F414265

General Info

Members Datasets Scaffolds Average Seq Length
340 193 680 119

Family's Representative Sequence

Representative Sequence 3300005614|Ga0068856_100322272|Ga0068856_1003222722
Length 123
Sequence MKALTGNLLRDGETVFWREGAWVPRFKDAQLFDDDARAEEAEGRAKSAQTVVVDPYLIDVVESDGPNGGLWAPLSFRERIRALGPSNHPQHGKQALGGDDIAALQHAHGAARSTGRVNLIKRK

Samples

Sample ID Description Type Environment
1 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
12 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
13 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
14 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
15 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
16 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
17 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
18 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
19 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
20 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
21 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
22 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
23 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
24 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
25 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
26 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
27 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
28 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
29 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
30 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
31 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
32 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
33 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
34 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
35 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
36 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
37 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
38 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
39 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
40 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
41 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
42 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
43 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
44 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
45 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
46 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
47 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
48 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
49 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
50 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
51 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
52 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
53 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
54 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
55 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
56 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
57 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
58 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
59 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
60 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
61 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
62 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
63 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
93 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
97 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
98 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
99 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
100 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
101 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
102 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
103 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
104 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
105 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
106 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
107 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
108 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
109 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
110 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
111 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
112 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
113 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
114 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
115 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
116 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
117 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
118 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
119 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
120 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
121 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
122 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
123 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
124 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
125 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
126 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
127 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
128 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
129 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
130 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
131 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
132 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
133 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
134 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
135 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
136 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
137 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
138 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
139 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
140 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
141 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
142 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
143 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
144 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
145 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
146 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
147 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
148 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
149 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
150 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
151 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
152 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
153 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
154 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
155 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
156 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
157 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
158 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
159 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
160 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
161 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
162 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
163 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
164 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
165 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
166 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
167 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
168 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
169 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
170 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
171 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
172 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
173 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
174 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
175 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
176 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
177 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
178 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
179 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
180 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
181 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
182 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
183 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
184 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
185 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
186 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
187 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
188 3300053725 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere Metagenome Endosphere
189 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
190 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
191 2643221614 Phenylobacterium sp. Root77 Isolate Unclassified
192 2643221661 Phenylobacterium sp. Root1277 Isolate Unclassified
193 2643221666 Phenylobacterium sp. Root1290 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.12
Metatranscriptomes 0
Isolates 0.88

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.94
Nodule 0
Rhizoplane 2.65
Rhizosphere 78.82
Stem 0
Stem Tuber 0
Unclassified 0.88

