F414120

General Info

Members Datasets Scaffolds Average Seq Length
339 169 339 237

Family's Representative Sequence

Representative Sequence 3300053727|Ga0500611_000003|Ga0500611_000003_234412_235227
Length 271
Sequence VPPELSEINMNGLHGVITIARMNLKTVADRVSLQPMGQKKLERFAELDTFQNVLQFPKDIAGKWNSFFKNKHSITLELACGKGEYAVGLGRLYPDRNFIGVDLKGNRIWVGARKALKEELYNVGFLRTLIDQVADYFAKDEVAEIWITFPDPQLRKSKAKKRLTHPKFLRLYQQFLIPGGLIHLKTDSPDLYAFTKLVIALYGCVLHNDYEDTYKQDAIAPELRIKTHYESLDIAGSNRIHYLCFSLPAVIPGKEKDSELKQLLEENEGAD

Samples

Sample ID Description Type Environment
1 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
25 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
26 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
29 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
30 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
31 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
32 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
33 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
34 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
35 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
36 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
37 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
38 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
39 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
40 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
41 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
42 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
43 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
44 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
45 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
46 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
47 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
48 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
50 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
51 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
52 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
53 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
56 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
57 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
58 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
59 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
60 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
61 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
62 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
63 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
64 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
65 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
66 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
67 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
68 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
69 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
70 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
71 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
72 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
111 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
115 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
116 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
117 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
118 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
119 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
120 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
121 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
122 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
123 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
124 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
125 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
126 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
127 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
128 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
129 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
130 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
131 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
132 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
133 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
134 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
135 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
136 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
137 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
138 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
139 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
140 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
141 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
142 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
143 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
144 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
145 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
146 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
147 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
148 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
149 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
150 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
151 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
152 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
153 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
154 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
155 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
156 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
157 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
158 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
159 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
160 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
161 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
162 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
163 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
164 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
165 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
166 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
167 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
168 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
169 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.95
Nodule 0
Rhizoplane 1.18
Rhizosphere 94.99
Stem 0
Stem Tuber 0
Unclassified 0.88

