 266 | Ga0501075_0005888 | 3300049591 | Bacteria | 8384 |
| 267 | Ga0501076_0013506 | 3300049592 | Bacteria | 6123 |
| 268 | Ga0501077_0045396 | 3300049593 | Bacteria | 2791 |
| 269 | Ga0501079_0028416 | 3300049741 | Bacteria | 4291 |
| 270 | Ga0501079_0033795 | 3300049741 | Bacteria | 3935 |
| 271 | Ga0501080_0016998 | 3300049742 | Bacteria | 6718 |
| 272 | Ga0501080_0024522 | 3300049742 | Bacteria | 5591 |
| 273 | Ga0501080_0027005 | 3300049742 | Bacteria | 5338 |
| 274 | Ga0501080_0293019 | 3300049742 | Bacteria | 1477 |
| 275 | Ga0501080_1525367 | 3300049742 | Bacteria | 567 |
| 276 | Ga0501081_0112772 | 3300049743 | Bacteria | 1930 |
| 277 | Ga0501083_0014495 | 3300049744 | Bacteria | 5511 |
| 278 | Ga0501083_0026609 | 3300049744 | Bacteria | 3996 |
| 279 | Ga0501083_0080837 | 3300049744 | Bacteria | 2155 |
| 280 | Ga0501083_0449893 | 3300049744 | Bacteria | 838 |
| 281 | Ga0501035_0050252 | 3300049822 | Bacteria | 3737 |
| 282 | Ga0501044_0042513 | 3300049823 | Bacteria | 4726 |
| 283 | Ga0501045_0030891 | 3300049824 | Bacteria | 3878 |
| 284 | nmdc:mga03n38_203150_c1 | 3300050490 | Bacteria | 1026 |
| 285 | nmdc:mga00v17_3623_c1 | 3300050491 | Bacteria | 7982 |
| 286 | nmdc:mga00v17_465788_c1 | 3300050491 | Bacteria | 820 |
| 287 | nmdc:mga0yw44_135024_c1 | 3300050492 | Bacteria | 1600 |
| 288 | nmdc:mga0yw44_167559_c1 | 3300050492 | Bacteria | 1441 |
| 289 | nmdc:mga0yw44_250650_c1 | 3300050492 | Bacteria | 1178 |
| 290 | nmdc:mga0yw44_593712_c1 | 3300050492 | Bacteria | 752 |
| 291 | nmdc:mga0yw44_62676_c1 | 3300050492 | Bacteria | 2284 |
| 292 | nmdc:mga0yw44_708986_c1 | 3300050492 | Bacteria | 683 |
| 293 | nmdc:mga0yw44_82504_c1 | 3300050492 | Bacteria | 2017 |
| 294 | nmdc:mga04h51_268212_c1 | 3300050495 | Bacteria | 688 |
| 295 | nmdc:mga07m45_412339_c1 | 3300050496 | Unclassified | 784 |
| 296 | nmdc:mga05p37_130377_c1 | 3300050507 | Bacteria | 3085 |
| 297 | nmdc:mga05p37_1372985_c1 | 3300050507 | Unclassified | 714 |
| 298 | nmdc:mga05p37_15909_c1 | 3300050507 | Bacteria | 9050 |
| 299 | nmdc:mga05p37_262527_c1 | 3300050507 | Bacteria | 2066 |
| 300 | nmdc:mga05p37_30095_c1 | 3300050507 | Bacteria | 6625 |
| 301 | nmdc:mga05p37_85253_c1 | 3300050507 | Bacteria | 3892 |
| 302 | nmdc:mga09592_114797_c1 | 3300050508 | Bacteria | 2311 |
| 303 | nmdc:mga09592_11813_c1 | 3300050508 | Bacteria | 5074 |
| 304 | nmdc:mga09592_289569_c1 | 3300050508 | Bacteria | 1420 |
| 305 | nmdc:mga09592_307_c1 | 3300050508 | Bacteria | 35790 |
| 306 | nmdc:mga09592_427947_c1 | 3300050508 | Bacteria | 1143 |
| 307 | nmdc:mga0qj67_129904_c1 | 3300050509 | Bacteria | 2040 |
| 308 | nmdc:mga0qj67_51255_c1 | 3300050509 | Bacteria | 3263 |
| 309 | nmdc:mga0qj67_51371_c1 | 3300050509 | Bacteria | 3260 |
| 310 | nmdc:mga0qj67_66496_c1 | 3300050509 | Bacteria | 2871 |
| 311 | nmdc:mga0qj67_691730_c1 | 3300050509 | Bacteria | 812 |
| 312 | nmdc:mga0qj67_76360_c1 | 3300050509 | Bacteria | 2679 |
| 313 | nmdc:mga0qj67_827782_c1 | 3300050509 | Bacteria | 732 |
| 314 | nmdc:mga06r32_104875_c1 | 3300050510 | Bacteria | 2777 |
| 315 | nmdc:mga06r32_128289_c1 | 3300050510 | Bacteria | 2506 |
| 316 | nmdc:mga06r32_153_c1 | 3300050510 | Bacteria | 52808 |
| 317 | nmdc:mga06r32_1822270_c1 | 3300050510 | Unclassified | 544 |
| 318 | nmdc:mga06r32_19152_c1 | 3300050510 | Bacteria | 6281 |
| 319 | nmdc:mga06r32_2059394_c1 | 3300050510 | Bacteria | 504 |
| 320 | nmdc:mga06r32_23807_c1 | 3300050510 | Bacteria | 5673 |
| 321 | nmdc:mga06r32_46741_c1 | 3300050510 | Bacteria | 4131 |
| 322 | nmdc:mga08y16_1041558_c1 | 3300050511 | Bacteria | 796 |
| 323 | nmdc:mga08y16_121448_c1 | 3300050511 | Bacteria | 2719 |
| 324 | nmdc:mga08y16_279316_c1 | 3300050511 | Bacteria | 1723 |
| 325 | nmdc:mga08y16_345284_c1 | 3300050511 | Bacteria | 1530 |
| 326 | nmdc:mga08y16_444794_c1 | 3300050511 | Unclassified | 1322 |
| 327 | nmdc:mga08y16_62065_c1 | 3300050511 | Bacteria | 3903 |
| 328 | nmdc:mga0a205_1572468_c1 | 3300050515 | Bacteria | 506 |