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068856_100322272 3300005614 Bacteria 1563
2 Ga0070658_10067935 3300005327 Bacteria 2913
3 Ga0070658_10528122 3300005327 Bacteria 1020
4 Ga0070658_10635920 3300005327 Bacteria 926
5 Ga0070676_10718615 3300005328 Bacteria 731
6 Ga0070670_100000050 3300005331 Bacteria 132470
7 Ga0070670_100312431 3300005331 Bacteria 1376
8 Ga0070670_100723567 3300005331 Bacteria 896
9 Ga0070666_10504132 3300005335 Bacteria 878
10 Ga0070666_10911896 3300005335 Bacteria 650
11 Ga0070680_100185301 3300005336 Bacteria 1753
12 Ga0068868_101291138 3300005338 Bacteria 678
13 Ga0070660_100021475 3300005339 Bacteria 4762
14 Ga0070660_100191571 3300005339 Bacteria 1656
15 Ga0070660_100447973 3300005339 Bacteria 1071
16 Ga0070660_101227022 3300005339 Bacteria 636
17 Ga0070660_101312969 3300005339 Bacteria 614
18 Ga0070691_10032339 3300005341 Bacteria 2457
19 Ga0070668_100001178 3300005347 Bacteria 18504
20 Ga0070668_100002233 3300005347 Bacteria 14239
21 Ga0070668_100022775 3300005347 Bacteria 4736
22 Ga0070669_100019655 3300005353 Bacteria 4825
23 Ga0070671_100000153 3300005355 Bacteria 45037
24 Ga0070671_101894045 3300005355 Unclassified 530
25 Ga0070659_100000040 3300005366 Bacteria 104145
26 Ga0070659_100023337 3300005366 Bacteria 4733
27 Ga0070659_100116869 3300005366 Bacteria 2157
28 Ga0070659_101384807 3300005366 Bacteria 625
29 Ga0070659_101559816 3300005366 Unclassified 589
30 Ga0070659_102132038 3300005366 Bacteria 504
31 Ga0070667_100000299 3300005367 Bacteria 55531
32 Ga0070667_100004014 3300005367 Bacteria 12458
33 Ga0070667_100123204 3300005367 Bacteria 2257
34 Ga0070663_100370572 3300005455 Bacteria 1164
35 Ga0070663_100526242 3300005455 Bacteria 985
36 Ga0070681_10012401 3300005458 Bacteria 8454
37 Ga0070681_10039169 3300005458 Bacteria 4751
38 Ga0070681_10244504 3300005458 Bacteria 1707
39 Ga0070685_10493817 3300005466 Bacteria 865
40 Ga0070679_100009638 3300005530 Bacteria 9133
41 Ga0070679_100317125 3300005530 Bacteria 1508
42 Ga0070679_101272854 3300005530 Bacteria 681
43 Ga0068853_100065622 3300005539 Bacteria 3150
44 Ga0068853_100102914 3300005539 Bacteria 2527
45 Ga0068853_100718633 3300005539 Bacteria 954
46 Ga0068853_100925450 3300005539 Bacteria 838
47 Ga0068853_100952278 3300005539 Bacteria 825
48 Ga0070686_100851736 3300005544 Bacteria 738
49 Ga0070665_100000867 3300005548 Bacteria 39214
50 Ga0070665_100025340 3300005548 Bacteria 5977
51 Ga0070665_100080551 3300005548 Bacteria 3262
52 Ga0070665_101186855 3300005548 Bacteria 774
53 Ga0068855_100045792 3300005563 Bacteria 5172
54 Ga0068855_100062729 3300005563 Bacteria 4338
55 Ga0068855_100080242 3300005563 Bacteria 3783
56 Ga0068855_100082011 3300005563 Bacteria 3738
57 Ga0068855_100210419 3300005563 Bacteria 2185
58 Ga0068855_101380337 3300005563 Bacteria 727
59 Ga0068855_101744509 3300005563 Bacteria 634
60 Ga0068857_100450043 3300005577 Bacteria 1204
61 Ga0068854_100786894 3300005578 Bacteria 828
62 Ga0068852_100152151 3300005616 Bacteria 2152
63 Ga0068859_100000744 3300005617 Bacteria 32833
64 Ga0068859_100089003 3300005617 Bacteria 3137
65 Ga0068864_100000238 3300005618 Bacteria 49284
66 Ga0068864_100487548 3300005618 Bacteria 1184
67 Ga0068861_100082567 3300005719 Bacteria 2519
68 Ga0068861_100618912 3300005719 Bacteria 996
69 Ga0068863_100002323 3300005841 Bacteria 18907
70 Ga0068863_100006056 3300005841 Bacteria 11870
71 Ga0068863_100188638 3300005841 Bacteria 1981
72 Ga0068858_100000129 3300005842 Bacteria 79265
73 Ga0068858_100001538 3300005842 Bacteria 23685
74 Ga0068858_100072031 3300005842 Bacteria 3206
75 Ga0068860_100003590 3300005843 Bacteria 15950
76 Ga0068860_100029093 3300005843 Bacteria 5314
77 Ga0068860_101306866 3300005843 Bacteria 746
78 Ga0068862_100000786 3300005844 Bacteria 31460
79 Ga0068862_100055960 3300005844 Bacteria 3379
80 Ga0075368_10009901 3300006042 Bacteria 3437
81 Ga0075363_100112974 3300006048 Bacteria 1511
82 Ga0075364_10000457 3300006051 Bacteria 20666
83 Ga0075367_10001510 3300006178 Bacteria 10055