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 ARcpr5yngRDRAFT_c004685 3300000043 Bacteria 1283
2 rootL2_10192219 3300003322 Unclassified 2027
3 rootH1_10359371 3300003323 Unclassified 1315
4 Ga0070658_10091086 3300005327 Bacteria 2513
5 Ga0070676_10012693 3300005328 Bacteria 4606
6 Ga0070676_10020237 3300005328 Bacteria 3712
7 Ga0070676_10025860 3300005328 Unclassified 3320
8 Ga0070676_10029554 3300005328 Bacteria 3118
9 Ga0070676_10075528 3300005328 Bacteria 2032
10 Ga0070676_10093846 3300005328 Bacteria 1843
11 Ga0070683_100151483 3300005329 Unclassified 2199
12 Ga0070690_100004226 3300005330 Bacteria 7951
13 Ga0070690_100227534 3300005330 Bacteria 1309
14 Ga0070670_100019716 3300005331 Bacteria 5791
15 Ga0070670_100023427 3300005331 Bacteria 5314
16 Ga0070670_100129578 3300005331 Bacteria 2178
17 Ga0070670_100280165 3300005331 Bacteria 1456
18 Ga0070670_100628606 3300005331 Unclassified 962
19 Ga0068869_100003891 3300005334 Bacteria 9212
20 Ga0068869_100017592 3300005334 Bacteria 4848
21 Ga0068869_100018954 3300005334 Bacteria 4691
22 Ga0068869_100020358 3300005334 Unclassified 4549
23 Ga0068869_100049524 3300005334 Bacteria 3041
24 Ga0068869_100056615 3300005334 Unclassified 2860
25 Ga0070666_10112077 3300005335 Bacteria 1887
26 Ga0070682_100000041 3300005337 Bacteria 142152
27 Ga0068868_100022712 3300005338 Bacteria 4739
28 Ga0068868_100037694 3300005338 Bacteria 3749
29 Ga0068868_100124825 3300005338 Bacteria 2102
30 Ga0068868_100195471 3300005338 Bacteria 1684
31 Ga0070689_100020841 3300005340 Bacteria 4870
32 Ga0070687_100061703 3300005343 Bacteria 1982
33 Ga0070687_100113302 3300005343 Bacteria 1539
34 Ga0070661_100294596 3300005344 Bacteria 1262
35 Ga0070668_100066756 3300005347 Unclassified 2792
36 Ga0070668_100082221 3300005347 Bacteria 2526
37 Ga0070668_100113109 3300005347 Unclassified 2162
38 Ga0070669_100007136 3300005353 Bacteria 8028
39 Ga0070675_100048606 3300005354 Unclassified 3479
40 Ga0070675_100056126 3300005354 Bacteria 3244
41 Ga0070675_100216290 3300005354 Bacteria 1667
42 Ga0070671_100016180 3300005355 Bacteria 6031
43 Ga0070674_100138212 3300005356 Bacteria 1825
44 Ga0070674_100183811 3300005356 Bacteria 1603
45 Ga0070674_100293074 3300005356 Bacteria 1294
46 Ga0070673_100055911 3300005364 Bacteria 3111
47 Ga0070673_100079875 3300005364 Bacteria 2649
48 Ga0070673_100353024 3300005364 Bacteria 1305
49 Ga0070688_100007682 3300005365 Bacteria 5823
50 Ga0070688_100071299 3300005365 Unclassified 2224
51 Ga0070688_100098389 3300005365 Bacteria 1924
52 Ga0070688_100430472 3300005365 Bacteria 982
53 Ga0070667_100026671 3300005367 Bacteria 4806
54 Ga0070667_100040616 3300005367 Unclassified 3901
55 Ga0070667_100133451 3300005367 Unclassified 2169
56 Ga0070701_10264728 3300005438 Bacteria 1043
57 Ga0070701_10397038 3300005438 Bacteria 873
58 Ga0070678_100021957 3300005456 Unclassified 4218
59 Ga0070678_100115357 3300005456 Bacteria 2108
60 Ga0070662_100012145 3300005457 Bacteria 5703
61 Ga0070662_100025669 3300005457 Unclassified 4071
62 Ga0070662_100094511 3300005457 Unclassified 2251
63 Ga0070662_100355732 3300005457 Bacteria 1201
64 Ga0068867_100041400 3300005459 Unclassified 3367
65 Ga0070685_10039716 3300005466 Bacteria 2675
66 Ga0070698_100808854 3300005471 Bacteria 881
67 Ga0070699_100636954 3300005518 Bacteria 973
68 Ga0068853_100145992 3300005539 Unclassified 2126
69 Ga0068853_100149457 3300005539 Bacteria 2102
70 Ga0070672_100021559 3300005543 Bacteria 4717
71 Ga0070672_100057987 3300005543 Bacteria 3041
72 Ga0070672_100068035 3300005543 Bacteria 2824
73 Ga0070686_100041074 3300005544 Bacteria 2889
74 Ga0070686_100192369 3300005544 Bacteria 1457
75 Ga0070665_100044251 3300005548 Bacteria 4471
76 Ga0070665_100057343 3300005548 Bacteria 3904
77 Ga0070665_100084391 3300005548 Bacteria 3182
78 Ga0070664_100037374 3300005564 Bacteria 4083
79 Ga0070664_100055716 3300005564 Bacteria 3358
80 Ga0070664_100080774 3300005564 Unclassified 2801
81 Ga0068857_100014487 3300005577 Bacteria 6878
82 Ga0068857_100057896 3300005577 Unclassified 3440
83 Ga0068857_100416664 3300005577 Bacteria 1252
84 Ga0068854_100010322 3300005578 Bacteria 6051
85 Ga0068854_100036530 3300005578 Bacteria 3445
86 Ga0068852_100659639 3300005616 Bacteria 1054
87 Ga0068859_100013479 3300005617 Bacteria 8198
88 Ga0068859_100041628 3300005617 Bacteria 4614
89 Ga0068859_100140286 3300005617 Bacteria 2490
90 Ga0068859_100165289 3300005617 Bacteria 2293
91 Ga0068859_100472469 3300005617 Bacteria 1349
92 Ga0068864_100004849 3300005618 Bacteria 11019
93 Ga0068864_100016665 3300005618 Bacteria 6123
94 Ga0068864_100191704 3300005618 Unclassified 1874
95 Ga0068864_100362228 3300005618 Bacteria 1370
96 Ga0068866_10005608 3300005718 Bacteria 5194
97 Ga0068861_100045806 3300005719 Bacteria 3295
98 Ga0068870_10020763 3300005840 Unclassified 3204
99 Ga0068870_10066415 3300005840 Unclassified 1953
100 Ga0068863_100155403 3300005841 Bacteria 2190
101 Ga0068863_100245516 3300005841 Bacteria 1729
102 Ga0068858_100002187 3300005842 Bacteria 19799
103 Ga0068860_100007697 3300005843 Bacteria 10771
104 Ga0068860_100055073 3300005843 Bacteria 3780
105 Ga0068860_100606622 3300005843 Unclassified 1100
106 Ga0068862_100246565 3300005844 Bacteria 1626
107 Ga0097621_100154937 3300006237 Bacteria 1966
108 Ga0097621_100393046 3300006237 Bacteria 1240
109 Ga0068871_100037164 3300006358 Unclassified 3882
110 Ga0068871_100588792 3300006358 Bacteria 1011
111 Ga0075428_100302710 3300006844 Bacteria 1719
112 Ga0075434_100314853 3300006871 Bacteria 1586
