F414124

General Info

Members Datasets Scaffolds Average Seq Length
339 298 678 267

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2513237104|2513714959
Length 302
Sequence NERIFVQAIRSYCARHGVAIDVRADGWLIAMDRGETRRFAFGYDIGLNSAIAHRLANDKSATSEVLALAGVPSIAHHLFLNPKLGEHVAGPRWWEAMLRLLIQNPQGLVVKPNEGTAGRSVVKVTGSAELERAVSEVFAMSLGLVIAPYVDIEDEVRVILLDETPMAVYGKERPSVTGDGVQTLRELARAVPKVKLDDLDAHALDAVVPKGERRVLTWRHNLDAGAKPVLIEGGETRAACAKLAIDAARAIGITFASIDLVRVDGVWKVLEINSGVMMEALGKLYPELVQATYDAALDRVFG

Samples

Sample ID Description Type Environment
1 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
2 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
3 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
4 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
5 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
8 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
9 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
10 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
11 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
12 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
13 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
14 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
15 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
16 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
17 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
18 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
19 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
20 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
21 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
22 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
23 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
24 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
25 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
26 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
27 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
28 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
29 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
30 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
31 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
32 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
33 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
34 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
35 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
36 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
37 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
38 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
39 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
40 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
41 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
42 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
43 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
44 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
45 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
46 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
47 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
48 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
49 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
65 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
66 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
67 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
68 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
69 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
72 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
73 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
74 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
75 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
76 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
77 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
78 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
79 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
80 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
81 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
82 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
83 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
84 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
85 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
86 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
87 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
88 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
89 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
90 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
91 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
92 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
93 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
94 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
95 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
96 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
97 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
98 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
99 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