| 329 | Ga0495601_0014400 | 3300053077 | Bacteria | 4766 |
| 330 | Ga0495612_0180066 | 3300053078 | Unclassified | 928 |
| 331 | Ga0500566_0130348 | 3300053094 | Unclassified | 1346 |
| 332 | Ga0500593_061852 | 3300053117 | Bacteria | 1644 |
| 333 | Ga0500616_0034832 | 3300053153 | Bacteria | 2741 |
| 334 | Ga0501084_0003856 | 3300054114 | Bacteria | 12208 |
| 335 | Ga0501084_0317241 | 3300054114 | Bacteria | 1316 |
| 336 | Ga0590071_083263 | 3300059421 | Bacteria | 796 |
| 337 | Ga0590077_033254 | 3300059426 | Bacteria | 1131 |
| 338 | Ga0590077_109437 | 3300059426 | Bacteria | 649 |
| 339 | Ga0501082_0056705 | 3300060353 | Bacteria | 3375 |
| 340 | Ga0530510_0004141 | 3300061734 | Bacteria | 10015 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300025944 | Ga0207661_11636278 | Ga0207661_116362781 | 88 |
| 2 | 3300047319 | Ga0495674_1330158 | Ga0495674_1330158_38_367 | 100 |
| 3 | 3300009098 | Ga0105245_10162944 | Ga0105245_101629442 | 113 |
| 4 | 3300009148 | Ga0105243_12085789 | Ga0105243_120857891 | 113 |
| 5 | 3300013308 | Ga0157375_12594725 | Ga0157375_125947251 | 113 |
| 6 | 3300039437 | Ga0436365_0013510 | Ga0436365_0013510_5244_5627 | 113 |
| 7 | 3300041494 | Ga0451837_0014192 | Ga0451837_0014192_1340_1720 | 113 |
| 8 | 3300049571 | Ga0501034_0001825 | Ga0501034_0001825_3983_4384 | 113 |
| 9 | 3300049587 | Ga0501071_0042618 | Ga0501071_0042618_373_756 | 113 |
| 10 | 3300049587 | Ga0501071_1464188 | Ga0501071_1464188_101_502 | 113 |
| 11 | 3300049588 | Ga0501072_0003020 | Ga0501072_0003020_7307_7708 | 113 |
| 12 | 3300049588 | Ga0501072_0013346 | Ga0501072_0013346_3088_3471 | 113 |
| 13 | 3300049589 | Ga0501073_0023141 | Ga0501073_0023141_3901_4302 | 113 |
| 14 | 3300049589 | Ga0501073_0544846 | Ga0501073_0544846_290_682 | 113 |
| 15 | 3300049589 | Ga0501073_0784470 | Ga0501073_0784470_260_643 | 113 |
| 16 | 3300049590 | Ga0501074_0056993 | Ga0501074_0056993_473_874 | 113 |
| 17 | 3300049742 | Ga0501080_0293019 | Ga0501080_0293019_923_1306 | 113 |
| 18 | 3300005329 | Ga0070683_101091172 | Ga0070683_1010911721 | 114 |
| 19 | 3300005535 | Ga0070684_101097446 | Ga0070684_1010974462 | 114 |
| 20 | 3300009098 | Ga0105245_10688010 | Ga0105245_106880102 | 114 |
| 21 | 3300013297 | Ga0157378_11000270 | Ga0157378_110002702 | 114 |
| 22 | 3300025944 | Ga0207661_10671353 | Ga0207661_106713532 | 114 |
| 23 | 3300035171 | Ga0373946_0128514 | Ga0373946_0128514_97_489 | 114 |
| 24 | 3300035692 | Ga0373935_1119487 | Ga0373935_1119487_144_536 | 114 |
| 25 | 3300050492 | nmdc:mga0yw44_708986_c1 | nmdc:mga0yw44_708986_c1_82_474 | 114 |
| 26 | 3300005937 | Ga0081455_10203046 | Ga0081455_102030462 | 115 |
| 27 | 3300006844 | Ga0075428_100459108 | Ga0075428_1004591082 | 115 |
| 28 | 3300006846 | Ga0075430_100194022 | Ga0075430_1001940221 | 115 |
| 29 | 3300006847 | Ga0075431_100094275 | Ga0075431_1000942754 | 115 |
| 30 | 3300006880 | Ga0075429_100266311 | Ga0075429_1002663112 | 115 |
| 31 | 3300009147 | Ga0114129_10446862 | Ga0114129_104468622 | 115 |
| 32 | 3300012503 | Ga0157313_1058551 | Ga0157313_10585511 | 115 |
| 33 | 3300014326 | Ga0157380_11508807 | Ga0157380_115088072 | 115 |
| 34 | 3300046523 | Ga0495644_0373173 | Ga0495644_0373173_129_527 | 115 |
| 35 | 3300050507 | nmdc:mga05p37_1372985_c1 | nmdc:mga05p37_1372985_c1_28_408 | 115 |
| 36 | 3300050508 | nmdc:mga09592_289569_c1 | nmdc:mga09592_289569_c1_84_464 | 115 |
| 37 | 3300050509 | nmdc:mga0qj67_827782_c1 | nmdc:mga0qj67_827782_c1_77_457 | 115 |
| 38 | 3300005356 | Ga0070674_102054894 | Ga0070674_1020548941 | 116 |
| 39 | 3300049570 | Ga0501033_0008893 | Ga0501033_0008893_4296_4706 | 116 |
| 40 | 3300049580 | Ga0501046_0790558 | Ga0501046_0790558_65_475 | 116 |
| 41 | 3300049581 | Ga0501047_0068125 | Ga0501047_0068125_1139_1549 | 116 |
| 42 | 3300049585 | Ga0501069_0025361 | Ga0501069_0025361_2236_2646 | 116 |
| 43 | 3300049823 | Ga0501044_0042513 | Ga0501044_0042513_3648_4058 | 116 |
| 44 | 3300006038 | Ga0075365_10047862 | Ga0075365_100478622 | 117 |
| 45 | 3300031911 | Ga0307412_10170047 | Ga0307412_101700472 | 117 |