113 Ga0068865_100026090 3300006881 Bacteria 3850
114 Ga0068865_100057981 3300006881 Bacteria 2703
115 Ga0068865_100127783 3300006881 Bacteria 1900
116 Ga0068865_100448585 3300006881 Bacteria 1066
117 Ga0097620_100013479 3300006931 Bacteria 8198
118 Ga0097620_100041624 3300006931 Bacteria 4614
119 Ga0097620_100140291 3300006931 Bacteria 2490
120 Ga0097620_100165290 3300006931 Bacteria 2293
121 Ga0097620_100472450 3300006931 Bacteria 1349
122 Ga0111539_10035043 3300009094 Bacteria 6078
123 Ga0105247_10002404 3300009101 Bacteria 12733
124 Ga0105247_10028949 3300009101 Bacteria 3353
125 Ga0105242_10049260 3300009176 Unclassified 3428
126 Ga0105242_10054380 3300009176 Unclassified 3272
127 Ga0105242_10570908 3300009176 Unclassified 1088
128 Ga0105242_10729167 3300009176 Bacteria 973
129 Ga0105238_10831703 3300009551 Bacteria 940
130 Ga0105249_10001273 3300009553 Bacteria 22114
131 Ga0105249_10048871 3300009553 Bacteria 3857
132 Ga0105249_10065359 3300009553 Unclassified 3346
133 Ga0105249_10139255 3300009553 Bacteria 2325
134 Ga0105249_10174019 3300009553 Unclassified 2090
135 Ga0105249_10176613 3300009553 Unclassified 2075
136 Ga0105239_10280893 3300010375 Unclassified 1874
137 Ga0105239_10678874 3300010375 Bacteria 1177
138 Ga0105246_10196000 3300011119 Bacteria 1567
139 Ga0105246_10226523 3300011119 Bacteria 1469
140 Ga0157374_10005464 3300013296 Bacteria 10669
141 Ga0157374_10016930 3300013296 Bacteria 6416
142 Ga0157374_10068910 3300013296 Bacteria 3329
143 Ga0157378_10012126 3300013297 Bacteria 7549
144 Ga0157378_10268307 3300013297 Bacteria 1640
145 Ga0157378_10597891 3300013297 Bacteria 1114
146 Ga0163162_10077487 3300013306 Bacteria 3388
147 Ga0163162_10081373 3300013306 Unclassified 3309
148 Ga0163162_10188449 3300013306 Bacteria 2190
149 Ga0163162_10264248 3300013306 Bacteria 1852
150 Ga0163162_10408324 3300013306 Bacteria 1491
151 Ga0163162_10707534 3300013306 Bacteria 1129
152 Ga0163162_11042914 3300013306 Bacteria 925
153 Ga0163162_11049713 3300013306 Bacteria 922
154 Ga0157372_10370900 3300013307 Unclassified 1668
155 Ga0157372_10397662 3300013307 Bacteria 1606
156 Ga0157375_10005062 3300013308 Bacteria 11440
157 Ga0157375_10042742 3300013308 Bacteria 4389
158 Ga0157375_10120251 3300013308 Unclassified 2735
159 Ga0157375_10331760 3300013308 Bacteria 1686
160 Ga0163163_10003207 3300014325 Bacteria 13858
161 Ga0163163_10026468 3300014325 Bacteria 5545
162 Ga0163163_10628986 3300014325 Bacteria 1137
163 Ga0163163_10654635 3300014325 Bacteria 1114
164 Ga0157380_10006006 3300014326 Bacteria 8501
165 Ga0157377_10156982 3300014745 Bacteria 1411
166 Ga0157379_10010876 3300014968 Bacteria 7931
167 Ga0157379_10027481 3300014968 Bacteria 5066
168 Ga0157376_10036540 3300014969 Unclassified 3980
169 Ga0157376_10044415 3300014969 Bacteria 3653
170 Ga0157376_11034807 3300014969 Bacteria 845
171 Ga0163161_10015865 3300017792 Bacteria 5255
172 Ga0207697_10017874 3300025315 Bacteria 2911
173 Ga0207697_10023892 3300025315 Bacteria 2503
174 Ga0207697_10062759 3300025315 Bacteria 1548
175 Ga0207642_10193358 3300025899 Bacteria 1118
176 Ga0207680_10040922 3300025903 Unclassified 2701
177 Ga0207680_10058477 3300025903 Unclassified 2336
178 Ga0207645_10003291 3300025907 Bacteria 12324
179 Ga0207645_10013173 3300025907 Bacteria 5581
180 Ga0207645_10084893 3300025907 Bacteria 2032
181 Ga0207643_10024072 3300025908 Unclassified 3360
182 Ga0207643_10441783 3300025908 Unclassified 827
183 Ga0207705_10069266 3300025909 Bacteria 2555
184 Ga0207662_10013369 3300025918 Bacteria 4590
185 Ga0207662_10148467 3300025918 Bacteria 1489
186 Ga0207649_10066114 3300025920 Bacteria 2291
187 Ga0207649_10244332 3300025920 Bacteria 1290
188 Ga0207681_10011555 3300025923 Bacteria 5425
189 Ga0207681_10119384 3300025923 Unclassified 1931
190 Ga0207681_10242051 3300025923 Bacteria 1405
191 Ga0207650_10039563 3300025925 Bacteria 3445
192 Ga0207650_10296203 3300025925 Bacteria 1320
193 Ga0207659_10020656 3300025926 Bacteria 4356
194 Ga0207659_10020665 3300025926 Bacteria 4356
195 Ga0207644_10044787 3300025931 Unclassified 3145
196 Ga0207706_10003305 3300025933 Bacteria 15441
197 Ga0207706_10004710 3300025933 Bacteria 12777
198 Ga0207706_10016902 3300025933 Bacteria 6581
199 Ga0207706_10021468 3300025933 Bacteria 5799
200 Ga0207686_10009672 3300025934 Bacteria 5236
201 Ga0207670_10062703 3300025936 Bacteria 2541
202 Ga0207670_10377399 3300025936 Bacteria 1128
203 Ga0207669_10009238 3300025937 Bacteria 4682
204 Ga0207669_10206049 3300025937 Bacteria 1432
205 Ga0207704_10028693 3300025938 Bacteria 3091
206 Ga0207691_10036183 3300025940 Bacteria 4574
207 Ga0207691_10074580 3300025940 Bacteria 3060
208 Ga0207691_10101704 3300025940 Bacteria 2564
209 Ga0207689_10009237 3300025942 Bacteria 8527
210 Ga0207689_10036579 3300025942 Bacteria 4075
211 Ga0207689_10051114 3300025942 Bacteria 3407
212 Ga0207689_10055997 3300025942 Unclassified 3245
213 Ga0207689_10068331 3300025942 Bacteria 2920
214 Ga0207689_10071190 3300025942 Bacteria 2856
215 Ga0207689_10191455 3300025942 Bacteria 1688
216 Ga0207661_10008708 3300025944 Bacteria 7254
217 Ga0207661_10068988 3300025944 Bacteria 2881
218 Ga0207679_10036929 3300025945 Unclassified 3469
219 Ga0207679_10039911 3300025945 Bacteria 3356
220 Ga0207679_10310426 3300025945 Bacteria 1362
221 Ga0207679_10681406 3300025945 Unclassified 932
222 Ga0207651_10039270 3300025960 Bacteria 3120
223 Ga0207651_10043632 3300025960 Bacteria 2995
224 Ga0207712_10025151 3300025961 Unclassified 3953
225 Ga0207712_10070474 3300025961 Bacteria 2512