100 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
101 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
102 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
103 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
104 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
105 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
106 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
107 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
108 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
109 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
110 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
111 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
112 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
113 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
114 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
115 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
116 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
117 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
118 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
119 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
120 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
121 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
122 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
123 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
124 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
125 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
126 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
127 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
128 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
129 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
130 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
131 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
132 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
133 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
134 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
135 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
136 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
137 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
138 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
139 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
140 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
141 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
142 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
143 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
144 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
145 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
146 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
147 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
148 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
149 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
150 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
151 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
152 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
153 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
154 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
155 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
156 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
157 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
158 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
159 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
160 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
161 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
162 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
163 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
164 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
165 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
166 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
167 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
168 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
169 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
170 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
171 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
172 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
173 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
174 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
175 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
176 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
177 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
178 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
179 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
180 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
181 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
182 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
183 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
184 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
185 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
186 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
187 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
188 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
189 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
190 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
191 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
192 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
193 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
194 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
195 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
196 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
197 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
198 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
199 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
200 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
201 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
202 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
203 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
204 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
205 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
206 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
207 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
208 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
209 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
210 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
211 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
212 2922368715
213 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
214 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
215 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
216 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
217 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
218 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
219 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
220 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
221 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
222 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
223 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
224 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
225 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
226 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
227 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
228 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
229 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
230 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
231 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
232 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
233 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
234 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
235 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
236 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
237 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
238 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
239 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
240 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
241 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
242 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
243 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
244 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
245 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
246 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
247 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
248 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
249 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
250 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
251 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
252 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
253 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
254 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
255 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
256 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
257 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
258 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
259 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
260 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
261 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
262 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
263 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
264 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
265 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
266 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
267 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
268 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
269 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
270 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
271 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
272 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
273 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
274 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