84 Ga0075366_10174632 3300006195 Bacteria 1304
85 Ga0097621_101046284 3300006237 Bacteria 765
86 Ga0068871_101529900 3300006358 Bacteria 631
87 Ga0097620_100000744 3300006931 Bacteria 32833
88 Ga0097620_100089011 3300006931 Bacteria 3137
89 Ga0105251_10407023 3300009011 Bacteria 626
90 Ga0105240_10024604 3300009093 Bacteria 7931
91 Ga0105240_10058654 3300009093 Bacteria 4805
92 Ga0105240_10109550 3300009093 Bacteria 3344
93 Ga0105240_10237869 3300009093 Bacteria 2113
94 Ga0105240_10254230 3300009093 Bacteria 2030
95 Ga0105240_11727572 3300009093 Bacteria 653
96 Ga0105240_12340135 3300009093 Bacteria 553
97 Ga0105247_10045298 3300009101 Bacteria 2698
98 Ga0105243_11108629 3300009148 Bacteria 800
99 Ga0105248_10002783 3300009177 Bacteria 19441
100 Ga0105248_10174871 3300009177 Bacteria 2420
101 Ga0105248_10224611 3300009177 Bacteria 2114
102 Ga0105248_11784327 3300009177 Bacteria 698
103 Ga0105237_11911449 3300009545 Bacteria 602
104 Ga0105237_12230149 3300009545 Bacteria 557
105 Ga0105238_10163367 3300009551 Bacteria 2203
106 Ga0105238_11222217 3300009551 Bacteria 776
107 Ga0105238_12559328 3300009551 Bacteria 546
108 Ga0105249_10000356 3300009553 Bacteria 45856
109 Ga0105249_11405840 3300009553 Bacteria 770
110 Ga0105239_10071226 3300010375 Bacteria 3820
111 Ga0105239_10290930 3300010375 Bacteria 1840
112 Ga0105239_12062564 3300010375 Bacteria 662
113 Ga0157373_11349344 3300013100 Bacteria 541
114 Ga0157370_11717918 3300013104 Bacteria 563
115 Ga0157369_10217478 3300013105 Bacteria 2001
116 Ga0157369_10712376 3300013105 Bacteria 1033
117 Ga0157369_10945216 3300013105 Bacteria 883
118 Ga0163162_10012291 3300013306 Bacteria 8358
119 Ga0163162_10780250 3300013306 Bacteria 1074
120 Ga0157372_10580927 3300013307 Bacteria 1306
121 Ga0157372_11310486 3300013307 Bacteria 836
122 Ga0157372_12744902 3300013307 Bacteria 565
123 Ga0157375_12918170 3300013308 Bacteria 571
124 Ga0163163_10001756 3300014325 Bacteria 18264
125 Ga0163163_10221834 3300014325 Bacteria 1939
126 Ga0163163_10735463 3300014325 Bacteria 1050
127 Ga0157379_10001581 3300014968 Bacteria 18756
128 Ga0157379_10006140 3300014968 Bacteria 10344
129 Ga0157379_10037449 3300014968 Bacteria 4325
130 Ga0157379_11539051 3300014968 Bacteria 648
131 Ga0213874_10000791 3300021377 Bacteria 6428
132 Ga0213876_10000168 3300021384 Bacteria 69226
133 Ga0213876_10136186 3300021384 Bacteria 1306
134 Ga0213875_10030168 3300021388 Bacteria 2569
135 Ga0209026_1024362 3300025250 Bacteria 918
136 Ga0209148_1034264 3300025254 Bacteria 737
137 Ga0207697_10118115 3300025315 Bacteria 1140
138 Ga0207697_10362712 3300025315 Bacteria 643
139 Ga0207680_10222305 3300025903 Bacteria 1295
140 Ga0207645_10538279 3300025907 Bacteria 792
141 Ga0207705_10013624 3300025909 Bacteria 5866
142 Ga0207705_10403607 3300025909 Bacteria 1057
143 Ga0207707_10082409 3300025912 Bacteria 2809
144 Ga0207707_10460069 3300025912 Bacteria 1088
145 Ga0207707_10625543 3300025912 Bacteria 909
146 Ga0207695_10000987 3300025913 Bacteria 50463
147 Ga0207695_10065741 3300025913 Bacteria 3728
148 Ga0207695_10154695 3300025913 Bacteria 2229
149 Ga0207695_10344110 3300025913 Bacteria 1379
150 Ga0207660_10004369 3300025917 Bacteria 9219
151 Ga0207660_10390808 3300025917 Bacteria 1119
152 Ga0207657_10005615 3300025919 Bacteria 13091
153 Ga0207657_10034871 3300025919 Bacteria 4518
154 Ga0207657_10321435 3300025919 Bacteria 1223
155 Ga0207657_11013132 3300025919 Bacteria 637
156 Ga0207652_10002332 3300025921 Bacteria 16081
157 Ga0207652_10329761 3300025921 Bacteria 1378
158 Ga0207694_10463028 3300025924 Bacteria 1059
159 Ga0207694_10622219 3300025924 Bacteria 908
160 Ga0207694_11081504 3300025924 Bacteria 679
161 Ga0207650_10000133 3300025925 Bacteria 90953
162 Ga0207650_10158259 3300025925 Bacteria 1793
163 Ga0207650_11290743 3300025925 Bacteria 621
164 Ga0207644_10005355 3300025931 Bacteria 8370
165 Ga0207690_10000134 3300025932 Bacteria 60374
166 Ga0207690_11144540 3300025932 Unclassified 649