226 Ga0207712_10142904 3300025961 Unclassified 1839
227 Ga0207668_10000514 3300025972 Bacteria 24251
228 Ga0207668_10033078 3300025972 Bacteria 3423
229 Ga0207640_10020254 3300025981 Unclassified 3948
230 Ga0207640_10064629 3300025981 Bacteria 2437
231 Ga0207658_10551866 3300025986 Bacteria 1031
232 Ga0207677_10006073 3300026023 Bacteria 6590
233 Ga0207677_10006916 3300026023 Bacteria 6235
234 Ga0207677_10020872 3300026023 Unclassified 3990
235 Ga0207677_10167263 3300026023 Bacteria 1715
236 Ga0207677_10214204 3300026023 Bacteria 1540
237 Ga0207703_10331129 3300026035 Bacteria 1397
238 Ga0207639_10006113 3300026041 Bacteria 8170
239 Ga0207639_10147356 3300026041 Bacteria 1968
240 Ga0207678_10007078 3300026067 Bacteria 9954
241 Ga0207708_10161800 3300026075 Bacteria 1768
242 Ga0207641_10006788 3300026088 Bacteria 9591
243 Ga0207641_10093542 3300026088 Bacteria 2635
244 Ga0207641_10132355 3300026088 Bacteria 2241
245 Ga0207648_10001955 3300026089 Bacteria 22528
246 Ga0207648_10005292 3300026089 Bacteria 13021
247 Ga0207648_10013552 3300026089 Bacteria 7579
248 Ga0207648_10023550 3300026089 Bacteria 5513
249 Ga0207648_10220954 3300026089 Bacteria 1684
250 Ga0207676_10018120 3300026095 Bacteria 5113
251 Ga0207676_10137845 3300026095 Bacteria 2085
252 Ga0207676_10309312 3300026095 Bacteria 1446
253 Ga0207676_10340037 3300026095 Bacteria 1384
254 Ga0207674_10010543 3300026116 Bacteria 10459
255 Ga0207674_10033431 3300026116 Bacteria 5384
256 Ga0207674_10472237 3300026116 Bacteria 1212
257 Ga0207675_100000282 3300026118 Bacteria 48883
258 Ga0207683_10003845 3300026121 Bacteria 13020
259 Ga0207683_10062288 3300026121 Bacteria 3285
260 Ga0207683_10142135 3300026121 Bacteria 2163
261 Ga0207698_10037438 3300026142 Bacteria 3573
262 Ga0207698_10438310 3300026142 Bacteria 1258
263 Ga0207428_10137684 3300027907 Bacteria 1866
264 Ga0268266_10006796 3300028379 Bacteria 10422
265 Ga0268266_10044619 3300028379 Bacteria 3790
266 Ga0268266_10074515 3300028379 Bacteria 2947
267 Ga0268265_10237330 3300028380 Bacteria 1606
268 Ga0268265_10290055 3300028380 Bacteria 1468
269 Ga0268265_10340578 3300028380 Bacteria 1365
270 Ga0268265_10784983 3300028380 Bacteria 927
271 Ga0268264_10020188 3300028381 Bacteria 5445
272 Ga0268264_10039119 3300028381 Unclassified 3918
273 Ga0268264_10169765 3300028381 Bacteria 1972
274 Ga0268264_10326036 3300028381 Unclassified 1454
275 Ga0307516_10328090 3300031730 Bacteria 1200
276 Ga0307406_10020465 3300031901 Bacteria 3897
277 Ga0307414_10183138 3300032004 Unclassified 1687
278 Ga0373947_0047778 3300035725 Unclassified 2566
279 Ga0373925_0169786 3300037068 Bacteria 1722
280 Ga0395905_0112701 3300037471 Bacteria 2555
281 Ga0451807_0453552 3300041486 Unclassified 884
282 Ga0439449_0023320 3300042007 Bacteria 2315
283 Ga0450899_002200 3300042135 Unclassified 2120
284 Ga0439434_0014251 3300042435 Bacteria 2365
285 Ga0439434_0108665 3300042435 Bacteria 897
286 Ga0466972_0000057 3300044658 Bacteria 110775
287 Ga0466968_0022550 3300044735 Bacteria 2559
288 Ga0466970_0000465 3300044765 Bacteria 20048
289 Ga0495638_0202165 3300046460 Unclassified 1121
290 Ga0495650_0006071 3300046471 Bacteria 7626
291 Ga0495668_0002514 3300046616 Bacteria 14989
292 Ga0495611_0058551 3300046648 Bacteria 1747
293 Ga0495672_0066379 3300047320 Bacteria 2059
294 Ga0495686_0017483 3300047472 Bacteria 4829
295 Ga0495686_0080871 3300047472 Bacteria 1985
296 Ga0496110_0018045 3300048913 Bacteria 5911
297 Ga0496111_0135025 3300048914 Bacteria 1827
298 Ga0496111_0167364 3300048914 Bacteria 1633
299 Ga0501292_006298 3300049515 Bacteria 1682
300 Ga0501296_009408 3300049519 Bacteria 1145
301 Ga0501298_001651 3300049521 Bacteria 3303
302 Ga0501032_0004878 3300049569 Bacteria 10041
303 Ga0501034_0018637 3300049571 Bacteria 7115
304 Ga0501038_0038821 3300049574 Bacteria 4168
305 Ga0501039_0104500 3300049575 Unclassified 2211
306 Ga0501043_0002067 3300049579 Bacteria 17117
307 Ga0501046_0021125 3300049580 Bacteria 5375
308 Ga0501048_0137115 3300049582 Bacteria 1729
309 Ga0501067_0040003 3300049583 Bacteria 2604
310 Ga0501074_0002102 3300049590 Bacteria 13745
311 Ga0501223_002911 3300049663 Bacteria 3754
312 Ga0501235_000348 3300049669 Bacteria 8836
313 Ga0501257_019547 3300049686 Bacteria 1585
314 Ga0501259_000182 3300049688 Bacteria 9516
315 Ga0501261_001781 3300049690 Bacteria 2654
316 Ga0501221_000013 3300049704 Bacteria 22152
317 Ga0501234_016108 3300049707 Bacteria 1179
318 Ga0501245_000480 3300049708 Bacteria 4850
319 Ga0501079_0036433 3300049741 Bacteria 3790
320 Ga0501080_0394563 3300049742 Unclassified 1245
321 Ga0501080_0484797 3300049742 Bacteria 1106
322 Ga0501035_0001762 3300049822 Bacteria 21856
323 Ga0501044_0003029 3300049823 Bacteria 19020
324 Ga0501044_0042014 3300049823 Unclassified 4759
325 nmdc:mga0k408_23872_c1 3300050493 Bacteria 3454
326 nmdc:mga08y16_241684_c1 3300050511 Bacteria 1866
327 nmdc:mga08y16_30941_c1 3300050511 Bacteria 5628
328 nmdc:mga0n895_1071379_c1 3300050512 Bacteria 784
329 nmdc:mga0n895_387970_c1 3300050512 Bacteria 1413
330 Ga0500646_0004373 3300053090 Bacteria 3575
331 Ga0500646_0016975 3300053090 Bacteria 1905
332 Ga0500583_0005082 3300053092 Bacteria 4366
333 Ga0500641_0163043 3300053096 Unclassified 961
334 Ga0500568_0000080 3300053139 Bacteria 92694
335 Ga0500616_0026950 3300053153 Unclassified 3176
336 Ga0500616_0061576 3300053153 Bacteria 1942
337 Ga0500611_000003 3300053727 Bacteria 333431
338 Ga0500645_018311 3300053730 Bacteria 2188
339 Ga0501084_0110107 3300054114 Bacteria 2314