| 46 | 3300050492 | nmdc:mga0yw44_82504_c1 | nmdc:mga0yw44_82504_c1_69_461 | 117 |
| 47 | 3300006038 | Ga0075365_10087302 | Ga0075365_100873022 | 118 |
| 48 | 3300006038 | Ga0075365_10117688 | Ga0075365_101176882 | 118 |
| 49 | 3300006353 | Ga0075370_10540869 | Ga0075370_105408691 | 118 |
| 50 | 3300031995 | Ga0307409_100393810 | Ga0307409_1003938102 | 118 |
| 51 | 3300050492 | nmdc:mga0yw44_135024_c1 | nmdc:mga0yw44_135024_c1_181_558 | 118 |
| 52 | 3300050492 | nmdc:mga0yw44_250650_c1 | nmdc:mga0yw44_250650_c1_322_699 | 118 |
| 53 | 3300050492 | nmdc:mga0yw44_62676_c1 | nmdc:mga0yw44_62676_c1_415_795 | 118 |
| 54 | 3300050496 | nmdc:mga07m45_412339_c1 | nmdc:mga07m45_412339_c1_313_690 | 118 |
| 55 | 3300006038 | Ga0075365_10344053 | Ga0075365_103440532 | 119 |
| 56 | 3300006844 | Ga0075428_100203687 | Ga0075428_1002036872 | 119 |
| 57 | 3300006846 | Ga0075430_100034626 | Ga0075430_1000346264 | 119 |
| 58 | 3300006847 | Ga0075431_100113289 | Ga0075431_1001132891 | 119 |
| 59 | 3300006852 | Ga0075433_10945800 | Ga0075433_109458001 | 119 |
| 60 | 3300009147 | Ga0114129_10018758 | Ga0114129_100187585 | 119 |
| 61 | 3300050509 | nmdc:mga0qj67_76360_c1 | nmdc:mga0qj67_76360_c1_1230_1610 | 119 |
| 62 | 3300050511 | nmdc:mga08y16_345284_c1 | nmdc:mga08y16_345284_c1_13_393 | 119 |
| 63 | 3300050515 | nmdc:mga0a205_1572468_c1 | nmdc:mga0a205_1572468_c1_99_479 | 119 |
| 64 | 3300005329 | Ga0070683_102387291 | Ga0070683_1023872911 | 120 |
| 65 | 3300005336 | Ga0070680_100561452 | Ga0070680_1005614522 | 120 |
| 66 | 3300005530 | Ga0070679_101022948 | Ga0070679_1010229481 | 120 |
| 67 | 3300005539 | Ga0068853_100358342 | Ga0068853_1003583422 | 120 |
| 68 | 3300005614 | Ga0068856_100104479 | Ga0068856_1001044794 | 120 |
| 69 | 3300005616 | Ga0068852_100656140 | Ga0068852_1006561401 | 120 |
| 70 | 3300013105 | Ga0157369_10228094 | Ga0157369_102280942 | 120 |
| 71 | 3300020070 | Ga0206356_11362758 | Ga0206356_113627581 | 120 |
| 72 | 3300025912 | Ga0207707_10770524 | Ga0207707_107705242 | 120 |
| 73 | 3300025981 | Ga0207640_10406152 | Ga0207640_104061521 | 120 |
| 74 | 3300026041 | Ga0207639_10067450 | Ga0207639_100674502 | 120 |
| 75 | 3300041512 | Ga0451853_2104363 | Ga0451853_2104363_282_659 | 121 |
| 76 | 3300004800 | Ga0058861_11611134 | Ga0058861_116111341 | 122 |
| 77 | 3300005327 | Ga0070658_10006232 | Ga0070658_100062325 | 122 |
| 78 | 3300005339 | Ga0070660_101409295 | Ga0070660_1014092951 | 122 |
| 79 | 3300005344 | Ga0070661_101450176 | Ga0070661_1014501761 | 122 |
| 80 | 3300005435 | Ga0070714_100483713 | Ga0070714_1004837132 | 122 |
| 81 | 3300005458 | Ga0070681_11045220 | Ga0070681_110452201 | 122 |
| 82 | 3300006844 | Ga0075428_100000002 | Ga0075428_100000002305 | 122 |
| 83 | 3300013105 | Ga0157369_10017015 | Ga0157369_100170154 | 122 |
| 84 | 3300020069 | Ga0197907_10934416 | Ga0197907_109344162 | 122 |
| 85 | 3300020070 | Ga0206356_10090670 | Ga0206356_100906701 | 122 |
| 86 | 3300020075 | Ga0206349_1844536 | Ga0206349_18445362 | 122 |
| 87 | 3300020077 | Ga0206351_10827054 | Ga0206351_108270541 | 122 |
| 88 | 3300020078 | Ga0206352_10515275 | Ga0206352_105152753 | 122 |
| 89 | 3300020081 | Ga0206354_10795115 | Ga0206354_107951152 | 122 |
| 90 | 3300020082 | Ga0206353_10414443 | Ga0206353_104144433 | 122 |
| 91 | 3300021384 | Ga0213876_10019736 | Ga0213876_100197362 | 122 |
| 92 | 3300022467 | Ga0224712_10033106 | Ga0224712_100331062 | 122 |
| 93 | 3300025909 | Ga0207705_10005268 | Ga0207705_100052685 | 122 |
| 94 | 3300025917 | Ga0207660_10316011 | Ga0207660_103160112 | 122 |
| 95 | 3300039453 | Ga0436362_0817418 | Ga0436362_0817418_1385_1765 | 122 |
| 96 | 3300049587 | Ga0501071_1559327 | Ga0501071_1559327_96_482 | 122 |
| 97 | 3300005329 | Ga0070683_100811868 | Ga0070683_1008118681 | 123 |
| 98 | 3300005335 | Ga0070666_11271933 | Ga0070666_112719331 | 123 |
| 99 | 3300005336 | Ga0070680_101482432 | Ga0070680_1014824321 | 123 |
| 100 | 3300005445 | Ga0070708_101153767 | Ga0070708_1011537671 | 123 |