275 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
276 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
277 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
278 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
279 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
280 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
281 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
282 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
283 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
284 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
285 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
286 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
287 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
288 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
289 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
290 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
291 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
292 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
293 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
294 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
295 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
296 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
297 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
298 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 55.62
Metatranscriptomes 0
Isolates 44.38

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 20.65
Nodule 35.4
Rhizoplane 2.65
Rhizosphere 24.78
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25153J46596_10003798 3300003215 Bacteria 8333
2 JGI25153J46596_10021478 3300003215 Bacteria 2405
3 JGI25153J46596_10022344 3300003215 Bacteria 2335
4 JGI25153J46596_10036136 3300003215 Bacteria 1589
5 JGI25153J46596_10036156 3300003215 Bacteria 1588
6 JGI25160J50197_1003105 3300003354 Bacteria 7578
7 JGI25160J50197_1006588 3300003354 Bacteria 4679
8 Ga0055539_1005098 3300003752 Bacteria 1718
9 Ga0055531_10007499 3300003794 Bacteria 5939
10 Ga0065165_1001837 3300005262 Bacteria 20724
11 Ga0065165_1002477 3300005262 Bacteria 15526
12 Ga0065165_1010669 3300005262 Bacteria 3936
13 Ga0070658_10208760 3300005327 Bacteria 1649
14 Ga0070667_100216285 3300005367 Bacteria 1704
15 Ga0070663_100022572 3300005455 Bacteria 4209
16 Ga0070665_100208978 3300005548 Bacteria 1952
17 Ga0070665_100217656 3300005548 Bacteria 1910
18 Ga0070665_100296133 3300005548 Bacteria 1620
19 Ga0068855_100349625 3300005563 Bacteria 1629
20 Ga0068857_100167961 3300005577 Bacteria 1993
21 Ga0068856_100191229 3300005614 Bacteria 2060
22 Ga0068852_100233705 3300005616 Bacteria 1754
23 Ga0068851_10045009 3300005834 Bacteria 2230
24 Ga0068858_100255042 3300005842 Bacteria 1666
25 Ga0075365_10013432 3300006038 Bacteria 4898
26 Ga0075368_10004690 3300006042 Bacteria 4650
27 Ga0075363_100079699 3300006048 Bacteria 1789
28 Ga0075364_10159097 3300006051 Bacteria 1524
29 Ga0075362_10026087 3300006177 Bacteria 2493
30 Ga0075369_10071568 3300006186 Bacteria 1526
31 Ga0075366_10049399 3300006195 Bacteria 2496
32 Ga0075370_10131153 3300006353 Bacteria 1462
33 Ga0099823_1016800 3300006944 Bacteria 7161
34 Ga0105240_10002557 3300009093 Bacteria 29181
35 Ga0105240_10455710 3300009093 Bacteria 1430
36 Ga0105245_10172481 3300009098 Bacteria 2061
37 Ga0105243_10155786 3300009148 Bacteria 1964
38 Ga0105241_10100071 3300009174 Bacteria 2303
39 Ga0105241_10362194 3300009174 Bacteria 1262
40 Ga0105248_10358105 3300009177 Bacteria 1643
41 Ga0105237_10002092 3300009545 Bacteria 25220
42 Ga0105237_10286092 3300009545 Bacteria 1651
43 Ga0105239_10030653 3300010375 Bacteria 5915
44 Ga0105239_10202584 3300010375 Bacteria 2223
45 Ga0105246_10016814 3300011119 Bacteria 4640
46 Ga0157374_10160082 3300013296 Bacteria 2193
47 Ga0157376_10353716 3300014969 Bacteria 1407
48 Ga0214544_1000007 3300021320 Bacteria 379989
49 Ga0214542_1000216 3300021321 Bacteria 92614
50 Ga0214545_1000118 3300021324 Bacteria 92737
51 Ga0214543_1000009 3300021327 Bacteria 384302
52 Ga0209563_105093 3300025230 Bacteria 2425
53 Ga0209677_100395 3300025253 Bacteria 26466
54 Ga0209148_1000388 3300025254 Bacteria 52495
55 Ga0209233_1007765 3300025261 Bacteria 3371
56 Ga0209233_1024576 3300025261 Bacteria 1504
57 Ga0209455_1001028 3300025272 Bacteria 13884
58 Ga0209564_1029241 3300025295 Bacteria 1739
59 Ga0209758_1000030 3300025297 Bacteria 509217
60 Ga0209758_1000429 3300025297 Bacteria 71157
61 Ga0209758_1001554 3300025297 Bacteria 26349
62 Ga0209758_1004020 3300025297 Bacteria 12690
63 Ga0209758_1013181 3300025297 Bacteria 4539
64 Ga0209758_1018173 3300025297 Bacteria 3462
65 Ga0209256_1002999 3300025299 Bacteria 12539
66 Ga0209256_1028786 3300025299 Bacteria 1560
67 Ga0207426_1000347 3300025302 Bacteria 85420
68 Ga0207426_1002198 3300025302 Bacteria 13123
69 Ga0207426_1007792 3300025302 Bacteria 4434
70 Ga0207426_1017112 3300025302 Bacteria 2584
71 Ga0209257_1003962 3300025304 Bacteria 12003
72 Ga0209257_1026301 3300025304 Bacteria 1964
73 Ga0207680_10080292 3300025903 Bacteria 2048
74 Ga0207647_10002092 3300025904 Bacteria 15273