167 Ga0207711_10004518 3300025941 Bacteria 11850
168 Ga0207711_10023337 3300025941 Bacteria 5178
169 Ga0207711_10036643 3300025941 Bacteria 4163
170 Ga0207679_11809445 3300025945 Bacteria 558
171 Ga0207667_10066085 3300025949 Bacteria 3770
172 Ga0207667_10075226 3300025949 Bacteria 3507
173 Ga0207667_10114179 3300025949 Bacteria 2784
174 Ga0207667_10182196 3300025949 Bacteria 2157
175 Ga0207667_10510695 3300025949 Bacteria 1218
176 Ga0207667_11294258 3300025949 Bacteria 706
177 Ga0207712_10000790 3300025961 Bacteria 23489
178 Ga0207712_10371977 3300025961 Bacteria 1193
179 Ga0207712_10890569 3300025961 Bacteria 786
180 Ga0207668_10000016 3300025972 Bacteria 159703
181 Ga0207668_10000662 3300025972 Bacteria 21158
182 Ga0207668_10015854 3300025972 Bacteria 4692
183 Ga0207640_10794530 3300025981 Bacteria 819
184 Ga0207658_10000931 3300025986 Bacteria 24185
185 Ga0207658_10013584 3300025986 Bacteria 5569
186 Ga0207658_10015286 3300025986 Bacteria 5266
187 Ga0207658_10457426 3300025986 Bacteria 1131
188 Ga0207703_10000086 3300026035 Bacteria 107307
189 Ga0207703_10003053 3300026035 Bacteria 14164
190 Ga0207703_10053505 3300026035 Bacteria 3281
191 Ga0207639_10022556 3300026041 Bacteria 4535
192 Ga0207678_10412724 3300026067 Bacteria 1170
193 Ga0207702_10257269 3300026078 Bacteria 1642
194 Ga0207702_11148907 3300026078 Bacteria 771
195 Ga0207641_10003109 3300026088 Bacteria 14930
196 Ga0207641_10005335 3300026088 Bacteria 10980
197 Ga0207641_10189281 3300026088 Bacteria 1890
198 Ga0207676_10000109 3300026095 Bacteria 74080
199 Ga0207676_10551544 3300026095 Bacteria 1101
200 Ga0207674_10145460 3300026116 Bacteria 2329
201 Ga0207675_100053296 3300026118 Bacteria 3774
202 Ga0207698_11432208 3300026142 Bacteria 706
203 Ga0209813_10040482 3300027866 Bacteria 1417
204 Ga0268266_10013244 3300028379 Bacteria 7109
205 Ga0268266_10013577 3300028379 Bacteria 7015
206 Ga0268266_10020927 3300028379 Bacteria 5576
207 Ga0268265_10006583 3300028380 Bacteria 7863
208 Ga0268265_10042866 3300028380 Bacteria 3360
209 Ga0268264_10000364 3300028381 Bacteria 67218
210 Ga0268264_10008347 3300028381 Bacteria 8607
211 Ga0268264_11334527 3300028381 Bacteria 727
212 Ga0265338_10009609 3300028800 Bacteria 11491
213 Ga0265327_10000933 3300031251 Bacteria 42834
214 Ga0307408_100323933 3300031548 Bacteria 1299
215 Ga0307408_100394546 3300031548 Bacteria 1187
216 Ga0307405_10289269 3300031731 Bacteria 1238
217 Ga0307416_101318284 3300032002 Bacteria 828
218 Ga0307415_101629427 3300032126 Bacteria 621
219 Ga0373945_0248571 3300035116 Bacteria 750
220 Ga0373931_0649865 3300035691 Bacteria 693
221 Ga0373935_0371379 3300035692 Bacteria 1023
222 Ga0373933_0840621 3300035724 Bacteria 604
223 Ga0373937_0596385 3300036401 Bacteria 1049
224 Ga0373937_0760730 3300036401 Bacteria 916
225 Ga0373925_0605643 3300037068 Bacteria 902
226 Ga0373925_0796827 3300037068 Bacteria 779
227 Ga0395899_0000984 3300037312 Bacteria 26243
228 Ga0395900_0000010 3300037418 Bacteria 461364
229 Ga0395900_0990458 3300037418 Bacteria 761
230 Ga0395900_1581924 3300037418 Bacteria 567
231 Ga0395898_0004653 3300037466 Bacteria 14958
232 Ga0395898_1104645 3300037466 Bacteria 726
233 Ga0395905_0001301 3300037471 Bacteria 30685
234 Ga0395905_0220013 3300037471 Bacteria 1777
235 Ga0395905_0235286 3300037471 Bacteria 1712
236 Ga0395905_0626880 3300037471 Bacteria 977
237 Ga0395905_1835362 3300037471 Bacteria 512
238 Ga0436364_0372079 3300037853 Bacteria 2586
239 Ga0436364_1112419 3300037853 Bacteria 2722
240 Ga0395901_0000007 3300038443 Bacteria 497408
241 Ga0395901_0267576 3300038443 Bacteria 1778
242 Ga0436365_1053358 3300039437 Bacteria 69298
243 Ga0436365_1080759 3300039437 Bacteria 630
244 Ga0436365_1596297 3300039437 Bacteria 3685
245 Ga0436363_1274042 3300039450 Bacteria 5264
246 Ga0451845_0939838 3300041501 Bacteria 583
247 Ga0451855_0940282 3300041511 Bacteria 645
248 Ga0466972_0613926 3300044658 Bacteria 514
249 Ga0466961_0163722 3300044693 Bacteria 1386
250 Ga0466964_0733309 3300044706 Bacteria 553