| 101 | 3300005549 | Ga0070704_100626123 | Ga0070704_1006261231 | 123 |
| 102 | 3300006038 | Ga0075365_10008049 | Ga0075365_100080495 | 123 |
| 103 | 3300006051 | Ga0075364_10973941 | Ga0075364_109739411 | 123 |
| 104 | 3300006237 | Ga0097621_101763972 | Ga0097621_1017639721 | 123 |
| 105 | 3300009094 | Ga0111539_10380421 | Ga0111539_103804212 | 123 |
| 106 | 3300013307 | Ga0157372_12075793 | Ga0157372_120757931 | 123 |
| 107 | 3300022467 | Ga0224712_10036714 | Ga0224712_100367142 | 123 |
| 108 | 3300042125 | Ga0450923_141640 | Ga0450923_141640_96_485 | 123 |
| 109 | 3300045976 | Ga0466967_0319326 | Ga0466967_0319326_938_1324 | 123 |
| 110 | 3300046535 | Ga0495586_0048271 | Ga0495586_0048271_446_832 | 123 |
| 111 | 3300046642 | Ga0495634_0009347 | Ga0495634_0009347_3587_3973 | 123 |
| 112 | 3300046689 | Ga0495613_0039109 | Ga0495613_0039109_3084_3470 | 123 |
| 113 | 3300046794 | Ga0495589_0382657 | Ga0495589_0382657_17_424 | 123 |
| 114 | 3300047322 | Ga0495680_0079012 | Ga0495680_0079012_666_1052 | 123 |
| 115 | 3300049571 | Ga0501034_0001375 | Ga0501034_0001375_16973_17377 | 123 |
| 116 | 3300049572 | Ga0501036_1208985 | Ga0501036_1208985_79_486 | 123 |
| 117 | 3300049573 | Ga0501037_0116331 | Ga0501037_0116331_19_423 | 123 |
| 118 | 3300049579 | Ga0501043_1024080 | Ga0501043_1024080_53_466 | 123 |
| 119 | 3300049584 | Ga0501068_0006888 | Ga0501068_0006888_2822_3226 | 123 |
| 120 | 3300049584 | Ga0501068_0007529 | Ga0501068_0007529_2793_3197 | 123 |
| 121 | 3300049585 | Ga0501069_0000041 | Ga0501069_0000041_67851_68240 | 123 |
| 122 | 3300049585 | Ga0501069_0005758 | Ga0501069_0005758_2035_2439 | 123 |
| 123 | 3300049586 | Ga0501070_0000013 | Ga0501070_0000013_10627_11016 | 123 |
| 124 | 3300049586 | Ga0501070_0006607 | Ga0501070_0006607_3811_4215 | 123 |
| 125 | 3300049586 | Ga0501070_0026321 | Ga0501070_0026321_3748_4152 | 123 |
| 126 | 3300049587 | Ga0501071_0005449 | Ga0501071_0005449_3286_3675 | 123 |
| 127 | 3300049587 | Ga0501071_0011076 | Ga0501071_0011076_5614_6018 | 123 |
| 128 | 3300049587 | Ga0501071_1259792 | Ga0501071_1259792_120_527 | 123 |
| 129 | 3300049588 | Ga0501072_0017545 | Ga0501072_0017545_4631_5035 | 123 |
| 130 | 3300049589 | Ga0501073_0008360 | Ga0501073_0008360_1889_2293 | 123 |
| 131 | 3300049589 | Ga0501073_0012898 | Ga0501073_0012898_365_769 | 123 |
| 132 | 3300049590 | Ga0501074_0003351 | Ga0501074_0003351_7630_8034 | 123 |
| 133 | 3300049741 | Ga0501079_0033795 | Ga0501079_0033795_3388_3792 | 123 |
| 134 | 3300049742 | Ga0501080_0016998 | Ga0501080_0016998_2891_3280 | 123 |
| 135 | 3300049742 | Ga0501080_0024522 | Ga0501080_0024522_1660_2064 | 123 |
| 136 | 3300049742 | Ga0501080_0027005 | Ga0501080_0027005_3570_3974 | 123 |
| 137 | 3300049744 | Ga0501083_0014495 | Ga0501083_0014495_3984_4388 | 123 |
| 138 | 3300049744 | Ga0501083_0026609 | Ga0501083_0026609_860_1264 | 123 |
| 139 | 3300049744 | Ga0501083_0080837 | Ga0501083_0080837_500_904 | 123 |
| 140 | 3300050492 | nmdc:mga0yw44_167559_c1 | nmdc:mga0yw44_167559_c1_129_539 | 123 |
| 141 | 3300050511 | nmdc:mga08y16_1041558_c1 | nmdc:mga08y16_1041558_c1_74_493 | 123 |
| 142 | 3300053094 | Ga0500566_0130348 | Ga0500566_0130348_17_403 | 123 |
| 143 | 3300053117 | Ga0500593_061852 | Ga0500593_061852_323_727 | 123 |
| 144 | 3300053153 | Ga0500616_0034832 | Ga0500616_0034832_1709_2116 | 123 |
| 145 | 3300054114 | Ga0501084_0003856 | Ga0501084_0003856_6456_6860 | 123 |
| 146 | 3300059426 | Ga0590077_109437 | Ga0590077_109437_180_584 | 123 |
| 147 | 3300005340 | Ga0070689_101189245 | Ga0070689_1011892452 | 124 |
| 148 | 3300005344 | Ga0070661_100133395 | Ga0070661_1001333952 | 124 |
| 149 | 3300005347 | Ga0070668_100498972 | Ga0070668_1004989721 | 124 |
| 150 | 3300005353 | Ga0070669_100277065 | Ga0070669_1002770652 | 124 |
| 151 | 3300005354 | Ga0070675_100109982 | Ga0070675_1001099821 | 124 |
| 152 | 3300005354 | Ga0070675_100325552 | Ga0070675_1003255522 | 124 |
| 153 | 3300005356 | Ga0070674_101699886 | Ga0070674_1016998861 | 124 |