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005337 Ga0070682_100000041 Ga0070682_100000041119 213
2 3300053096 Ga0500641_0163043 Ga0500641_0163043_164_823 215
3 3300005544 Ga0070686_100192369 Ga0070686_1001923691 218
4 3300003322 rootL2_10192219 rootL2_101922191 220
5 3300005334 Ga0068869_100017592 Ga0068869_1000175926 221
6 3300005354 Ga0070675_100216290 Ga0070675_1002162903 221
7 3300005365 Ga0070688_100430472 Ga0070688_1004304721 221
8 3300005518 Ga0070699_100636954 Ga0070699_1006369541 221
9 3300005617 Ga0068859_100041628 Ga0068859_1000416282 221
10 3300006931 Ga0097620_100041624 Ga0097620_1000416242 221
11 3300025942 Ga0207689_10071190 Ga0207689_100711903 221
12 3300026075 Ga0207708_10161800 Ga0207708_101618002 221
13 3300026089 Ga0207648_10023550 Ga0207648_100235506 230
14 3300047472 Ga0495686_0017483 Ga0495686_0017483_4056_4760 230
15 3300047472 Ga0495686_0080871 Ga0495686_0080871_800_1504 230
16 3300050493 nmdc:mga0k408_23872_c1 nmdc:mga0k408_23872_c1_499_1203 230
17 3300025940 Ga0207691_10074580 Ga0207691_100745804 231
18 3300026121 Ga0207683_10142135 Ga0207683_101421351 231
19 3300042435 Ga0439434_0108665 Ga0439434_0108665_175_882 231
20 3300044658 Ga0466972_0000057 Ga0466972_0000057_2844_3548 231
21 3300044735 Ga0466968_0022550 Ga0466968_0022550_335_1048 231
22 3300044765 Ga0466970_0000465 Ga0466970_0000465_677_1381 231
23 3300046616 Ga0495668_0002514 Ga0495668_0002514_6100_6813 231
24 3300049742 Ga0501080_0484797 Ga0501080_0484797_288_992 231
25 3300049823 Ga0501044_0042014 Ga0501044_0042014_320_1024 231
26 3300053090 Ga0500646_0004373 Ga0500646_0004373_2066_2779 231
27 3300053092 Ga0500583_0005082 Ga0500583_0005082_144_857 231
28 3300053139 Ga0500568_0000080 Ga0500568_0000080_6544_7248 231
29 3300053153 Ga0500616_0026950 Ga0500616_0026950_634_1338 231
30 3300053730 Ga0500645_018311 Ga0500645_018311_1184_1888 231
31 3300000043 ARcpr5yngRDRAFT_c004685 ARcpr5yngRDRAFT_0046851 232
32 3300003323 rootH1_10359371 rootH1_103593713 232
33 3300005327 Ga0070658_10091086 Ga0070658_100910862 232
34 3300005328 Ga0070676_10012693 Ga0070676_100126932 232
35 3300005328 Ga0070676_10020237 Ga0070676_100202373 232
36 3300005328 Ga0070676_10025860 Ga0070676_100258605 232
37 3300005328 Ga0070676_10029554 Ga0070676_100295543 232
38 3300005328 Ga0070676_10075528 Ga0070676_100755282 232
39 3300005328 Ga0070676_10093846 Ga0070676_100938462 232
40 3300005329 Ga0070683_100151483 Ga0070683_1001514833 232
41 3300005330 Ga0070690_100004226 Ga0070690_1000042269 232
42 3300005330 Ga0070690_100227534 Ga0070690_1002275342 232
43 3300005331 Ga0070670_100019716 Ga0070670_1000197165 232
44 3300005331 Ga0070670_100023427 Ga0070670_1000234276 232
45 3300005331 Ga0070670_100129578 Ga0070670_1001295784 232
46 3300005331 Ga0070670_100280165 Ga0070670_1002801652 232
47 3300005331 Ga0070670_100628606 Ga0070670_1006286062 232
48 3300005334 Ga0068869_100003891 Ga0068869_1000038919 232
49 3300005334 Ga0068869_100018954 Ga0068869_1000189547 232
50 3300005334 Ga0068869_100020358 Ga0068869_1000203584 232
51 3300005334 Ga0068869_100049524 Ga0068869_1000495242 232
52 3300005334 Ga0068869_100056615 Ga0068869_1000566154 232
53 3300005335 Ga0070666_10112077 Ga0070666_101120774 232
54 3300005338 Ga0068868_100022712 Ga0068868_1000227125 232
55 3300005338 Ga0068868_100037694 Ga0068868_1000376944 232
56 3300005338 Ga0068868_100124825 Ga0068868_1001248252 232
57 3300005338 Ga0068868_100195471 Ga0068868_1001954712 232
58 3300005340 Ga0070689_100020841 Ga0070689_1000208418 232
59 3300005343 Ga0070687_100061703 Ga0070687_1000617032 232
60 3300005343 Ga0070687_100113302 Ga0070687_1001133023 232
61 3300005344 Ga0070661_100294596 Ga0070661_1002945962 232
62 3300005347 Ga0070668_100066756 Ga0070668_1000667562 232
63 3300005347 Ga0070668_100082221 Ga0070668_1000822213 232
64 3300005347 Ga0070668_100113109 Ga0070668_1001131094 232
65 3300005353 Ga0070669_100007136 Ga0070669_1000071363 232
66 3300005354 Ga0070675_100048606 Ga0070675_1000486062 232
67 3300005354 Ga0070675_100056126 Ga0070675_1000561266 232
68 3300005355 Ga0070671_100016180 Ga0070671_1000161806 232
69 3300005356 Ga0070674_100138212 Ga0070674_1001382122 232
70 3300005356 Ga0070674_100183811 Ga0070674_1001838111 232
71 3300005356 Ga0070674_100293074 Ga0070674_1002930742 232
72 3300005364 Ga0070673_100055911 Ga0070673_1000559112 232
73 3300005364 Ga0070673_100079875 Ga0070673_1000798753 232
74 3300005364 Ga0070673_100353024 Ga0070673_1003530243 232
75 3300005365 Ga0070688_100007682 Ga0070688_1000076826 232
76 3300005365 Ga0070688_100071299 Ga0070688_1000712993 232
77 3300005365 Ga0070688_100098389 Ga0070688_1000983892 232
78 3300005367 Ga0070667_100026671 Ga0070667_1000266713 232
79 3300005367 Ga0070667_100040616 Ga0070667_1000406165 232
80 3300005367 Ga0070667_100133451 Ga0070667_1001334514 232
81 3300005438 Ga0070701_10264728 Ga0070701_102647282 232
82 3300005438 Ga0070701_10397038 Ga0070701_103970381 232
83 3300005456 Ga0070678_100021957 Ga0070678_1000219573 232
84 3300005456 Ga0070678_100115357 Ga0070678_1001153573 232
85 3300005457 Ga0070662_100012145 Ga0070662_1000121457 232
86 3300005457 Ga0070662_100025669 Ga0070662_1000256696 232
87 3300005457 Ga0070662_100094511 Ga0070662_1000945114 232
88 3300005457 Ga0070662_100355732 Ga0070662_1003557321 232
89 3300005459 Ga0068867_100041400 Ga0068867_1000414004 232
90 3300005466 Ga0070685_10039716 Ga0070685_100397162 232
91 3300005471 Ga0070698_100808854 Ga0070698_1008088541 232
92 3300005539 Ga0068853_100145992 Ga0068853_1001459922 232
93 3300005539 Ga0068853_100149457 Ga0068853_1001494573 232
94 3300005543 Ga0070672_100021559 Ga0070672_1000215594 232
95 3300005543 Ga0070672_100057987 Ga0070672_1000579875 232
96 3300005543 Ga0070672_100068035 Ga0070672_1000680352 232
97 3300005544 Ga0070686_100041074 Ga0070686_1000410742 232
98 3300005548 Ga0070665_100044251 Ga0070665_1000442512 232
99 3300005548 Ga0070665_100057343 Ga0070665_1000573437 232
100 3300005548 Ga0070665_100084391 Ga0070665_1000843913 232
101 3300005564 Ga0070664_100037374 Ga0070664_1000373745 232
102 3300005564 Ga0070664_100055716 Ga0070664_1000557165 232
103 3300005564 Ga0070664_100080774 Ga0070664_1000807744 232
104 3300005577 Ga0068857_100014487 Ga0068857_1000144874 232
105 3300005577 Ga0068857_100057896 Ga0068857_1000578962 232
106 3300005577 Ga0068857_100416664 Ga0068857_1004166642 232
107 3300005578 Ga0068854_100010322 Ga0068854_1000103223 232
108 3300005578 Ga0068854_100036530 Ga0068854_1000365302 232
109 3300005616 Ga0068852_100659639 Ga0068852_1006596392 232
110 3300005617 Ga0068859_100013479 Ga0068859_1000134798 232
111 3300005617 Ga0068859_100140286 Ga0068859_1001402864 232
112 3300005617 Ga0068859_100165289 Ga0068859_1001652893 232
113 3300005617 Ga0068859_100472469 Ga0068859_1004724692 232