251 Ga0466957_0481165 3300044842 Bacteria 859
252 Ga0495662_0426813 3300046476 Bacteria 651
253 Ga0495585_0190021 3300046492 Bacteria 1051
254 Ga0495606_0535373 3300046507 Bacteria 585
255 Ga0495610_0026595 3300046512 Bacteria 3088
256 Ga0495620_0042151 3300046515 Bacteria 1996
257 Ga0495637_0106497 3300046520 Bacteria 1091
258 Ga0495643_0005794 3300046522 Bacteria 8270
259 Ga0495654_0281179 3300046530 Bacteria 684
260 Ga0495609_0077785 3300046538 Bacteria 1452
261 Ga0495621_0030050 3300046539 Bacteria 1855
262 Ga0495597_0001893 3300046542 Bacteria 14240
263 Ga0495597_0118983 3300046542 Bacteria 1102
264 Ga0495622_0002466 3300046557 Bacteria 8963
265 Ga0495668_0028998 3300046616 Bacteria 3128
266 Ga0495625_0057581 3300046660 Bacteria 2763
267 Ga0495669_0325930 3300046684 Bacteria 741
268 Ga0495593_0036107 3300047673 Bacteria 2681
269 Ga0495602_0434264 3300048088 Bacteria 930
270 Ga0496101_0513317 3300048904 Bacteria 947
271 Ga0496101_0754089 3300048904 Bacteria 768
272 Ga0496102_0065142 3300048905 Bacteria 3339
273 Ga0496102_0825324 3300048905 Bacteria 849
274 Ga0496102_1249075 3300048905 Bacteria 662
275 Ga0496102_1506099 3300048905 Bacteria 591
276 Ga0496103_0244773 3300048906 Bacteria 1154
277 Ga0496106_1248889 3300048909 Bacteria 578
278 Ga0496112_0263228 3300048915 Bacteria 1674
279 Ga0496118_0014735 3300048921 Bacteria 7300
280 Ga0496119_0067233 3300048922 Bacteria 2114
281 Ga0496121_0001187 3300048924 Bacteria 45612
282 Ga0501033_0029990 3300049570 Bacteria 4088
283 Ga0501033_0377114 3300049570 Bacteria 991
284 Ga0501034_0609465 3300049571 Bacteria 997
285 Ga0501037_0240542 3300049573 Bacteria 1269
286 Ga0501038_0421414 3300049574 Bacteria 1030
287 Ga0501043_0187225 3300049579 Bacteria 1611
288 Ga0501043_0241199 3300049579 Bacteria 1394
289 Ga0501043_0470661 3300049579 Bacteria 942
290 Ga0501047_0013442 3300049581 Bacteria 7761
291 Ga0501047_0029691 3300049581 Bacteria 5271
292 Ga0501047_0029700 3300049581 Bacteria 5270
293 Ga0501047_0058071 3300049581 Bacteria 3739
294 Ga0501048_0033502 3300049582 Bacteria 3711
295 Ga0501257_010211 3300049686 Bacteria 2128
296 Ga0501035_0227136 3300049822 Bacteria 1592
297 Ga0501035_1081839 3300049822 Bacteria 627
298 Ga0501044_0004038 3300049823 Bacteria 16462
299 Ga0501044_1174238 3300049823 Bacteria 636
300 Ga0501044_1613402 3300049823 Bacteria 514
301 nmdc:mga03n38_83734_c1 3300050490 Bacteria 1504
302 nmdc:mga00v17_801_c1 3300050491 Bacteria 17106
303 nmdc:mga0k408_5702_c1 3300050493 Bacteria 6623
304 nmdc:mga06z11_3771_c1 3300050494 Bacteria 5895
305 nmdc:mga04h51_16932_c1 3300050495 Bacteria 2123
306 nmdc:mga0sz30_11763_c1 3300050516 Bacteria 3388
307 Ga0500635_0000082 3300053080 Bacteria 62117
308 Ga0500643_022644 3300053087 Bacteria 2019
309 Ga0500647_0049452 3300053091 Bacteria 2022
310 Ga0500583_0272431 3300053092 Bacteria 832
311 Ga0500651_0002702 3300053093 Bacteria 9453
312 Ga0500566_0015011 3300053094 Bacteria 4548
313 Ga0500554_142814 3300053102 Bacteria 809
314 Ga0500555_001298 3300053103 Bacteria 7915
315 Ga0500555_028129 3300053103 Bacteria 1602
316 Ga0500556_0022237 3300053104 Bacteria 2057
317 Ga0500569_000868 3300053109 Bacteria 5375
318 Ga0500572_117750 3300053111 Bacteria 858
319 Ga0500595_002406 3300053119 Bacteria 9340
320 Ga0500595_130635 3300053119 Bacteria 707
321 Ga0500597_234225 3300053120 Bacteria 758
322 Ga0500608_011266 3300053122 Bacteria 3876
323 Ga0500614_001498 3300053123 Bacteria 5563
324 Ga0500642_0138309 3300053130 Bacteria 1142
325 Ga0500658_0054554 3300053134 Bacteria 1643
326 Ga0500559_0244014 3300053136 Bacteria 846
327 Ga0500564_222803 3300053138 Bacteria 762
328 Ga0500603_027601 3300053150 Bacteria 1443
329 Ga0500619_011115 3300053154 Bacteria 2302
330 Ga0500620_095473 3300053155 Bacteria 1038
331 Ga0500638_188050 3300053162 Bacteria 885
332 Ga0500636_0071341 3300053177 Bacteria 2014
333 Ga0500636_0078364 3300053177 Bacteria 1907
334 Ga0500637_0039619 3300053178 Bacteria 2658
335 Ga0500576_201161 3300053725 Bacteria 677