75 Ga0207654_10034676 3300025911 Bacteria 2806
76 Ga0207654_10237501 3300025911 Bacteria 1216
77 Ga0207695_10000006 3300025913 Bacteria 1135309
78 Ga0207671_10002266 3300025914 Bacteria 20809
79 Ga0207657_10406888 3300025919 Bacteria 1070
80 Ga0207650_10044021 3300025925 Bacteria 3279
81 Ga0207668_10141775 3300025972 Bacteria 1849
82 Ga0207658_10233408 3300025986 Bacteria 1554
83 Ga0207703_10220067 3300026035 Bacteria 1697
84 Ga0207639_10511873 3300026041 Bacteria 1098
85 Ga0207678_10042635 3300026067 Bacteria 3930
86 Ga0207678_10208940 3300026067 Bacteria 1670
87 Ga0207702_10222335 3300026078 Bacteria 1760
88 Ga0207674_10041752 3300026116 Bacteria 4742
89 Ga0207698_10102660 3300026142 Bacteria 2374
90 Ga0209389_1000015 3300027296 Bacteria 188311
91 Ga0209389_1000035 3300027296 Bacteria 127089
92 Ga0209589_1000039 3300027357 Bacteria 127084
93 Ga0209489_100072 3300027361 Bacteria 138111
94 Ga0209489_100084 3300027361 Bacteria 127094
95 Ga0209700_100034 3300027363 Bacteria 197276
96 Ga0209813_10029588 3300027866 Bacteria 1605
97 Ga0268266_10055001 3300028379 Bacteria 3421
98 Ga0268266_10192775 3300028379 Bacteria 1861
99 Ga0268266_10506798 3300028379 Bacteria 1153
100 Ga0268264_10464454 3300028381 Bacteria 1228
101 Ga0307507_10176913 3300033179 Bacteria 1535
102 Ga0307510_10048089 3300033180 Bacteria 4557
103 Ga0395905_0036290 3300037471 Bacteria 4629
104 Ga0451797_0571001 3300041453 Bacteria 1017
105 Ga0451833_0399597 3300041491 Bacteria 953
106 Ga0466972_0000048 3300044658 Bacteria 119165
107 Ga0466972_0005309 3300044658 Bacteria 6450
108 Ga0466972_0089023 3300044658 Bacteria 1465
109 Ga0466966_0000542 3300044684 Bacteria 24049
110 Ga0466961_0000018 3300044693 Bacteria 109837
111 Ga0466960_0112322 3300044901 Bacteria 1417
112 Ga0466959_0006178 3300045049 Bacteria 8276
113 Ga0495638_0008088 3300046460 Bacteria 7481
114 Ga0495651_0000667 3300046462 Bacteria 26661
115 Ga0495653_0079269 3300046463 Bacteria 2433
116 Ga0495607_0176689 3300046501 Bacteria 1074
117 Ga0495606_0160437 3300046507 Bacteria 1312
118 Ga0495608_0052564 3300046511 Bacteria 2697
119 Ga0495610_0068357 3300046512 Bacteria 1665
120 Ga0495628_0316531 3300046516 Bacteria 1152
121 Ga0495643_0103456 3300046522 Bacteria 1456
122 Ga0495648_0035435 3300046524 Bacteria 3235
123 Ga0495648_0135044 3300046524 Bacteria 1306
124 Ga0495648_0205703 3300046524 Bacteria 982
125 Ga0495640_0012313 3300046533 Bacteria 6540
126 Ga0495597_0087744 3300046542 Bacteria 1323
127 Ga0495645_0023280 3300046543 Bacteria 4485
128 Ga0495622_0197900 3300046557 Bacteria 896
129 Ga0495657_0042515 3300046675 Bacteria 3102
130 Ga0495623_0015865 3300046679 Bacteria 4870
131 Ga0495646_0011525 3300046680 Bacteria 5615
132 Ga0495613_0104934 3300046689 Bacteria 2040
133 Ga0495671_0089931 3300046692 Bacteria 1503
134 Ga0495600_0002629 3300046809 Bacteria 10366
135 Ga0495604_0005311 3300047317 Bacteria 10226
136 Ga0495687_006309 3300047443 Bacteria 7301
137 Ga0495675_0016813 3300047444 Bacteria 4627
138 Ga0495686_0164753 3300047472 Bacteria 1293
139 Ga0495686_0249934 3300047472 Bacteria 997
140 Ga0495602_0023680 3300048088 Bacteria 5977
141 Ga0496102_0054073 3300048905 Bacteria 3660
142 Ga0496105_0020805 3300048908 Bacteria 5305
143 Ga0496106_0230172 3300048909 Bacteria 1480
144 Ga0496108_0555228 3300048911 Bacteria 1002
145 Ga0496110_0064392 3300048913 Bacteria 3240
146 Ga0496111_0009986 3300048914 Bacteria 6351
147 Ga0496112_0126400 3300048915 Bacteria 2527
148 Ga0496113_0098757 3300048916 Bacteria 2260
149 Ga0496116_0016000 3300048919 Bacteria 5897
150 Ga0496116_0097461 3300048919 Bacteria 1768
151 Ga0496118_0077925 3300048921 Bacteria 2348
152 Ga0496119_0083922 3300048922 Bacteria 1828
153 Ga0496120_0012118 3300048923 Bacteria 5884
154 Ga0496121_0038319 3300048924 Bacteria 4248
155 Ga0496121_0060239 3300048924 Bacteria 3123
156 Ga0496121_0070406 3300048924 Bacteria 2817
157 Ga0496122_0126548 3300048925 Bacteria 1634
158 Ga0496124_0233235 3300048927 Bacteria 1374
159 Ga0496125_0148355 3300048928 Bacteria 1616
160 Ga0496126_0423414 3300048929 Bacteria 1076
161 nmdc:mga0yw44_12543_c1 3300050492 Bacteria 4423
162 nmdc:mga0yw44_159551_c1 3300050492 Bacteria 1476
163 nmdc:mga07m45_155301_c1 3300050496 Bacteria 1327
164 nmdc:mga07m45_89495_c1 3300050496 Bacteria 1763
165 nmdc:mga0sz30_21812_c1 3300050516 Bacteria 2595
166 nmdc:mga0sz30_97740_c1 3300050516 Bacteria 1281
167 Ga0500643_000278 3300053087 Bacteria 44354
168 Ga0500583_0036324 3300053092 Bacteria 2205
169 Ga0500651_0314706 3300053093 Bacteria 895
170 Ga0500566_0052622 3300053094 Bacteria 2325
171 Ga0500555_001765 3300053103 Bacteria 6463
172 Ga0500556_0024450 3300053104 Bacteria 1984
173 Ga0500557_000019 3300053105 Bacteria 93216
174 Ga0500572_095768 3300053111 Bacteria 945
175 Ga0500595_013131 3300053119 Bacteria 3179
176 Ga0500642_0000064 3300053130 Bacteria 58285
177 Ga0500658_0023505 3300053134 Bacteria 2354
178 Ga0500577_0133433 3300053142 Bacteria 1042
179 Ga0500590_074884 3300053148 Bacteria 1674
180 Ga0500616_0065346 3300053153 Bacteria 1871
181 Ga0500620_052229 3300053155 Bacteria 1373