114 3300005618 Ga0068864_100004849 Ga0068864_10000484910 232
115 3300005618 Ga0068864_100016665 Ga0068864_1000166659 232
116 3300005618 Ga0068864_100191704 Ga0068864_1001917041 232
117 3300005618 Ga0068864_100362228 Ga0068864_1003622283 232
118 3300005718 Ga0068866_10005608 Ga0068866_100056083 232
119 3300005719 Ga0068861_100045806 Ga0068861_1000458064 232
120 3300005840 Ga0068870_10020763 Ga0068870_100207633 232
121 3300005840 Ga0068870_10066415 Ga0068870_100664152 232
122 3300005841 Ga0068863_100155403 Ga0068863_1001554034 232
123 3300005841 Ga0068863_100245516 Ga0068863_1002455164 232
124 3300005842 Ga0068858_100002187 Ga0068858_10000218717 232
125 3300005843 Ga0068860_100007697 Ga0068860_1000076977 232
126 3300005843 Ga0068860_100055073 Ga0068860_1000550736 232
127 3300005843 Ga0068860_100606622 Ga0068860_1006066222 232
128 3300005844 Ga0068862_100246565 Ga0068862_1002465653 232
129 3300006237 Ga0097621_100154937 Ga0097621_1001549372 232
130 3300006237 Ga0097621_100393046 Ga0097621_1003930463 232
131 3300006358 Ga0068871_100037164 Ga0068871_1000371643 232
132 3300006358 Ga0068871_100588792 Ga0068871_1005887921 232
133 3300006844 Ga0075428_100302710 Ga0075428_1003027102 232
134 3300006871 Ga0075434_100314853 Ga0075434_1003148531 232
135 3300006881 Ga0068865_100026090 Ga0068865_1000260903 232
136 3300006881 Ga0068865_100057981 Ga0068865_1000579814 232
137 3300006881 Ga0068865_100127783 Ga0068865_1001277833 232
138 3300006881 Ga0068865_100448585 Ga0068865_1004485852 232
139 3300006931 Ga0097620_100013479 Ga0097620_1000134798 232
140 3300006931 Ga0097620_100140291 Ga0097620_1001402913 232
141 3300006931 Ga0097620_100165290 Ga0097620_1001652903 232
142 3300006931 Ga0097620_100472450 Ga0097620_1004724503 232
143 3300009094 Ga0111539_10035043 Ga0111539_100350433 232
144 3300009101 Ga0105247_10002404 Ga0105247_100024044 232
145 3300009101 Ga0105247_10028949 Ga0105247_100289493 232
146 3300009176 Ga0105242_10049260 Ga0105242_100492604 232
147 3300009176 Ga0105242_10054380 Ga0105242_100543804 232
148 3300009176 Ga0105242_10570908 Ga0105242_105709081 232
149 3300009176 Ga0105242_10729167 Ga0105242_107291671 232
150 3300009551 Ga0105238_10831703 Ga0105238_108317031 232
151 3300009553 Ga0105249_10001273 Ga0105249_1000127319 232
152 3300009553 Ga0105249_10048871 Ga0105249_100488713 232
153 3300009553 Ga0105249_10065359 Ga0105249_100653595 232
154 3300009553 Ga0105249_10139255 Ga0105249_101392553 232
155 3300009553 Ga0105249_10174019 Ga0105249_101740193 232
156 3300009553 Ga0105249_10176613 Ga0105249_101766133 232
157 3300010375 Ga0105239_10280893 Ga0105239_102808933 232
158 3300010375 Ga0105239_10678874 Ga0105239_106788742 232
159 3300011119 Ga0105246_10196000 Ga0105246_101960003 232
160 3300011119 Ga0105246_10226523 Ga0105246_102265232 232
161 3300013296 Ga0157374_10005464 Ga0157374_1000546410 232
162 3300013296 Ga0157374_10016930 Ga0157374_100169304 232
163 3300013296 Ga0157374_10068910 Ga0157374_100689102 232
164 3300013297 Ga0157378_10012126 Ga0157378_100121267 232
165 3300013297 Ga0157378_10268307 Ga0157378_102683072 232
166 3300013297 Ga0157378_10597891 Ga0157378_105978911 232
167 3300013306 Ga0163162_10077487 Ga0163162_100774872 232
168 3300013306 Ga0163162_10081373 Ga0163162_100813732 232
169 3300013306 Ga0163162_10188449 Ga0163162_101884494 232
170 3300013306 Ga0163162_10264248 Ga0163162_102642482 232
171 3300013306 Ga0163162_10408324 Ga0163162_104083242 232
172 3300013306 Ga0163162_10707534 Ga0163162_107075341 232
173 3300013306 Ga0163162_11042914 Ga0163162_110429141 232
174 3300013306 Ga0163162_11049713 Ga0163162_110497131 232
175 3300013307 Ga0157372_10370900 Ga0157372_103709003 232
176 3300013307 Ga0157372_10397662 Ga0157372_103976623 232
177 3300013308 Ga0157375_10005062 Ga0157375_1000506210 232
178 3300013308 Ga0157375_10042742 Ga0157375_100427423 232
179 3300013308 Ga0157375_10120251 Ga0157375_101202512 232
180 3300013308 Ga0157375_10331760 Ga0157375_103317604 232
181 3300014325 Ga0163163_10003207 Ga0163163_100032079 232
182 3300014325 Ga0163163_10026468 Ga0163163_100264682 232
183 3300014325 Ga0163163_10628986 Ga0163163_106289863 232
184 3300014325 Ga0163163_10654635 Ga0163163_106546352 232
185 3300014326 Ga0157380_10006006 Ga0157380_100060066 232
186 3300014745 Ga0157377_10156982 Ga0157377_101569822 232
187 3300014968 Ga0157379_10010876 Ga0157379_100108768 232
188 3300014968 Ga0157379_10027481 Ga0157379_100274817 232
189 3300014969 Ga0157376_10036540 Ga0157376_100365404 232
190 3300014969 Ga0157376_10044415 Ga0157376_100444152 232
191 3300014969 Ga0157376_11034807 Ga0157376_110348071 232
192 3300017792 Ga0163161_10015865 Ga0163161_100158656 232
193 3300025315 Ga0207697_10017874 Ga0207697_100178742 232
194 3300025315 Ga0207697_10023892 Ga0207697_100238923 232
195 3300025315 Ga0207697_10062759 Ga0207697_100627593 232
196 3300025899 Ga0207642_10193358 Ga0207642_101933582 232
197 3300025903 Ga0207680_10040922 Ga0207680_100409224 232
198 3300025903 Ga0207680_10058477 Ga0207680_100584773 232
199 3300025907 Ga0207645_10003291 Ga0207645_100032913 232
200 3300025907 Ga0207645_10013173 Ga0207645_100131734 232
201 3300025907 Ga0207645_10084893 Ga0207645_100848932 232
202 3300025908 Ga0207643_10024072 Ga0207643_100240724 232
203 3300025908 Ga0207643_10441783 Ga0207643_104417832 232
204 3300025909 Ga0207705_10069266 Ga0207705_100692663 232
205 3300025918 Ga0207662_10013369 Ga0207662_100133694 232
206 3300025918 Ga0207662_10148467 Ga0207662_101484672 232
207 3300025920 Ga0207649_10066114 Ga0207649_100661143 232
208 3300025920 Ga0207649_10244332 Ga0207649_102443322 232
209 3300025923 Ga0207681_10011555 Ga0207681_100115557 232
210 3300025923 Ga0207681_10119384 Ga0207681_101193844 232
211 3300025923 Ga0207681_10242051 Ga0207681_102420513 232
212 3300025925 Ga0207650_10039563 Ga0207650_100395634 232
213 3300025925 Ga0207650_10296203 Ga0207650_102962031 232
214 3300025926 Ga0207659_10020656 Ga0207659_100206563 232
215 3300025926 Ga0207659_10020665 Ga0207659_100206653 232
216 3300025931 Ga0207644_10044787 Ga0207644_100447874 232
217 3300025933 Ga0207706_10003305 Ga0207706_100033057 232
218 3300025933 Ga0207706_10004710 Ga0207706_100047101 232
219 3300025933 Ga0207706_10016902 Ga0207706_100169029 232
220 3300025933 Ga0207706_10021468 Ga0207706_100214682 232
221 3300025934 Ga0207686_10009672 Ga0207686_100096724 232
222 3300025936 Ga0207670_10062703 Ga0207670_100627033 232
223 3300025936 Ga0207670_10377399 Ga0207670_103773992 232
224 3300025937 Ga0207669_10009238 Ga0207669_100092382 232
225 3300025937 Ga0207669_10206049 Ga0207669_102060491 232
226 3300025938 Ga0207704_10028693 Ga0207704_100286933 232
227 3300025940 Ga0207691_10036183 Ga0207691_100361832 232
228 3300025940 Ga0207691_10101704 Ga0207691_101017042 232
229 3300025942 Ga0207689_10009237 Ga0207689_100092378 232
230 3300025942 Ga0207689_10036579 Ga0207689_100365797 232
231 3300025942 Ga0207689_10051114 Ga0207689_100511142 232
232 3300025942 Ga0207689_10055997 Ga0207689_100559974 232
233 3300025942 Ga0207689_10068331 Ga0207689_100683314 232
234 3300025942 Ga0207689_10191455 Ga0207689_101914552 232
235 3300025944 Ga0207661_10008708 Ga0207661_100087081 232
236 3300025944 Ga0207661_10068988 Ga0207661_100689884 232
237 3300025945 Ga0207679_10036929 Ga0207679_100369294 232
238 3300025945 Ga0207679_10039911 Ga0207679_100399111 232
239 3300025945 Ga0207679_10310426 Ga0207679_103104263 232
240 3300025945 Ga0207679_10681406 Ga0207679_106814061 232
241 3300025960 Ga0207651_10039270 Ga0207651_100392702 232
242 3300025960 Ga0207651_10043632 Ga0207651_100436325 232
243 3300025961 Ga0207712_10025151 Ga0207712_100251512 232
244 3300025961 Ga0207712_10070474 Ga0207712_100704743 232
245 3300025961 Ga0207712_10142904 Ga0207712_101429041 232
246 3300025972 Ga0207668_10000514 Ga0207668_1000051414 232
247 3300025972 Ga0207668_10033078 Ga0207668_100330783 232
248 3300025981 Ga0207640_10020254 Ga0207640_100202543 232
249 3300025981 Ga0207640_10064629 Ga0207640_100646292 232
250 3300025986 Ga0207658_10551866 Ga0207658_105518661 232
251 3300026023 Ga0207677_10006073 Ga0207677_100060739 232
252 3300026023 Ga0207677_10006916 Ga0207677_100069164 232
253 3300026023 Ga0207677_10020872 Ga0207677_100208725 232
254 3300026023 Ga0207677_10167263 Ga0207677_101672632 232
255 3300026023 Ga0207677_10214204 Ga0207677_102142043 232
256 3300026035 Ga0207703_10331129 Ga0207703_103311291 232
257 3300026041 Ga0207639_10006113 Ga0207639_100061139 232
258 3300026041 Ga0207639_10147356 Ga0207639_101473562 232
259 3300026067 Ga0207678_10007078 Ga0207678_100070786 232
260 3300026088 Ga0207641_10006788 Ga0207641_1000678810 232
261 3300026088 Ga0207641_10093542 Ga0207641_100935421 232
262 3300026088 Ga0207641_10132355 Ga0207641_101323553 232
263 3300026089 Ga0207648_10001955 Ga0207648_1000195520 232
264 3300026089 Ga0207648_10005292 Ga0207648_100052922 232
265 3300026089 Ga0207648_10013552 Ga0207648_100135528 232
266 3300026089 Ga0207648_10220954 Ga0207648_102209542 232
267 3300026095 Ga0207676_10018120 Ga0207676_100181207 232
268 3300026095 Ga0207676_10137845 Ga0207676_101378454 232
269 3300026095 Ga0207676_10309312 Ga0207676_103093121 232
270 3300026095 Ga0207676_10340037 Ga0207676_103400373 232
271 3300026116 Ga0207674_10010543 Ga0207674_100105435 232
272 3300026116 Ga0207674_10033431 Ga0207674_100334318 232
273 3300026116 Ga0207674_10472237 Ga0207674_104722371 232
274 3300026118 Ga0207675_100000282 Ga0207675_1000002826 232
275 3300026121 Ga0207683_10003845 Ga0207683_1000384514 232
276 3300026121 Ga0207683_10062288 Ga0207683_100622882 232
277 3300026142 Ga0207698_10037438 Ga0207698_100374385 232
278 3300026142 Ga0207698_10438310 Ga0207698_104383102 232
279 3300027907 Ga0207428_10137684 Ga0207428_101376843 232
280 3300028379 Ga0268266_10006796 Ga0268266_100067961 232
281 3300028379 Ga0268266_10044619 Ga0268266_100446194 232
282 3300028379 Ga0268266_10074515 Ga0268266_100745152 232
283 3300028380 Ga0268265_10237330 Ga0268265_102373302 232
284 3300028380 Ga0268265_10290055 Ga0268265_102900551 232
285 3300028380 Ga0268265_10340578 Ga0268265_103405782 232
286 3300028380 Ga0268265_10784983 Ga0268265_107849831 232
287 3300028381 Ga0268264_10020188 Ga0268264_100201886 232
288 3300028381 Ga0268264_10039119 Ga0268264_100391197 232
289 3300028381 Ga0268264_10169765 Ga0268264_101697652 232
290 3300028381 Ga0268264_10326036 Ga0268264_103260363 232
291 3300031730 Ga0307516_10328090 Ga0307516_103280902 232
292 3300031901 Ga0307406_10020465 Ga0307406_100204654 232
293 3300032004 Ga0307414_10183138 Ga0307414_101831383 232
294 3300035725 Ga0373947_0047778 Ga0373947_0047778_854_1555 232
295 3300037068 Ga0373925_0169786 Ga0373925_0169786_455_1156 232
296 3300037471 Ga0395905_0112701 Ga0395905_0112701_1279_1989 232
297 3300041486 Ga0451807_0453552 Ga0451807_0453552_160_861 232
298 3300042007 Ga0439449_0023320 Ga0439449_0023320_974_1681 232
299 3300042135 Ga0450899_002200 Ga0450899_002200_1074_1781 232
300 3300042435 Ga0439434_0014251 Ga0439434_0014251_495_1202 232
301 3300046460 Ga0495638_0202165 Ga0495638_0202165_398_1108 232
302 3300046471 Ga0495650_0006071 Ga0495650_0006071_6558_7271 232
303 3300046648 Ga0495611_0058551 Ga0495611_0058551_273_1007 232
304 3300047320 Ga0495672_0066379 Ga0495672_0066379_1242_1949 232
305 3300048913 Ga0496110_0018045 Ga0496110_0018045_131_832 232
306 3300048914 Ga0496111_0135025 Ga0496111_0135025_946_1647 232
307 3300048914 Ga0496111_0167364 Ga0496111_0167364_712_1413 232
308 3300049515 Ga0501292_006298 Ga0501292_006298_861_1571 232
309 3300049519 Ga0501296_009408 Ga0501296_009408_129_839 232
310 3300049521 Ga0501298_001651 Ga0501298_001651_653_1363 232
311 3300049569 Ga0501032_0004878 Ga0501032_0004878_7364_8086 232
312 3300049571 Ga0501034_0018637 Ga0501034_0018637_5198_5920 232
313 3300049574 Ga0501038_0038821 Ga0501038_0038821_1358_2080 232
314 3300049575 Ga0501039_0104500 Ga0501039_0104500_671_1393 232
315 3300049579 Ga0501043_0002067 Ga0501043_0002067_16072_16794 232
316 3300049580 Ga0501046_0021125 Ga0501046_0021125_1760_2482 232
317 3300049582 Ga0501048_0137115 Ga0501048_0137115_645_1367 232
318 3300049583 Ga0501067_0040003 Ga0501067_0040003_1393_2115 232
319 3300049590 Ga0501074_0002102 Ga0501074_0002102_10131_10853 232
320 3300049663 Ga0501223_002911 Ga0501223_002911_963_1673 232
321 3300049669 Ga0501235_000348 Ga0501235_000348_1325_2035 232
322 3300049686 Ga0501257_019547 Ga0501257_019547_719_1429 232
323 3300049688 Ga0501259_000182 Ga0501259_000182_3862_4572 232
324 3300049690 Ga0501261_001781 Ga0501261_001781_1639_2349 232
325 3300049704 Ga0501221_000013 Ga0501221_000013_2289_2999 232
326 3300049707 Ga0501234_016108 Ga0501234_016108_145_855 232
327 3300049708 Ga0501245_000480 Ga0501245_000480_1825_2535 232
328 3300049741 Ga0501079_0036433 Ga0501079_0036433_1938_2660 232
329 3300049742 Ga0501080_0394563 Ga0501080_0394563_364_1086 232
330 3300049822 Ga0501035_0001762 Ga0501035_0001762_3785_4507 232
331 3300049823 Ga0501044_0003029 Ga0501044_0003029_697_1419 232
332 3300050511 nmdc:mga08y16_241684_c1 nmdc:mga08y16_241684_c1_634_1380 232
333 3300050511 nmdc:mga08y16_30941_c1 nmdc:mga08y16_30941_c1_1809_2516 232
334 3300050512 nmdc:mga0n895_1071379_c1 nmdc:mga0n895_1071379_c1_35_736 232
335 3300050512 nmdc:mga0n895_387970_c1 nmdc:mga0n895_387970_c1_179_880 232
336 3300053090 Ga0500646_0016975 Ga0500646_0016975_192_905 232
337 3300053153 Ga0500616_0061576 Ga0500616_0061576_620_1330 232
338 3300053727 Ga0500611_000003 Ga0500611_000003_234412_235227 232
339 3300054114 Ga0501084_0110107 Ga0501084_0110107_1582_2304 232

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02390

Methyltransf_4

Putative methyltransferase

71

242

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
1yzh-assembly1.cif.gz_A crystal structure of the conserved hypothetical protein, methyltransferase from streptococcus pneumoniae tigr4 0.9194 8 212
1yzh-assembly1.cif.gz_A crystal structure of the conserved hypothetical protein, methyltransferase from streptococcus pneumoniae tigr4 0.9108 8 212
7nzj-assembly3.cif.gz_E structure of bstrmb apo 0.9047 7 213
7nzj-assembly3.cif.gz_E structure of bstrmb apo 0.8839 7 213
3dxz-assembly1.cif.gz_A crystal structure of ectrmb in complex with sah 0.8097 12 217
ID Description Score Start End Superfamily
1yzhA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9143 8 212 3.40.50.150
1yzhA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9057 8 212 3.40.50.150
af_Q8I3G1_737_866_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8703 38 113 3.40.50.150
af_K7LTE4_237_888_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8693 38 99 3.40.50.150
af_Q4E3J0_145_404_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8475 38 90 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A838TIJ5-F1-model_v4 Methyltransferase domain-containing protein 0.9905 1 106 GO:0008176
GO:0043527
AF-A0A838TIJ5-F1-model_v4 Methyltransferase domain-containing protein 0.9814 1 106 GO:0008176
GO:0043527
AF-A0A800AZZ5-F1-model_v4 tRNA (Guanosine(46)-N7)-methyltransferase TrmB (EC 2.1.1.33) 0.9808 5 107 GO:0008176
GO:0043527
AF-A0A257I2F3-F1-model_v4 tRNA (Guanosine(46)-N7)-methyltransferase TrmB 0.9751 1 231 GO:0008176
GO:0043527
AF-A0A5C7QSB4-F1-model_v4 deleted 0.9697 1 231

Feature Viewer

pLDDT pTM Quality
91.42 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map