336 Ga0500625_186703 3300053729 Bacteria 716
337 Ga0500596_000086 3300053735 Bacteria 12601
338 2644085616 2643221614 Bacteria 4260023
339 2644343167 2643221661 Bacteria 4267604
340 2644366467 2643221666 Bacteria 4265935
341 Ga0068856_100322272
342 Ga0070658_10067935
343 Ga0070658_10528122
344 Ga0070658_10635920
345 Ga0070676_10718615
346 Ga0070670_100000050
347 Ga0070670_100312431
348 Ga0070670_100723567
349 Ga0070666_10504132
350 Ga0070666_10911896
351 Ga0070680_100185301
352 Ga0068868_101291138
353 Ga0070660_100021475
354 Ga0070660_100191571
355 Ga0070660_100447973
356 Ga0070660_101227022
357 Ga0070660_101312969
358 Ga0070691_10032339
359 Ga0070668_100001178
360 Ga0070668_100002233
361 Ga0070668_100022775
362 Ga0070669_100019655
363 Ga0070671_100000153
364 Ga0070671_101894045
365 Ga0070659_100000040
366 Ga0070659_100023337
367 Ga0070659_100116869
368 Ga0070659_101384807
369 Ga0070659_101559816
370 Ga0070659_102132038
371 Ga0070667_100000299
372 Ga0070667_100004014
373 Ga0070667_100123204
374 Ga0070663_100370572
375 Ga0070663_100526242
376 Ga0070681_10012401
377 Ga0070681_10039169
378 Ga0070681_10244504
379 Ga0070685_10493817
380 Ga0070679_100009638
381 Ga0070679_100317125
382 Ga0070679_101272854
383 Ga0068853_100065622
384 Ga0068853_100102914
385 Ga0068853_100718633
386 Ga0068853_100925450
387 Ga0068853_100952278
388 Ga0070686_100851736
389 Ga0070665_100000867
390 Ga0070665_100025340
391 Ga0070665_100080551
392 Ga0070665_101186855
393 Ga0068855_100045792
394 Ga0068855_100062729
395 Ga0068855_100080242
396 Ga0068855_100082011
397 Ga0068855_100210419
398 Ga0068855_101380337
399 Ga0068855_101744509
400 Ga0068857_100450043
401 Ga0068854_100786894
402 Ga0068852_100152151
403 Ga0068859_100000744
404 Ga0068859_100089003
405 Ga0068864_100000238
406 Ga0068864_100487548
407 Ga0068861_100082567
408 Ga0068861_100618912
409 Ga0068863_100002323
410 Ga0068863_100006056
411 Ga0068863_100188638
412 Ga0068858_100000129
413 Ga0068858_100001538
414 Ga0068858_100072031
415 Ga0068860_100003590
416 Ga0068860_100029093
417 Ga0068860_101306866
418 Ga0068862_100000786
419 Ga0068862_100055960
420 Ga0075368_10009901
421 Ga0075363_100112974
422 Ga0075364_10000457
423 Ga0075367_10001510
424 Ga0075366_10174632
425 Ga0097621_101046284
426 Ga0068871_101529900
427 Ga0097620_100000744
428 Ga0097620_100089011
429 Ga0105251_10407023
430 Ga0105240_10024604
431 Ga0105240_10058654
432 Ga0105240_10109550
433 Ga0105240_10237869
434 Ga0105240_10254230
435 Ga0105240_11727572
436 Ga0105240_12340135
437 Ga0105247_10045298
438 Ga0105243_11108629
439 Ga0105248_10002783
440 Ga0105248_10174871
441 Ga0105248_10224611
442 Ga0105248_11784327
443 Ga0105237_11911449
444 Ga0105237_12230149
445 Ga0105238_10163367
446 Ga0105238_11222217
447 Ga0105238_12559328
448 Ga0105249_10000356
449 Ga0105249_11405840
450 Ga0105239_10071226
451 Ga0105239_10290930
452 Ga0105239_12062564
453 Ga0157373_11349344
454 Ga0157370_11717918
455 Ga0157369_10217478
456 Ga0157369_10712376
457 Ga0157369_10945216
458 Ga0163162_10012291
459 Ga0163162_10780250
460 Ga0157372_10580927
461 Ga0157372_11310486
462 Ga0157372_12744902
463 Ga0157375_12918170
464 Ga0163163_10001756
465 Ga0163163_10221834
466 Ga0163163_10735463
467 Ga0157379_10001581
468 Ga0157379_10006140
469 Ga0157379_10037449
470 Ga0157379_11539051
471 Ga0213874_10000791
472 Ga0213876_10000168
473 Ga0213876_10136186
474 Ga0213875_10030168
475 Ga0209026_1024362
476 Ga0209148_1034264
477 Ga0207697_10118115
478 Ga0207697_10362712
479 Ga0207680_10222305
480 Ga0207645_10538279
481 Ga0207705_10013624
482 Ga0207705_10403607
483 Ga0207707_10082409
484 Ga0207707_10460069
485 Ga0207707_10625543
486 Ga0207695_10000987
487 Ga0207695_10065741
488 Ga0207695_10154695
489 Ga0207695_10344110
490 Ga0207660_10004369
491 Ga0207660_10390808
492 Ga0207657_10005615
493 Ga0207657_10034871
494 Ga0207657_10321435
495 Ga0207657_11013132
496 Ga0207652_10002332
497 Ga0207652_10329761
498 Ga0207694_10463028
499 Ga0207694_10622219
500 Ga0207694_11081504
501 Ga0207650_10000133