| 154 | 3300005364 | Ga0070673_100614988 | Ga0070673_1006149882 | 124 |
| 155 | 3300005456 | Ga0070678_100469706 | Ga0070678_1004697062 | 124 |
| 156 | 3300005457 | Ga0070662_100957972 | Ga0070662_1009579722 | 124 |
| 157 | 3300005544 | Ga0070686_101292298 | Ga0070686_1012922982 | 124 |
| 158 | 3300005617 | Ga0068859_100188554 | Ga0068859_1001885542 | 124 |
| 159 | 3300005842 | Ga0068858_100807922 | Ga0068858_1008079222 | 124 |
| 160 | 3300005843 | Ga0068860_100851546 | Ga0068860_1008515462 | 124 |
| 161 | 3300005937 | Ga0081455_10248329 | Ga0081455_102483292 | 124 |
| 162 | 3300005937 | Ga0081455_10632903 | Ga0081455_106329032 | 124 |
| 163 | 3300005981 | Ga0081538_10058825 | Ga0081538_100588252 | 124 |
| 164 | 3300006844 | Ga0075428_100003331 | Ga0075428_10000333118 | 124 |
| 165 | 3300006844 | Ga0075428_100051092 | Ga0075428_1000510923 | 124 |
| 166 | 3300006844 | Ga0075428_100052890 | Ga0075428_1000528903 | 124 |
| 167 | 3300006844 | Ga0075428_100432763 | Ga0075428_1004327632 | 124 |
| 168 | 3300006846 | Ga0075430_100009474 | Ga0075430_1000094747 | 124 |
| 169 | 3300006846 | Ga0075430_100025183 | Ga0075430_1000251832 | 124 |
| 170 | 3300006846 | Ga0075430_100163533 | Ga0075430_1001635332 | 124 |
| 171 | 3300006847 | Ga0075431_100001047 | Ga0075431_10000104713 | 124 |
| 172 | 3300006847 | Ga0075431_100048193 | Ga0075431_1000481932 | 124 |
| 173 | 3300006847 | Ga0075431_100141192 | Ga0075431_1001411923 | 124 |
| 174 | 3300006847 | Ga0075431_100146734 | Ga0075431_1001467342 | 124 |
| 175 | 3300006847 | Ga0075431_100216868 | Ga0075431_1002168682 | 124 |
| 176 | 3300006880 | Ga0075429_100000556 | Ga0075429_1000005568 | 124 |
| 177 | 3300006880 | Ga0075429_100000896 | Ga0075429_1000008964 | 124 |
| 178 | 3300006931 | Ga0097620_100188550 | Ga0097620_1001885502 | 124 |
| 179 | 3300009094 | Ga0111539_10015662 | Ga0111539_100156627 | 124 |
| 180 | 3300009094 | Ga0111539_10571837 | Ga0111539_105718372 | 124 |
| 181 | 3300009094 | Ga0111539_11438781 | Ga0111539_114387812 | 124 |
| 182 | 3300009147 | Ga0114129_10001819 | Ga0114129_100018193 | 124 |
| 183 | 3300009147 | Ga0114129_10055596 | Ga0114129_100555966 | 124 |
| 184 | 3300009147 | Ga0114129_10069123 | Ga0114129_100691235 | 124 |
| 185 | 3300013102 | Ga0157371_11425034 | Ga0157371_114250341 | 124 |
| 186 | 3300013296 | Ga0157374_10365063 | Ga0157374_103650632 | 124 |
| 187 | 3300013297 | Ga0157378_10529189 | Ga0157378_105291892 | 124 |
| 188 | 3300013308 | Ga0157375_11137739 | Ga0157375_111377392 | 124 |
| 189 | 3300014326 | Ga0157380_11338061 | Ga0157380_113380611 | 124 |
| 190 | 3300020081 | Ga0206354_11179138 | Ga0206354_111791381 | 124 |
| 191 | 3300025926 | Ga0207659_11023041 | Ga0207659_110230412 | 124 |
| 192 | 3300025926 | Ga0207659_11363374 | Ga0207659_113633741 | 124 |
| 193 | 3300025932 | Ga0207690_10776752 | Ga0207690_107767522 | 124 |
| 194 | 3300025934 | Ga0207686_11731126 | Ga0207686_117311261 | 124 |
| 195 | 3300025936 | Ga0207670_10652529 | Ga0207670_106525291 | 124 |
| 196 | 3300025937 | Ga0207669_10817599 | Ga0207669_108175992 | 124 |
| 197 | 3300025960 | Ga0207651_10451602 | Ga0207651_104516022 | 124 |
| 198 | 3300025960 | Ga0207651_11287348 | Ga0207651_112873481 | 124 |
| 199 | 3300026035 | Ga0207703_10669903 | Ga0207703_106699032 | 124 |
| 200 | 3300026121 | Ga0207683_10258930 | Ga0207683_102589302 | 124 |
| 201 | 3300027907 | Ga0207428_10020246 | Ga0207428_100202461 | 124 |
| 202 | 3300031824 | Ga0307413_10054599 | Ga0307413_100545992 | 124 |
| 203 | 3300031852 | Ga0307410_10006490 | Ga0307410_100064903 | 124 |
| 204 | 3300031903 | Ga0307407_10037590 | Ga0307407_100375902 | 124 |
| 205 | 3300031995 | Ga0307409_100010656 | Ga0307409_1000106564 | 124 |
| 206 | 3300032002 | Ga0307416_100224090 | Ga0307416_1002240902 | 124 |
| 207 | 3300032005 | Ga0307411_10062685 | Ga0307411_100626851 | 124 |
| 208 | 3300032126 | Ga0307415_100073609 | Ga0307415_1000736093 | 124 |
| 209 | 3300035398 | Ga0316574_0609165 | Ga0316574_0609165_108_524 | 124 |