182 Ga0500622_0059887 3300053156 Bacteria 1943
183 Ga0500633_0030160 3300053160 Bacteria 1741
184 Ga0500636_0000729 3300053177 Bacteria 17739
185 Ga0500625_008211 3300053729 Bacteria 4592
186 Ga0500645_080020 3300053730 Bacteria 933
187 Ga0500609_000982 3300053731 Bacteria 4272
188 Ga0500601_001936 3300053737 Bacteria 2226
189 2513714959 2513237104 Bacteria 10034502
190 2507504733 2507262055 Bacteria 8048963
191 2508539851 2508501009 Bacteria 7784016
192 2508695018 2508501042 Bacteria 8719808
193 2511394936 2511231028 Bacteria 8046582
194 2513624971 2513237092 Bacteria 8341956
195 2513699724 2513237102 Bacteria 7703324
196 2513879230 2513237139 Bacteria 8737671
197 2514010242 2513237161 Bacteria 8871253
198 2517106527 2517093001 Bacteria 9002274
199 2524440153 2524023205 Bacteria 8918781
200 2528850660 2528768022 Bacteria 10457665
201 2617350117 2617270735 Bacteria 9163226
202 2617377191 2617270741 Bacteria 8201522
203 2745077738 2744054633 Bacteria 8678936
204 2793065752 2791355196 Bacteria 7323613
205 2805920345 2802429603 Bacteria 8777136
206 2824608867 2824600985 Bacteria 8488197
207 2824611913 2824609381 Bacteria 8672835
208 2824626261 2824617872 Bacteria 8814715
209 2824634989 2824626560 Bacteria 8813858
210 2824643442 2824635225 Bacteria 8785348
211 2824651778 2824644064 Bacteria 8743947
212 2824660780 2824653114 Bacteria 8493680
213 2824664245 2824661429 Bacteria 9877870
214 2824676064 2824671348 Bacteria 8369588
215 2824686741 2824679649 Bacteria 8248951
216 2824692492 2824687955 Bacteria 8360029
217 2824699793 2824696289 Bacteria 8335049
218 2824721937 2824714736 Bacteria 8717648
219 2824731813 2824723954 Bacteria 8758240
220 2824739944 2824732956 Bacteria 7810675
221 2824753570 2824746037 Bacteria 7911610
222 2824763226 2824753945 Bacteria 9787441
223 2824773095 2824763712 Bacteria 9792355
224 2824780995 2824773399 Bacteria 8360218
225 2838125841 2838122688 Bacteria 8803140
226 2841948433 2841941048 Bacteria 8688029
227 2841952881 2841949485 Bacteria 8680857
228 2841963506 2841957949 Bacteria 8652217
229 2841971087 2841966195 Bacteria 8673214
230 2841977654 2841974524 Bacteria 8931498
231 2841984785 2841983080 Bacteria 8395090
232 2842049536 2842045827 Bacteria 8006841
233 2844315937 2844315083 Bacteria 8138177
234 2847939825 2847930680 Bacteria 9342022
235 2847942775 2847939898 Bacteria 8606328
236 2849076774 2849076700 Bacteria 7039503
237 2857515725 2857509624 Bacteria 7472071
238 2874618635 2874612657 Bacteria 8252029
239 2874622063 2874620515 Bacteria 8290088
240 2874629267 2874628541 Bacteria 8630250
241 2879088259 2879083081 Bacteria 8587928
242 2879099887 2879099564 Bacteria 10442239
243 2881666049 2881665667 Bacteria 8175609
244 2885369024 2885366525 Bacteria 8326213
245 2888390192 2888388044 Bacteria 7304136
246 2888427333 2888419890 Bacteria 7857137
247 2903731886 2903727486 Bacteria 8281579
248 2904669345 2904666416 Bacteria 8226587
249 2904716096 2904711408 Bacteria 9771557
250 2906606173 2906602504 Bacteria 8295279
251 2906652124 2906643746 Bacteria 8722424
252 2908775708 2908775508 Bacteria 8092255
253 2922377902
254 2922400860 2922393267 Bacteria 8285685
255 2929623919 2929615660 Bacteria 9193770
256 2929633047 2929624759 Bacteria 9339455
257 2932789140 2932784394 Bacteria 9704911
258 2932814223 2932809354 Bacteria 9135765
259 2932820349 2932818245 Bacteria 9955613
260 2932834389 2932828146 Bacteria 9745859
261 2933585822 2933577622 Bacteria 9116884
262 2935615070 2935608549 Bacteria 8203142
263 2935620074 2935616580 Bacteria 9032984
264 2935640392 2935638405 Bacteria 10015038
265 2935651578 2935648319 Bacteria 8801166
266 2935659654 2935656913 Bacteria 8965014
267 2935668586 2935665750 Bacteria 9571747
268 2935683799 2935675223 Bacteria 9928132
269 2935686894 2935684952 Bacteria 9590419
270 2935702067 2935694250 Bacteria 9291695
271 2935709904 2935703347 Bacteria 10242284
272 2935716582 2935713505 Bacteria 9608509
273 2935723293 2935722832 Bacteria 9608746
274 2935734850 2935732158 Bacteria 9706831
275 2935744359 2935741537 Bacteria 9707219
276 2935752860 2935750917 Bacteria 9590372
277 2935769281 2935760218 Bacteria 9817913
278 2935774758 2935769743 Bacteria 7878163
279 2935789727 2935785616 Bacteria 7962367
280 2935797905 2935793552 Bacteria 8012592
281 2935806291 2935801545 Bacteria 9301974
282 2935818147 2935810662 Bacteria 9401221
283 2935825892 2935819856 Bacteria 8261050
284 2935831898 2935827899 Bacteria 10038562
285 2935841271 2935837841 Bacteria 9454360
286 2935851511 2935847175 Bacteria 8228321
287 2935858960 2935855204 Bacteria 9035059
288 2935864141 2935864058 Bacteria 9784707
289 2935875507 2935873716 Bacteria 9632195
290 2935910468 2935908558 Bacteria 8568796
291 2935918130 2935916978 Bacteria 9113783
292 2935927621 2935926038 Bacteria 8601059
293 2935936507 2935934488 Bacteria 8602579
294 2935943940 2935942939 Bacteria 8599779
295 2935952377 2935951376 Bacteria 8602333
296 2935969217 2935967501 Bacteria 8603075
297 2935978022 2935975950 Bacteria 8347125
298 2935984678 2935984226 Bacteria 8302647
299 2935995513 2935992306 Bacteria 9802711