502 Ga0207650_10158259
503 Ga0207650_11290743
504 Ga0207644_10005355
505 Ga0207690_10000134
506 Ga0207690_11144540
507 Ga0207711_10004518
508 Ga0207711_10023337
509 Ga0207711_10036643
510 Ga0207679_11809445
511 Ga0207667_10066085
512 Ga0207667_10075226
513 Ga0207667_10114179
514 Ga0207667_10182196
515 Ga0207667_10510695
516 Ga0207667_11294258
517 Ga0207712_10000790
518 Ga0207712_10371977
519 Ga0207712_10890569
520 Ga0207668_10000016
521 Ga0207668_10000662
522 Ga0207668_10015854
523 Ga0207640_10794530
524 Ga0207658_10000931
525 Ga0207658_10013584
526 Ga0207658_10015286
527 Ga0207658_10457426
528 Ga0207703_10000086
529 Ga0207703_10003053
530 Ga0207703_10053505
531 Ga0207639_10022556
532 Ga0207678_10412724
533 Ga0207702_10257269
534 Ga0207702_11148907
535 Ga0207641_10003109
536 Ga0207641_10005335
537 Ga0207641_10189281
538 Ga0207676_10000109
539 Ga0207676_10551544
540 Ga0207674_10145460
541 Ga0207675_100053296
542 Ga0207698_11432208
543 Ga0209813_10040482
544 Ga0268266_10013244
545 Ga0268266_10013577
546 Ga0268266_10020927
547 Ga0268265_10006583
548 Ga0268265_10042866
549 Ga0268264_10000364
550 Ga0268264_10008347
551 Ga0268264_11334527
552 Ga0265338_10009609
553 Ga0265327_10000933
554 Ga0307408_100323933
555 Ga0307408_100394546
556 Ga0307405_10289269
557 Ga0307416_101318284
558 Ga0307415_101629427
559 Ga0373945_0248571
560 Ga0373931_0649865
561 Ga0373935_0371379
562 Ga0373933_0840621
563 Ga0373937_0596385
564 Ga0373937_0760730
565 Ga0373925_0605643
566 Ga0373925_0796827
567 Ga0395899_0000984
568 Ga0395900_0000010
569 Ga0395900_0990458
570 Ga0395900_1581924
571 Ga0395898_0004653
572 Ga0395898_1104645
573 Ga0395905_0001301
574 Ga0395905_0220013
575 Ga0395905_0235286
576 Ga0395905_0626880
577 Ga0395905_1835362
578 Ga0436364_0372079
579 Ga0436364_1112419
580 Ga0395901_0000007
581 Ga0395901_0267576
582 Ga0436365_1053358
583 Ga0436365_1080759
584 Ga0436365_1596297
585 Ga0436363_1274042
586 Ga0451845_0939838
587 Ga0451855_0940282
588 Ga0466972_0613926
589 Ga0466961_0163722
590 Ga0466964_0733309
591 Ga0466957_0481165
592 Ga0495662_0426813
593 Ga0495585_0190021
594 Ga0495606_0535373
595 Ga0495610_0026595
596 Ga0495620_0042151
597 Ga0495637_0106497
598 Ga0495643_0005794
599 Ga0495654_0281179
600 Ga0495609_0077785
601 Ga0495621_0030050
602 Ga0495597_0001893
603 Ga0495597_0118983
604 Ga0495622_0002466
605 Ga0495668_0028998
606 Ga0495625_0057581
607 Ga0495669_0325930
608 Ga0495593_0036107
609 Ga0495602_0434264
610 Ga0496101_0513317
611 Ga0496101_0754089
612 Ga0496102_0065142
613 Ga0496102_0825324
614 Ga0496102_1249075
615 Ga0496102_1506099
616 Ga0496103_0244773
617 Ga0496106_1248889
618 Ga0496112_0263228
619 Ga0496118_0014735
620 Ga0496119_0067233
621 Ga0496121_0001187
622 Ga0501033_0029990
623 Ga0501033_0377114
624 Ga0501034_0609465
625 Ga0501037_0240542
626 Ga0501038_0421414
627 Ga0501043_0187225
628 Ga0501043_0241199
629 Ga0501043_0470661
630 Ga0501047_0013442
631 Ga0501047_0029691
632 Ga0501047_0029700
633 Ga0501047_0058071
634 Ga0501048_0033502
635 Ga0501257_010211
636 Ga0501035_0227136
637 Ga0501035_1081839
638 Ga0501044_0004038
639 Ga0501044_1174238
640 Ga0501044_1613402
641 nmdc:mga03n38_83734_c1
642 nmdc:mga00v17_801_c1
643 nmdc:mga0k408_5702_c1
644 nmdc:mga06z11_3771_c1
645 nmdc:mga04h51_16932_c1
646 nmdc:mga0sz30_11763_c1
647 Ga0500635_0000082
648 Ga0500643_022644
649 Ga0500647_0049452
650 Ga0500583_0272431
651 Ga0500651_0002702
652 Ga0500566_0015011
653 Ga0500554_142814
654 Ga0500555_001298
655 Ga0500555_028129
656 Ga0500556_0022237
657 Ga0500569_000868
658 Ga0500572_117750
659 Ga0500595_002406
660 Ga0500595_130635
661 Ga0500597_234225
662 Ga0500608_011266
663 Ga0500614_001498
664 Ga0500642_0138309
665 Ga0500658_0054554
666 Ga0500559_0244014
667 Ga0500564_222803
668 Ga0500603_027601
669 Ga0500619_011115
670 Ga0500620_095473
671 Ga0500638_188050
672 Ga0500636_0071341
673 Ga0500636_0078364
674 Ga0500637_0039619
675 Ga0500576_201161
676 Ga0500625_186703
677 Ga0500596_000086
678 2644085616
679 2644343167
680 2644366467

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF11011

DUF2849

Protein of unknown function (DUF2849)

2

90

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
2djw-assembly1.cif.gz_F crystal structure of ttha0845 from thermus thermophilus hb8 0.4754 2 63
6lrs-assembly1.cif.gz_S cryo-em structure of rbcl8-rbcs4 from anabaena sp. pcc 7120 0.4359 1 60
2wfw-assembly1.cif.gz_A structure and activity of the n-terminal substrate recognition domains in proteasomal atpases - the arc domain structure 0.4087 1 37
1s4m-assembly2.cif.gz_B crystal structure of flavin binding to fad synthetase from thermotoga maritina 0.4068 2 48
7ztj-assembly1.cif.gz_A penicillium expansum antifungal protein chimera c-ter 0.4052 1 22
ID Description Score Start End Superfamily
1svdM00 Alpha Beta;2-Layer Sandwich;Ribulose 1,5 Bisphosphate Carboxylase/Oxygenase;Ribulose bisphosphate carboxylase, small subunit 0.5408 2 58 3.30.190.10
af_Q2FWU7_1_95_3.40.1350.100 Alpha Beta;3-Layer(aba) Sandwich;Trna Endonuclease; Chain: A, domain 1; 0.5321 1 69 3.40.1350.100
af_Q7JKB9_25_97_2.10.60.10 Mainly Beta;Ribbon;CD59;CD59 0.5186 2 21 2.10.60.10
4me4A01 Alpha Beta;2-Layer Sandwich;Beta-Lactamase;GAF domain 0.5008 2 31 3.30.450.40
1i1gB02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Lrp/AsnC effector binding domain/regulation of amino acid metabolism (RAM) domain 0.4943 1 62 3.30.70.920
ID Description Score Start End GO Terms
AF-A0A3D4DWR5-F1-model_v4 DUF2849 domain-containing protein 0.9221 2 66
AF-A0A355KE31-F1-model_v4 DUF2849 domain-containing protein 0.9119 2 61
AF-A0A661NGF6-F1-model_v4 DUF2849 domain-containing protein 0.8951 2 81
AF-A0A7T1NT55-F1-model_v4 deleted 0.8873 2 82
AF-A0A2E3NLA9-F1-model_v4 DUF2849 domain-containing protein 0.8819 2 82

Map