| 210 | 3300041413 | Ga0439465_0203724 | Ga0439465_0203724_69_455 | 124 |
| 211 | 3300041512 | Ga0451853_4098489 | Ga0451853_4098489_62_505 | 124 |
| 212 | 3300042436 | Ga0439435_0303379 | Ga0439435_0303379_113_499 | 124 |
| 213 | 3300044684 | Ga0466966_0014422 | Ga0466966_0014422_3658_4044 | 124 |
| 214 | 3300044694 | Ga0466963_0018602 | Ga0466963_0018602_944_1336 | 124 |
| 215 | 3300045836 | Ga0466958_0080497 | Ga0466958_0080497_662_1054 | 124 |
| 216 | 3300045976 | Ga0466967_0396151 | Ga0466967_0396151_638_1036 | 124 |
| 217 | 3300046459 | Ga0495629_0237675 | Ga0495629_0237675_474_866 | 124 |
| 218 | 3300046475 | Ga0495639_0064761 | Ga0495639_0064761_941_1330 | 124 |
| 219 | 3300046516 | Ga0495628_0245478 | Ga0495628_0245478_143_544 | 124 |
| 220 | 3300046535 | Ga0495586_0414657 | Ga0495586_0414657_138_530 | 124 |
| 221 | 3300046543 | Ga0495645_0348429 | Ga0495645_0348429_427_828 | 124 |
| 222 | 3300046674 | Ga0495588_0258536 | Ga0495588_0258536_204_596 | 124 |
| 223 | 3300046681 | Ga0495647_0061969 | Ga0495647_0061969_916_1305 | 124 |
| 224 | 3300046683 | Ga0495658_0247937 | Ga0495658_0247937_600_992 | 124 |
| 225 | 3300046683 | Ga0495658_0347892 | Ga0495658_0347892_388_777 | 124 |
| 226 | 3300046689 | Ga0495613_0225034 | Ga0495613_0225034_303_695 | 124 |
| 227 | 3300046690 | Ga0495624_0195860 | Ga0495624_0195860_205_594 | 124 |
| 228 | 3300047321 | Ga0495676_0302053 | Ga0495676_0302053_659_1048 | 124 |
| 229 | 3300047673 | Ga0495593_0326493 | Ga0495593_0326493_347_739 | 124 |
| 230 | 3300048909 | Ga0496106_1137214 | Ga0496106_1137214_43_435 | 124 |
| 231 | 3300048912 | Ga0496109_0490422 | Ga0496109_0490422_605_997 | 124 |
| 232 | 3300049569 | Ga0501032_0399049 | Ga0501032_0399049_89_475 | 124 |
| 233 | 3300049570 | Ga0501033_0026515 | Ga0501033_0026515_1723_2109 | 124 |
| 234 | 3300049572 | Ga0501036_0014678 | Ga0501036_0014678_2253_2639 | 124 |
| 235 | 3300049574 | Ga0501038_0654194 | Ga0501038_0654194_387_779 | 124 |
| 236 | 3300049574 | Ga0501038_0776527 | Ga0501038_0776527_235_621 | 124 |
| 237 | 3300049575 | Ga0501039_0030027 | Ga0501039_0030027_2174_2560 | 124 |
| 238 | 3300049576 | Ga0501040_0012445 | Ga0501040_0012445_1248_1634 | 124 |
| 239 | 3300049577 | Ga0501041_0041136 | Ga0501041_0041136_1516_1902 | 124 |
| 240 | 3300049580 | Ga0501046_0162319 | Ga0501046_0162319_1235_1621 | 124 |
| 241 | 3300049582 | Ga0501048_0106354 | Ga0501048_0106354_161_547 | 124 |
| 242 | 3300049584 | Ga0501068_0415358 | Ga0501068_0415358_55_441 | 124 |
| 243 | 3300049584 | Ga0501068_0543290 | Ga0501068_0543290_316_702 | 124 |
| 244 | 3300049587 | Ga0501071_0011156 | Ga0501071_0011156_5597_5983 | 124 |
| 245 | 3300049587 | Ga0501071_0382150 | Ga0501071_0382150_185_574 | 124 |
| 246 | 3300049587 | Ga0501071_0506450 | Ga0501071_0506450_84_479 | 124 |
| 247 | 3300049587 | Ga0501071_1035554 | Ga0501071_1035554_21_419 | 124 |
| 248 | 3300049588 | Ga0501072_0063846 | Ga0501072_0063846_24_410 | 124 |
| 249 | 3300049590 | Ga0501074_0017212 | Ga0501074_0017212_72_458 | 124 |
| 250 | 3300049591 | Ga0501075_0005888 | Ga0501075_0005888_7874_8260 | 124 |
| 251 | 3300049592 | Ga0501076_0013506 | Ga0501076_0013506_3905_4291 | 124 |
| 252 | 3300049593 | Ga0501077_0045396 | Ga0501077_0045396_408_794 | 124 |
| 253 | 3300049741 | Ga0501079_0028416 | Ga0501079_0028416_1109_1495 | 124 |
| 254 | 3300049742 | Ga0501080_1525367 | Ga0501080_1525367_88_474 | 124 |
| 255 | 3300049743 | Ga0501081_0112772 | Ga0501081_0112772_301_687 | 124 |
| 256 | 3300049744 | Ga0501083_0449893 | Ga0501083_0449893_275_661 | 124 |
| 257 | 3300049822 | Ga0501035_0050252 | Ga0501035_0050252_2427_2813 | 124 |
| 258 | 3300049824 | Ga0501045_0030891 | Ga0501045_0030891_2140_2526 | 124 |
| 259 | 3300050507 | nmdc:mga05p37_130377_c1 | nmdc:mga05p37_130377_c1_1949_2335 | 124 |
| 260 | 3300050507 | nmdc:mga05p37_15909_c1 | nmdc:mga05p37_15909_c1_831_1217 | 124 |
| 261 | 3300050507 | nmdc:mga05p37_30095_c1 | nmdc:mga05p37_30095_c1_5153_5539 | 124 |
| 262 | 3300050507 | nmdc:mga05p37_85253_c1 | nmdc:mga05p37_85253_c1_2858_3244 | 124 |