300 2936007935 2936002035 Bacteria 9362176
301 2936014070 2936011229 Bacteria 8801034
302 2936023021 2936019824 Bacteria 8804134
303 2936031157 2936028420 Bacteria 8965941
304 2936044757 2936037263 Bacteria 9446081
305 2936049279 2936046547 Bacteria 8903709
306 2936055821 2936055302 Bacteria 8785755
307 2940558773 2940556831 Bacteria 9590747
308 2941535790 2941531003 Bacteria 7653939
309 2941543498 2941538514 Bacteria 9402094
310 3005486472 3005483717 Bacteria 7877331
311 3005588967 3005587118 Bacteria 7794411
312 3005595532 3005594810 Bacteria 8716512
313 3005711519 3005710791 Bacteria 7622528
314 8016517657 8016511872 Bacteria 9921665
315 8016525716 8016522445 Bacteria 8156687
316 8016539314 8016530956 Bacteria 8155261
317 8016543602 8016539877 Bacteria 8155419
318 8016549691 8016548790 Bacteria 8155074
319 8016558107 8016557553 Bacteria 8154380
320 8016581645 8016575299 Bacteria 8154085
321 8016596115 8016595262 Bacteria 8149947
322 8016607011 8016603502 Bacteria 8731218
323 8016618915 8016613128 Bacteria 8794220
324 8016622630 8016622563 Bacteria 7999408
325 8017058969 8017057580 Bacteria 10023680
326 8019530593 8019530166 Bacteria 8155624
327 8019540999 8019538911 Bacteria 7872763
328 8019549621 8019547302 Bacteria 7996444
329 8019576674 8019576017 Bacteria 10049540
330 8019607011 8019597564 Bacteria 10041141
331 8019611499 8019608314 Bacteria 10042931
332 8019622425 8019619141 Bacteria 9218857
333 8019630855 8019629233 Bacteria 8687553
334 8019639742 8019638758 Bacteria 9062356
335 8019667871 8019659431 Bacteria 8577854
336 8019677286 8019668869 Bacteria 8791617
337 8019678696 8019678201 Bacteria 8863603
338 8019696820 8019687851 Bacteria 8712826
339 8055742946 8055742211 Bacteria 9226248
340 JGI25153J46596_10003798
341 JGI25153J46596_10021478
342 JGI25153J46596_10022344
343 JGI25153J46596_10036136
344 JGI25153J46596_10036156
345 JGI25160J50197_1003105
346 JGI25160J50197_1006588
347 Ga0055539_1005098
348 Ga0055531_10007499
349 Ga0065165_1001837
350 Ga0065165_1002477
351 Ga0065165_1010669
352 Ga0070658_10208760
353 Ga0070667_100216285
354 Ga0070663_100022572
355 Ga0070665_100208978
356 Ga0070665_100217656
357 Ga0070665_100296133
358 Ga0068855_100349625
359 Ga0068857_100167961
360 Ga0068856_100191229
361 Ga0068852_100233705
362 Ga0068851_10045009
363 Ga0068858_100255042
364 Ga0075365_10013432
365 Ga0075368_10004690
366 Ga0075363_100079699
367 Ga0075364_10159097
368 Ga0075362_10026087
369 Ga0075369_10071568
370 Ga0075366_10049399
371 Ga0075370_10131153
372 Ga0099823_1016800
373 Ga0105240_10002557
374 Ga0105240_10455710
375 Ga0105245_10172481
376 Ga0105243_10155786
377 Ga0105241_10100071
378 Ga0105241_10362194
379 Ga0105248_10358105
380 Ga0105237_10002092
381 Ga0105237_10286092
382 Ga0105239_10030653
383 Ga0105239_10202584
384 Ga0105246_10016814
385 Ga0157374_10160082
386 Ga0157376_10353716
387 Ga0214544_1000007
388 Ga0214542_1000216
389 Ga0214545_1000118
390 Ga0214543_1000009
391 Ga0209563_105093
392 Ga0209677_100395
393 Ga0209148_1000388
394 Ga0209233_1007765
395 Ga0209233_1024576
396 Ga0209455_1001028
397 Ga0209564_1029241
398 Ga0209758_1000030
399 Ga0209758_1000429
400 Ga0209758_1001554
401 Ga0209758_1004020
402 Ga0209758_1013181
403 Ga0209758_1018173
404 Ga0209256_1002999
405 Ga0209256_1028786
406 Ga0207426_1000347
407 Ga0207426_1002198
408 Ga0207426_1007792
409 Ga0207426_1017112
410 Ga0209257_1003962
411 Ga0209257_1026301
412 Ga0207680_10080292
413 Ga0207647_10002092
414 Ga0207654_10034676
415 Ga0207654_10237501
416 Ga0207695_10000006
417 Ga0207671_10002266
418 Ga0207657_10406888
419 Ga0207650_10044021
420 Ga0207668_10141775
421 Ga0207658_10233408
422 Ga0207703_10220067
423 Ga0207639_10511873
424 Ga0207678_10042635
425 Ga0207678_10208940
426 Ga0207702_10222335
427 Ga0207674_10041752
428 Ga0207698_10102660
429 Ga0209389_1000015
430 Ga0209389_1000035
431 Ga0209589_1000039
432 Ga0209489_100072
433 Ga0209489_100084
434 Ga0209700_100034
435 Ga0209813_10029588
436 Ga0268266_10055001
437 Ga0268266_10192775
438 Ga0268266_10506798
439 Ga0268264_10464454
440 Ga0307507_10176913
441 Ga0307510_10048089
442 Ga0395905_0036290
443 Ga0451797_0571001
444 Ga0451833_0399597
445 Ga0466972_0000048
446 Ga0466972_0005309
447 Ga0466972_0089023
448 Ga0466966_0000542
449 Ga0466961_0000018
450 Ga0466960_0112322
451 Ga0466959_0006178
452 Ga0495638_0008088
453 Ga0495651_0000667
454 Ga0495653_0079269
455 Ga0495607_0176689
456 Ga0495606_0160437
457 Ga0495608_0052564
458 Ga0495610_0068357
459 Ga0495628_0316531
460 Ga0495643_0103456
461 Ga0495648_0035435
462 Ga0495648_0135044
463 Ga0495648_0205703
464 Ga0495640_0012313
465 Ga0495597_0087744
466 Ga0495645_0023280
467 Ga0495622_0197900
468 Ga0495657_0042515
469 Ga0495623_0015865
470 Ga0495646_0011525
471 Ga0495613_0104934
472 Ga0495671_0089931
473 Ga0495600_0002629
474 Ga0495604_0005311
475 Ga0495687_006309
476 Ga0495675_0016813
477 Ga0495686_0164753
478 Ga0495686_0249934
479 Ga0495602_0023680
480 Ga0496102_0054073
481 Ga0496105_0020805
482 Ga0496106_0230172
483 Ga0496108_0555228
484 Ga0496110_0064392
485 Ga0496111_0009986
486 Ga0496112_0126400
487 Ga0496113_0098757
488 Ga0496116_0016000
489 Ga0496116_0097461
490 Ga0496118_0077925
491 Ga0496119_0083922
492 Ga0496120_0012118
493 Ga0496121_0038319
494 Ga0496121_0060239
495 Ga0496121_0070406
496 Ga0496122_0126548
497 Ga0496124_0233235
498 Ga0496125_0148355
499 Ga0496126_0423414
500 nmdc:mga0yw44_12543_c1
501 nmdc:mga0yw44_159551_c1
502 nmdc:mga07m45_155301_c1
503 nmdc:mga07m45_89495_c1
504 nmdc:mga0sz30_21812_c1
505 nmdc:mga0sz30_97740_c1
506 Ga0500643_000278
507 Ga0500583_0036324
508 Ga0500651_0314706
509 Ga0500566_0052622
510 Ga0500555_001765
511 Ga0500556_0024450
512 Ga0500557_000019
513 Ga0500572_095768
514 Ga0500595_013131
515 Ga0500642_0000064
516 Ga0500658_0023505
517 Ga0500577_0133433
518 Ga0500590_074884
519 Ga0500616_0065346
520 Ga0500620_052229
521 Ga0500622_0059887
522 Ga0500633_0030160
523 Ga0500636_0000729
524 Ga0500625_008211
525 Ga0500645_080020
526 Ga0500609_000982
527 Ga0500601_001936
528 2513714959
529 2507504733
530 2508539851
531 2508695018
532 2511394936
533 2513624971
534 2513699724
535 2513879230
536 2514010242
537 2517106527
538 2524440153
539 2528850660
540 2617350117
541 2617377191
542 2745077738
543 2793065752
544 2805920345
545 2824608867
546 2824611913
547 2824626261
548 2824634989
549 2824643442
550 2824651778
551 2824660780
552 2824664245
553 2824676064
554 2824686741
555 2824692492
556 2824699793
557 2824721937
558 2824731813
559 2824739944
560 2824753570
561 2824763226
562 2824773095
563 2824780995
564 2838125841
565 2841948433
566 2841952881
567 2841963506
568 2841971087
569 2841977654
570 2841984785
571 2842049536
572 2844315937
573 2847939825
574 2847942775
575 2849076774
576 2857515725
577 2874618635
578 2874622063
579 2874629267
580 2879088259
581 2879099887
582 2881666049
583 2885369024
584 2888390192
585 2888427333
586 2903731886
587 2904669345
588 2904716096
589 2906606173
590 2906652124
591 2908775708
592 2922377902
593 2922400860
594 2929623919
595 2929633047
596 2932789140
597 2932814223
598 2932820349
599 2932834389
600 2933585822
601 2935615070
602 2935620074
603 2935640392
604 2935651578
605 2935659654
606 2935668586
607 2935683799
608 2935686894
609 2935702067
610 2935709904
611 2935716582
612 2935723293
613 2935734850
614 2935744359
615 2935752860
616 2935769281
617 2935774758
618 2935789727
619 2935797905
620 2935806291
621 2935818147
622 2935825892
623 2935831898
624 2935841271
625 2935851511
626 2935858960
627 2935864141
628 2935875507
629 2935910468
630 2935918130
631 2935927621
632 2935936507
633 2935943940
634 2935952377
635 2935969217
636 2935978022
637 2935984678
638 2935995513
639 2936007935
640 2936014070
641 2936023021
642 2936031157
643 2936044757
644 2936049279
645 2936055821
646 2940558773
647 2941535790
648 2941543498
649 3005486472
650 3005588967
651 3005595532
652 3005711519
653 8016517657
654 8016525716
655 8016539314
656 8016543602
657 8016549691
658 8016558107
659 8016581645
660 8016596115
661 8016607011
662 8016618915
663 8016622630
664 8017058969
665 8019530593
666 8019540999
667 8019549621
668 8019576674
669 8019607011
670 8019611499
671 8019622425
672 8019630855
673 8019639742
674 8019667871
675 8019677286
676 8019678696
677 8019696820
678 8055742946

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
3vpd-assembly1.cif.gz_A-2 lysx from thermus thermophilus complexed with amp-pnp 0.8221 57 245
3vpb-assembly1.cif.gz_D argx from sulfolobus tokodaii complexed with lysw/glu/adp/mg/zn/sulfate 0.8111 52 261
3vpc-assembly1.cif.gz_C argx from sulfolobus tokodaii complexed with adp 0.8016 52 264
5oeb-assembly6.cif.gz_F structure of large terminase from the thermophilic bacteriophage d6e in complex with adp (crystal form 3) 0.8001 9 44
5oeb-assembly3.cif.gz_C structure of large terminase from the thermophilic bacteriophage d6e in complex with adp (crystal form 3) 0.7996 9 44
ID Description Score Start End Superfamily
6dgiB03 Alpha Beta;2-Layer Sandwich;Dna Ligase; domain 1;ATP-grasp fold, A domain 0.8655 78 152 3.30.1490.20
6dgiB03 Alpha Beta;2-Layer Sandwich;Dna Ligase; domain 1;ATP-grasp fold, A domain 0.843 78 152 3.30.1490.20
3se7B03 Alpha Beta;2-Layer Sandwich;Dna Ligase; domain 1;ATP-grasp fold, A domain 0.8387 110 148 3.30.1490.20
2zdqA03 Alpha Beta;2-Layer Sandwich;Dna Ligase; domain 1;ATP-grasp fold, A domain 0.8376 112 148 3.30.1490.20
3tqtA03 Alpha Beta;2-Layer Sandwich;Dna Ligase; domain 1;ATP-grasp fold, A domain 0.8327 77 153 3.30.1490.20
ID Description Score Start End GO Terms
AF-A0A1C3WLX2-F1-model_v4 RimK-like ATP-grasp domain-containing protein 0.9365 1 263 GO:0005524
GO:0005737
GO:0009432
GO:0018169
GO:0046872
AF-A0A7W8E1L5-F1-model_v4 ATP-grasp domain-containing protein 0.9339 1 262 GO:0005737
GO:0009432
GO:0018169
AF-A0A1C3WLX2-F1-model_v4 RimK-like ATP-grasp domain-containing protein 0.9297 1 263 GO:0005524
GO:0005737
GO:0009432
GO:0018169
GO:0046872
AF-A0A7Y5W8K4-F1-model_v4 RimK-like protein 0.926 1 264 GO:0005524
GO:0005737
GO:0009432
GO:0018169
GO:0046872
AF-A0A4P5X757-F1-model_v4 ATP-grasp domain-containing protein 0.9142 6 265 GO:0005524
GO:0005737
GO:0009432
GO:0018169

Map