| 263 | 3300050508 | nmdc:mga09592_114797_c1 | nmdc:mga09592_114797_c1_1473_1859 | 124 |
| 264 | 3300050508 | nmdc:mga09592_307_c1 | nmdc:mga09592_307_c1_18885_19271 | 124 |
| 265 | 3300050508 | nmdc:mga09592_427947_c1 | nmdc:mga09592_427947_c1_306_692 | 124 |
| 266 | 3300050509 | nmdc:mga0qj67_129904_c1 | nmdc:mga0qj67_129904_c1_1062_1448 | 124 |
| 267 | 3300050509 | nmdc:mga0qj67_51371_c1 | nmdc:mga0qj67_51371_c1_2580_2966 | 124 |
| 268 | 3300050509 | nmdc:mga0qj67_691730_c1 | nmdc:mga0qj67_691730_c1_284_670 | 124 |
| 269 | 3300050510 | nmdc:mga06r32_104875_c1 | nmdc:mga06r32_104875_c1_1252_1638 | 124 |
| 270 | 3300050510 | nmdc:mga06r32_128289_c1 | nmdc:mga06r32_128289_c1_1046_1432 | 124 |
| 271 | 3300050510 | nmdc:mga06r32_153_c1 | nmdc:mga06r32_153_c1_49943_50329 | 124 |
| 272 | 3300050510 | nmdc:mga06r32_1822270_c1 | nmdc:mga06r32_1822270_c1_53_439 | 124 |
| 273 | 3300050510 | nmdc:mga06r32_19152_c1 | nmdc:mga06r32_19152_c1_2511_2897 | 124 |
| 274 | 3300050510 | nmdc:mga06r32_46741_c1 | nmdc:mga06r32_46741_c1_2915_3301 | 124 |
| 275 | 3300050511 | nmdc:mga08y16_121448_c1 | nmdc:mga08y16_121448_c1_1254_1640 | 124 |
| 276 | 3300050511 | nmdc:mga08y16_279316_c1 | nmdc:mga08y16_279316_c1_758_1144 | 124 |
| 277 | 3300050511 | nmdc:mga08y16_444794_c1 | nmdc:mga08y16_444794_c1_420_818 | 124 |
| 278 | 3300050511 | nmdc:mga08y16_62065_c1 | nmdc:mga08y16_62065_c1_135_521 | 124 |
| 279 | 3300053077 | Ga0495601_0014400 | Ga0495601_0014400_43_444 | 124 |
| 280 | 3300053078 | Ga0495612_0180066 | Ga0495612_0180066_409_810 | 124 |
| 281 | 3300054114 | Ga0501084_0317241 | Ga0501084_0317241_596_982 | 124 |
| 282 | 3300059421 | Ga0590071_083263 | Ga0590071_083263_244_630 | 124 |
| 283 | 3300059426 | Ga0590077_033254 | Ga0590077_033254_708_1094 | 124 |
| 284 | 3300060353 | Ga0501082_0056705 | Ga0501082_0056705_100_486 | 124 |
| 285 | 3300061734 | Ga0530510_0004141 | Ga0530510_0004141_872_1258 | 124 |
| 286 | 3300004799 | Ga0058863_11958211 | Ga0058863_119582111 | 125 |
| 287 | 3300004800 | Ga0058861_11733771 | Ga0058861_117337711 | 125 |
| 288 | 3300005334 | Ga0068869_100868363 | Ga0068869_1008683631 | 125 |
| 289 | 3300005354 | Ga0070675_101494141 | Ga0070675_1014941411 | 125 |
| 290 | 3300005440 | Ga0070705_101279510 | Ga0070705_1012795101 | 125 |
| 291 | 3300005445 | Ga0070708_100006253 | Ga0070708_1000062535 | 125 |
| 292 | 3300005445 | Ga0070708_100013158 | Ga0070708_1000131582 | 125 |
| 293 | 3300005456 | Ga0070678_100934636 | Ga0070678_1009346362 | 125 |
| 294 | 3300005467 | Ga0070706_100712408 | Ga0070706_1007124081 | 125 |
| 295 | 3300006048 | Ga0075363_100190078 | Ga0075363_1001900782 | 125 |
| 296 | 3300006051 | Ga0075364_10156650 | Ga0075364_101566501 | 125 |
| 297 | 3300006051 | Ga0075364_10452674 | Ga0075364_104526742 | 125 |
| 298 | 3300006058 | Ga0075432_10363759 | Ga0075432_103637591 | 125 |
| 299 | 3300006844 | Ga0075428_100121764 | Ga0075428_1001217641 | 125 |
| 300 | 3300006844 | Ga0075428_100575074 | Ga0075428_1005750742 | 125 |
| 301 | 3300006844 | Ga0075428_102644901 | Ga0075428_1026449011 | 125 |
| 302 | 3300006846 | Ga0075430_100219482 | Ga0075430_1002194823 | 125 |
| 303 | 3300006846 | Ga0075430_100333219 | Ga0075430_1003332192 | 125 |
| 304 | 3300006847 | Ga0075431_100029403 | Ga0075431_1000294036 | 125 |
| 305 | 3300006847 | Ga0075431_100420970 | Ga0075431_1004209702 | 125 |
| 306 | 3300006880 | Ga0075429_100030653 | Ga0075429_1000306535 | 125 |
| 307 | 3300009147 | Ga0114129_10190020 | Ga0114129_101900203 | 125 |
| 308 | 3300013297 | Ga0157378_11108105 | Ga0157378_111081052 | 125 |
| 309 | 3300013307 | Ga0157372_11164595 | Ga0157372_111645952 | 125 |
| 310 | 3300013308 | Ga0157375_10589097 | Ga0157375_105890972 | 125 |
| 311 | 3300014969 | Ga0157376_10864039 | Ga0157376_108640391 | 125 |
| 312 | 3300020069 | Ga0197907_11431877 | Ga0197907_114318771 | 125 |
| 313 | 3300020070 | Ga0206356_11253760 | Ga0206356_112537601 | 125 |
| 314 | 3300020076 | Ga0206355_1652289 | Ga0206355_16522892 | 125 |
| 315 | 3300020077 | Ga0206351_10305649 | Ga0206351_103056491 | 125 |
| 316 | 3300020081 | Ga0206354_11181400 | Ga0206354_111814001 | 125 |
| 317 | 3300022467 | Ga0224712_10412815 | Ga0224712_104128151 | 125 |
| 318 | 3300025908 | Ga0207643_10624937 | Ga0207643_106249371 | 125 |
| 319 | 3300025910 | Ga0207684_10676014 | Ga0207684_106760141 | 125 |
| 320 | 3300025934 | Ga0207686_10462914 | Ga0207686_104629142 | 125 |
| 321 | 3300025938 | Ga0207704_10531356 | Ga0207704_105313562 | 125 |
| 322 | 3300026089 | Ga0207648_10403330 | Ga0207648_104033302 | 125 |
| 323 | 3300026121 | Ga0207683_10695241 | Ga0207683_106952412 | 125 |
| 324 | 3300027866 | Ga0209813_10385102 | Ga0209813_103851021 | 125 |
| 325 | 3300046539 | Ga0495621_0230464 | Ga0495621_0230464_179_571 | 125 |
| 326 | 3300049571 | Ga0501034_0000255 | Ga0501034_0000255_32117_32509 | 125 |
| 327 | 3300049584 | Ga0501068_0094519 | Ga0501068_0094519_340_747 | 125 |
| 328 | 3300049586 | Ga0501070_0023620 | Ga0501070_0023620_3720_4112 | 125 |
| 329 | 3300049588 | Ga0501072_0005578 | Ga0501072_0005578_9149_9541 | 125 |
| 330 | 3300050490 | nmdc:mga03n38_203150_c1 | nmdc:mga03n38_203150_c1_312_704 | 125 |
| 331 | 3300050491 | nmdc:mga00v17_3623_c1 | nmdc:mga00v17_3623_c1_1023_1421 | 125 |
| 332 | 3300050491 | nmdc:mga00v17_465788_c1 | nmdc:mga00v17_465788_c1_84_476 | 125 |
| 333 | 3300050492 | nmdc:mga0yw44_593712_c1 | nmdc:mga0yw44_593712_c1_178_570 | 125 |
| 334 | 3300050495 | nmdc:mga04h51_268212_c1 | nmdc:mga04h51_268212_c1_225_623 | 125 |
| 335 | 3300050507 | nmdc:mga05p37_262527_c1 | nmdc:mga05p37_262527_c1_1264_1653 | 125 |
| 336 | 3300050508 | nmdc:mga09592_11813_c1 | nmdc:mga09592_11813_c1_1138_1527 | 125 |
| 337 | 3300050509 | nmdc:mga0qj67_51255_c1 | nmdc:mga0qj67_51255_c1_2447_2839 | 125 |
| 338 | 3300050509 | nmdc:mga0qj67_66496_c1 | nmdc:mga0qj67_66496_c1_2232_2621 | 125 |
| 339 | 3300050510 | nmdc:mga06r32_2059394_c1 | nmdc:mga06r32_2059394_c1_57_449 | 125 |
| 340 | 3300050510 | nmdc:mga06r32_23807_c1 | nmdc:mga06r32_23807_c1_3516_3905 | 125 |
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6yca-assembly1.cif.gz_A | crystal structure of eis1 from mycobacterium abscessus | 0.7285 | 29 | 99 |
| 6yca-assembly1.cif.gz_D | crystal structure of eis1 from mycobacterium abscessus | 0.7256 | 29 | 99 |
| 6yca-assembly1.cif.gz_F | crystal structure of eis1 from mycobacterium abscessus | 0.7244 | 29 | 99 |
| 6yca-assembly1.cif.gz_B | crystal structure of eis1 from mycobacterium abscessus | 0.7196 | 29 | 99 |
| 6yca-assembly1.cif.gz_E | crystal structure of eis1 from mycobacterium abscessus | 0.7157 | 29 | 99 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1iktA00 | Alpha Beta;2-Layer Sandwich;Nonspecific Lipid-transfer Protein; Chain A;SCP2 sterol-binding domain | 0.7055 | 11 | 106 | 3.30.1050.10 |
| af_Q21481_314_431_3.30.1050.10 | Alpha Beta;2-Layer Sandwich;Nonspecific Lipid-transfer Protein; Chain A;SCP2 sterol-binding domain | 0.6972 | 9 | 108 | 3.30.1050.10 |
| af_Q10KK9_14_236_2.120.10.80 | Mainly Beta;6 Propeller;Neuraminidase;Kelch-type beta propeller | 0.6819 | 32 | 54 | 2.120.10.80 |
| 3bksA00 | Alpha Beta;2-Layer Sandwich;Nonspecific Lipid-transfer Protein; Chain A;SCP2 sterol-binding domain | 0.6803 | 8 | 107 | 3.30.1050.10 |
| af_Q54PA2_138_240_3.30.1050.10 | Alpha Beta;2-Layer Sandwich;Nonspecific Lipid-transfer Protein; Chain A;SCP2 sterol-binding domain | 0.678 | 9 | 114 | 3.30.1050.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A538B5K7-F1-model_v4 | SCP-2 sterol transfer family protein | 0.8909 | 1 | 104 |
|
| AF-A0A538B5K7-F1-model_v4 | SCP-2 sterol transfer family protein | 0.8751 | 1 | 104 |
|
| AF-A0A7V9SNN2-F1-model_v4 | SCP2 sterol-binding domain-containing protein | 0.8738 | 1 | 125 |
|
| AF-A0A6J4I0I1-F1-model_v4 | SCP2 domain-containing protein | 0.8691 | 1 | 125 |
|
| AF-A0A399Y2L1-F1-model_v4 | SCP-2 sterol transfer family protein | 0.869 | 2 | 125 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar