F414043

General Info

Members Datasets Scaffolds Average Seq Length
339 177 337 849

Family's Representative Sequence

Representative Sequence 3300046472|Ga0495580_0001878|Ga0495580_0001878_12054_15083
Length 963
Sequence MTRDYYLSQLKIYSRFVRNFNPAQQDKNQMLKIAVGPGGRLGTSPSSLQRELSSLVANGVLVHRREGTRAYSNLTSFGLLGCSSFSYRAQKSPHLGTEWRPDGAHVISCWGKGAVSIPMFMRIRVCLLLALISLILISAPGLSGADFALKVTDKNYLDTQGFSVFLYDSTYHPIFVDQKNTAMEMILHGQRIATNGDVRLMPTPEQWDLVATLKGRHADKANNRLTADLAFPTFDLSYTLEVAAEPGGVRVSINLDKPLPQKLAGRAGFNLEFLPSIYMGKAYLVDGTKAGIFPRTPNDPMTKVLPLPDEPKKAYYLEDWDKAKGYTQPLPFAEGKSITLGVDDALARVNVVSDTANLMLFDGRARAQNGWFVLRSLIPSGKTTGAIVWHIRPDVIPNWTRPPMIAHSQVGYAPGFSKVAVLELDPNYNASKTARVLRLMEDGSYKQVFEGPITPSTPWLRYVYSKFDFTPVKDPGLYVLEYGDQRTAPFPISSDAYANIWQDSLDHHLAEQMDHVSVREGYRVWHGASHLDDGRMAPVVGEQFDGWNQVTATDGKYKGGDHIPGMNVGGWYDAGDFDLEEPAQLSVIQSLALAYREFDLKYDQLTVDEAAREVEMHRPDGVPDTVQQVKHGALLILAQFQNIGHAIRGTHEPDLRQYTQVGDGASKTDGRIYDPKLGPNETKGDYSGKPDDRWIFTTNNPYFQWNAIAALAAAADTLKGWDDALAKDCLDTAIKAWQDAKDHPTRRGSGVGLDWAAALELTIATNGAEPYKSRLKELSPQMITPQQMDLHGWTAVRALPYLDASAKDQLREAVKTYMAGLDKRLDATPFGVPPSLGTWGGSGAVMDMAIRMYFLHKTFPDLVSPEYTLRAVDYILGTHPVSSTSXXXXVGTVSKTMTYSNNRADNAYIPGAVIPGYIIIKPDFPECIDNFGFLWFEDEAVVAGSASWVVAGNAADAIIKESK

Samples

Sample ID Description Type Environment
1 2786546940 Opitutaceae bacterium EW11 Isolate Unclassified
2 2919709256 Sphingobium xenophagum 4256 Isolate Unclassified
3 2928531327 Caulobacter sp. 1776 Isolate Rhizosphere
4 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
5 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
15 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
16 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
17 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
18 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
19 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
20 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
21 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
22 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
23 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
24 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
25 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
26 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
27 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
28 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
29 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
30 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
31 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
32 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
33 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
34 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
35 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
36 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
37 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
38 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
39 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
40 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
41 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
42 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
43 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
44 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
45 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
46 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
47 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
48 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
49 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
50 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
51 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
52 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
53 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
54 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
55 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
56 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
57 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
58 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
92 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
93 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
94 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
95 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
96 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
97 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
98 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
99 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
100 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
101 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
102 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
103 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
104 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
105 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
106 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
107 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
108 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
109 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
110 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
111 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
112 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
113 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
114 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
115 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
116 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
117 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
118 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
119 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
120 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
121 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
122 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
123 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
124 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
125 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
126 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
127 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
128 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
129 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
130 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
131 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
132 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
133 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
134 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
135 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
136 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
137 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
138 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
139 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
140 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
141 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
142 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
143 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
144 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
145 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
146 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
147 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
148 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
149 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
150 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
151 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
152 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
153 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
154 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
155 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
156 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
157 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
158 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
159 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
160 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
161 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
162 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
163 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
164 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
165 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
166 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
167 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
168 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
169 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
170 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
171 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
172 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
173 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
174 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
175 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
176 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
177 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.12
Metatranscriptomes 0
Isolates 0.88

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.29
Nodule 0
Rhizoplane 2.65
Rhizosphere 91.15
Stem 0
Stem Tuber 0
Unclassified 5.9

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10033593 3300003316 Bacteria 10042
2 rootH1_10033593 3300003323 Bacteria 6842
3 rootL2_10076151 3300003322 Bacteria 4315
4 Ga0065712_10075645 3300005290 Bacteria 3814
5 Ga0070683_100000004 3300005329 Bacteria 373231
6 Ga0070683_100001452 3300005329 Bacteria 18237
7 Ga0070683_100028187 3300005329 Bacteria 5074
8 Ga0070683_100048123 3300005329 Bacteria 3942
9 Ga0070683_100057389 3300005329 Bacteria 3617
10 Ga0068869_100003419 3300005334 Bacteria 9701
11 Ga0070680_100006173 3300005336 Bacteria 9085
12 Ga0070680_100015000 3300005336 Bacteria 6065
13 Ga0070682_100026993 3300005337 Bacteria 3442
14 Ga0068868_100007085 3300005338 Bacteria 7968
15 Ga0068868_100029895 3300005338 Bacteria 4175
16 Ga0070668_100008822 3300005347 Bacteria 7487
17 Ga0070671_100000799 3300005355 Bacteria 22726
18 Ga0070671_100002601 3300005355 Bacteria 13979
19 Ga0070671_100003017 3300005355 Bacteria 13102
20 Ga0070667_100015932 3300005367 Bacteria 6219
21 Ga0070714_100000096 3300005435 Bacteria 74616
22 Ga0070713_100000125 3300005436 Bacteria 50351
23 Ga0070713_100000788 3300005436 Bacteria 20250
24 Ga0070713_100006012 3300005436 Bacteria 8358
25 Ga0070713_100012798 3300005436 Bacteria 6169
26 Ga0070711_100000408 3300005439 Bacteria 22286
27 Ga0070711_100013289 3300005439 Bacteria 5168
28 Ga0070711_100022730 3300005439 Bacteria 4068
29 Ga0070708_100020170 3300005445 Bacteria 5616
30 Ga0070662_100006877 3300005457 Bacteria 7360
31 Ga0070681_10000195 3300005458 Bacteria 47245
32 Ga0070681_10008458 3300005458 Bacteria 10072
33 Ga0070681_10028644 3300005458 Bacteria 5601
34 Ga0070681_10090992 3300005458 Bacteria 3001
35 Ga0070679_100000864 3300005530 Bacteria 26322
36 Ga0070684_100000009 3300005535 Bacteria 209881
37 Ga0068853_100000052 3300005539 Bacteria 86096
38 Ga0068853_100014901 3300005539 Bacteria 6385
39 Ga0070665_100000648 3300005548 Bacteria 47008
40 Ga0070665_100004287 3300005548 Bacteria 14990
41 Ga0070665_100009299 3300005548 Bacteria 9946
42 Ga0070665_100013491 3300005548 Bacteria 8222
43 Ga0068855_100000250 3300005563 Bacteria 67441
44 Ga0068855_100000978 3300005563 Bacteria 35574
45 Ga0068855_100005261 3300005563 Bacteria 15797
46 Ga0068855_100009728 3300005563 Bacteria 11600
47 Ga0068855_100021706 3300005563 Bacteria 7700
48 Ga0068855_100031670 3300005563 Bacteria 6314
49 Ga0068857_100002172 3300005577 Bacteria 15945
50 Ga0068854_100036852 3300005578 Bacteria 3430
51 Ga0068856_100000107 3300005614 Bacteria 81707
52 Ga0068856_100001248 3300005614 Bacteria 26722
53 Ga0068856_100002817 3300005614 Bacteria 17805
54 Ga0068856_100005406 3300005614 Bacteria 12587
55 Ga0068856_100014380 3300005614 Bacteria 7650
56 Ga0068856_100016550 3300005614 Bacteria 7137
57 Ga0068856_100020028 3300005614 Bacteria 6495
58 Ga0068856_100025827 3300005614 Bacteria 5727
59 Ga0068856_100032199 3300005614 Bacteria 5133
60 Ga0068856_100041283 3300005614 Bacteria 4533
61 Ga0068856_100073307 3300005614 Bacteria 3390
62 Ga0068852_100000010 3300005616 Bacteria 141683
63 Ga0068852_100000319 3300005616 Bacteria 32685
64 Ga0068859_100003018 3300005617 Bacteria 17065
65 Ga0068863_100009590 3300005841 Bacteria 9445
66 Ga0068858_100001302 3300005842 Bacteria 25776
67 Ga0068858_100021414 3300005842 Bacteria 6040
68 Ga0068858_100026056 3300005842 Bacteria 5436
69 Ga0068860_100000358 3300005843 Bacteria 60466
70 Ga0068860_100008247 3300005843 Bacteria 10368
71 Ga0068860_100031228 3300005843 Bacteria 5121
72 Ga0070712_100000067 3300006175 Bacteria 53056
73 Ga0070712_100017806 3300006175 Bacteria 4602
74 Ga0097621_100000735 3300006237 Bacteria 22947
75 Ga0097621_100007279 3300006237 Bacteria 7905
76 Ga0097621_100029308 3300006237 Bacteria 4346
77 Ga0068871_100000410 3300006358 Bacteria 29656
78 Ga0068871_100001081 3300006358 Bacteria 18287
79 Ga0075434_100050264 3300006871 Bacteria 4141
80 Ga0097620_100003018 3300006931 Bacteria 17065
81 Ga0105240_10000060 3300009093 Bacteria 219839
82 Ga0105240_10000436 3300009093 Bacteria 76985
83 Ga0105240_10000792 3300009093 Bacteria 57279
84 Ga0105240_10002230 3300009093 Bacteria 31523
85 Ga0105240_10002577 3300009093 Bacteria 29052
86 Ga0105240_10004439 3300009093 Bacteria 21395
87 Ga0105240_10006478 3300009093 Bacteria 17193
88 Ga0105240_10009459 3300009093 Bacteria 13797
89 Ga0105240_10020078 3300009093 Bacteria 8920
90 Ga0105240_10021620 3300009093 Bacteria 8557
91 Ga0105240_10033965 3300009093 Bacteria 6586
92 Ga0105240_10055810 3300009093 Bacteria 4945
93 Ga0105240_10070227 3300009093 Bacteria 4333
94 Ga0105240_10127687 3300009093 Bacteria 3054
95 Ga0105247_10000137 3300009101 Bacteria 70918
96 Ga0105247_10010902 3300009101 Bacteria 5491
97 Ga0105241_10000014 3300009174 Bacteria 171306
98 Ga0105241_10029522 3300009174 Bacteria 4093
99 Ga0105241_10039820 3300009174 Bacteria 3546
100 Ga0105241_10057238 3300009174 Bacteria 2990
101 Ga0105248_10000768 3300009177 Bacteria 36009
102 Ga0105248_10010546 3300009177 Bacteria 10180
103 Ga0105248_10022140 3300009177 Bacteria 7045
104 Ga0105248_10036409 3300009177 Bacteria 5503
105 Ga0105248_10081726 3300009177 Bacteria 3632
106 Ga0105237_10019278 3300009545 Bacteria 7047
107 Ga0105237_10019509 3300009545 Bacteria 7002
108 Ga0105237_10031903 3300009545 Bacteria 5336
109 Ga0105237_10050039 3300009545 Bacteria 4200
110 Ga0105238_10000090 3300009551 Bacteria 102374
111 Ga0105238_10001060 3300009551 Bacteria 27763
112 Ga0105238_10001481 3300009551 Bacteria 23573
113 Ga0105238_10004975 3300009551 Bacteria 13141
114 Ga0105238_10005061 3300009551 Bacteria 13033
115 Ga0105238_10011181 3300009551 Bacteria 9029
116 Ga0105238_10012541 3300009551 Bacteria 8555
117 Ga0105238_10021146 3300009551 Bacteria 6631
118 Ga0105238_10038112 3300009551 Bacteria 4883
119 Ga0105238_10042503 3300009551 Bacteria 4602
120 Ga0105249_10009117 3300009553 Bacteria 8679
121 Ga0105239_10015258 3300010375 Bacteria 8513
122 Ga0157373_10023392 3300013100 Bacteria 4480
123 Ga0157370_10000005 3300013104 Bacteria 288514
124 Ga0157370_10011091 3300013104 Bacteria 9447
125 Ga0157369_10000049 3300013105 Bacteria 169239
126 Ga0157369_10000062 3300013105 Bacteria 149758
127 Ga0157369_10001464 3300013105 Bacteria 28931
128 Ga0157369_10001678 3300013105 Bacteria 27009
129 Ga0157369_10002045 3300013105 Bacteria 24340
130 Ga0157369_10003116 3300013105 Bacteria 19813
131 Ga0157369_10006463 3300013105 Bacteria 13588
132 Ga0157369_10018414 3300013105 Bacteria 7830
133 Ga0157374_10000684 3300013296 Bacteria 29878
134 Ga0157374_10001112 3300013296 Bacteria 23158
135 Ga0157374_10001524 3300013296 Bacteria 19513
136 Ga0157374_10009547 3300013296 Bacteria 8332
137 Ga0157378_10001362 3300013297 Bacteria 21956
138 Ga0157378_10004149 3300013297 Bacteria 12796
139 Ga0157378_10014218 3300013297 Bacteria 6966
140 Ga0157378_10040256 3300013297 Bacteria 4143
141 Ga0163162_10000264 3300013306 Bacteria 47545
142 Ga0157372_10000047 3300013307 Bacteria 145881
143 Ga0157372_10002754 3300013307 Bacteria 19004
144 Ga0157372_10009660 3300013307 Bacteria 10254
145 Ga0157372_10019665 3300013307 Bacteria 7277
146 Ga0157372_10034462 3300013307 Bacteria 5565
147 Ga0163163_10015158 3300014325 Bacteria 7116
148 Ga0157379_10009285 3300014968 Bacteria 8563
149 Ga0157376_10000724 3300014969 Bacteria 21378
150 Ga0182007_10001909 3300015262 Bacteria 10824
151 Ga0207710_10000317 3300025900 Bacteria 37077
152 Ga0207684_10000668 3300025910 Bacteria 40657
153 Ga0207684_10037228 3300025910 Bacteria 4128
154 Ga0207654_10000018 3300025911 Bacteria 173245
155 Ga0207654_10000100 3300025911 Bacteria 57508
156 Ga0207654_10007996 3300025911 Bacteria 5331
157 Ga0207654_10017987 3300025911 Bacteria 3705
158 Ga0207707_10000796 3300025912 Bacteria 30935
159 Ga0207707_10023486 3300025912 Bacteria 5394
160 Ga0207695_10000025 3300025913 Bacteria 627211
161 Ga0207695_10000030 3300025913 Bacteria 533735
162 Ga0207695_10000507 3300025913 Bacteria 82878
163 Ga0207695_10003305 3300025913 Bacteria 22881
164 Ga0207695_10006198 3300025913 Bacteria 15587
165 Ga0207695_10017572 3300025913 Bacteria 8313
166 Ga0207695_10040953 3300025913 Bacteria 4961
167 Ga0207695_10069187 3300025913 Bacteria 3613
168 Ga0207695_10070903 3300025913 Bacteria 3560
169 Ga0207671_10000562 3300025914 Bacteria 49896
170 Ga0207671_10006539 3300025914 Bacteria 10360
171 Ga0207693_10000252 3300025915 Bacteria 49630
172 Ga0207693_10002771 3300025915 Bacteria 15175
173 Ga0207693_10004954 3300025915 Bacteria 11189
174 Ga0207663_10024423 3300025916 Bacteria 3481
175 Ga0207660_10006932 3300025917 Bacteria 7337
176 Ga0207660_10015966 3300025917 Bacteria 4964
177 Ga0207657_10001194 3300025919 Bacteria 27626
178 Ga0207657_10001956 3300025919 Bacteria 22232
179 Ga0207652_10004299 3300025921 Bacteria 11611
180 Ga0207652_10021207 3300025921 Bacteria 5361
181 Ga0207652_10023669 3300025921 Bacteria 5089
182 Ga0207694_10000749 3300025924 Bacteria 29171
183 Ga0207694_10001381 3300025924 Bacteria 20900
184 Ga0207694_10007101 3300025924 Bacteria 8510
185 Ga0207694_10008938 3300025924 Bacteria 7563
186 Ga0207694_10042363 3300025924 Bacteria 3511
187 Ga0207700_10000381 3300025928 Bacteria 25771
188 Ga0207700_10001805 3300025928 Bacteria 12162
189 Ga0207664_10000087 3300025929 Bacteria 88607
190 Ga0207664_10029191 3300025929 Bacteria 4199
191 Ga0207706_10009145 3300025933 Bacteria 9109
192 Ga0207665_10000948 3300025939 Bacteria 19619
193 Ga0207689_10001455 3300025942 Bacteria 22661
194 Ga0207661_10000017 3300025944 Bacteria 289163
195 Ga0207661_10009281 3300025944 Bacteria 7051
196 Ga0207667_10000949 3300025949 Bacteria 36988
197 Ga0207667_10001904 3300025949 Bacteria 26195
198 Ga0207667_10003377 3300025949 Bacteria 19699
199 Ga0207667_10013453 3300025949 Bacteria 9364
200 Ga0207640_10023799 3300025981 Bacteria 3686
201 Ga0207658_10003615 3300025986 Bacteria 10924
202 Ga0207658_10009732 3300025986 Bacteria 6525
203 Ga0207677_10016064 3300026023 Bacteria 4423
204 Ga0207677_10023041 3300026023 Bacteria 3838
205 Ga0207703_10001608 3300026035 Bacteria 20424
206 Ga0207639_10000666 3300026041 Bacteria 23711
207 Ga0207678_10002950 3300026067 Bacteria 15407
208 Ga0207678_10029696 3300026067 Bacteria 4773
209 Ga0207702_10000103 3300026078 Bacteria 99037
210 Ga0207702_10002192 3300026078 Bacteria 18717
211 Ga0207702_10005310 3300026078 Bacteria 11300
212 Ga0207702_10017107 3300026078 Bacteria 5997
213 Ga0207641_10000458 3300026088 Bacteria 46494
214 Ga0207641_10004515 3300026088 Bacteria 12028
215 Ga0207641_10010902 3300026088 Bacteria 7448
216 Ga0207648_10004931 3300026089 Bacteria 13584
217 Ga0207674_10000799 3300026116 Bacteria 40975
218 Ga0207674_10007556 3300026116 Bacteria 12664
219 Ga0207674_10014847 3300026116 Bacteria 8589
220 Ga0207683_10027311 3300026121 Bacteria 4932
221 Ga0207698_10000003 3300026142 Bacteria 321303
222 Ga0268266_10001605 3300028379 Bacteria 26384
223 Ga0268266_10002193 3300028379 Bacteria 21353
224 Ga0268266_10012785 3300028379 Bacteria 7252
225 Ga0268264_10000047 3300028381 Bacteria 349944
226 Ga0268264_10001478 3300028381 Bacteria 21925
227 Ga0268264_10016890 3300028381 Bacteria 5975
228 Ga0265323_10003237 3300028653 Bacteria 7254
229 Ga0265336_10004529 3300028666 Bacteria 5242
230 Ga0265338_10003365 3300028800 Bacteria 22571
231 Ga0265338_10008595 3300028800 Bacteria 12356
232 Ga0265338_10029319 3300028800 Bacteria 5456
233 Ga0265338_10045616 3300028800 Bacteria 4027
234 Ga0265320_10001228 3300031240 Bacteria 18819
235 Ga0265325_10001576 3300031241 Bacteria 15900
236 Ga0265339_10000003 3300031249 Bacteria 305994
237 Ga0265339_10008842 3300031249 Bacteria 6376
238 Ga0265331_10003684 3300031250 Bacteria 9758
239 Ga0265316_10003071 3300031344 Bacteria 17030
240 Ga0307408_100047659 3300031548 Bacteria 3070
241 Ga0265314_10000261 3300031711 Bacteria 77506
242 Ga0265314_10040133 3300031711 Bacteria 3363
243 Ga0265342_10018234 3300031712 Bacteria 4551
244 Ga0265342_10018312 3300031712 Bacteria 4538
245 Ga0307510_10000016 3300033180 Bacteria 206932
246 Ga0307510_10002386 3300033180 Bacteria 21282
247 Ga0373953_0004181 3300035117 Bacteria 4580
248 Ga0373954_0001017 3300035118 Bacteria 11102
249 Ga0373943_0011111 3300035170 Bacteria 4046
250 Ga0373946_0009327 3300035171 Bacteria 3612
251 Ga0373955_0005619 3300035172 Bacteria 5641
252 Ga0316574_0009269 3300035398 Bacteria 5506
253 Ga0373935_0038303 3300035692 Unclassified 3002
254 Ga0373933_0000438 3300035724 Bacteria 26060
255 Ga0373947_0020725 3300035725 Bacteria 3799
256 Ga0373937_0000322 3300036401 Bacteria 45481
257 Ga0373937_0028719 3300036401 Bacteria 5035
258 Ga0373925_0016755 3300037068 Bacteria 5307
259 Ga0373925_0027604 3300037068 Bacteria 4155
260 Ga0395905_0030071 3300037471 Bacteria 5120
261 Ga0436364_1460896 3300037853 Bacteria 6826
262 Ga0436361_0038755 3300039447 Bacteria 48544
263 Ga0436363_0013612 3300039450 Bacteria 6153
264 Ga0439448_0004360 3300042005 Bacteria 3994
265 Ga0439455_0001081 3300042012 Bacteria 4343
266 Ga0451577_0000639 3300042876 Bacteria 55755
267 Ga0451577_0002106 3300042876 Bacteria 24519
268 Ga0451577_0026913 3300042876 Bacteria 5207
269 Ga0466972_0039710 3300044658 Bacteria 2296
270 Ga0453683_0000322 3300044673 Bacteria 58997
271 Ga0451576_0000071 3300045051 Bacteria 258795
272 Ga0451576_0000932 3300045051 Bacteria 55136
273 Ga0466967_0036770 3300045976 Bacteria 4183
274 Ga0495651_0014095 3300046462 Bacteria 6183
275 Ga0495653_0002965 3300046463 Bacteria 13593
276 Ga0495580_0001878 3300046472 Bacteria 18487
277 Ga0495580_0002296 3300046472 Bacteria 16692
278 Ga0495580_0047922 3300046472 Bacteria 3028
279 Ga0495582_0013068 3300046473 Bacteria 4571
280 Ga0495662_0001310 3300046476 Bacteria 12313
281 Ga0495594_0000451 3300046499 Bacteria 20841
282 Ga0495606_0025348 3300046507 Bacteria 4249
283 Ga0495644_0000580 3300046523 Bacteria 15324
284 Ga0495666_0000349 3300046526 Bacteria 20177
285 Ga0495652_0011242 3300046529 Bacteria 8103
286 Ga0495652_0013288 3300046529 Bacteria 7409
287 Ga0495665_0001001 3300046531 Bacteria 15001
288 Ga0495640_0001051 3300046533 Bacteria 21466
289 Ga0495586_0002005 3300046535 Bacteria 11051
290 Ga0495587_0003574 3300046536 Bacteria 10359
291 Ga0495645_0000178 3300046543 Bacteria 44629
292 Ga0495645_0037299 3300046543 Bacteria 3543
293 Ga0495667_0008171 3300046559 Bacteria 7103
294 Ga0495634_0002336 3300046642 Bacteria 15851
295 Ga0495635_0006444 3300046663 Bacteria 8183
296 Ga0495588_0012009 3300046674 Bacteria 4081
297 Ga0495646_0010600 3300046680 Bacteria 5854
298 Ga0495624_0003415 3300046690 Bacteria 11777
299 Ga0495600_0000127 3300046809 Bacteria 42749
300 Ga0495581_0001009 3300047315 Bacteria 15209
301 Ga0495604_0000783 3300047317 Bacteria 26772
302 Ga0495604_0002410 3300047317 Bacteria 14966
303 Ga0495674_0010605 3300047319 Bacteria 8719
304 Ga0495676_0000532 3300047321 Bacteria 31321
305 Ga0495675_0000425 3300047444 Bacteria 28334
306 Ga0495675_0004573 3300047444 Bacteria 8392
307 Ga0495684_0046661 3300047471 Bacteria 3314
308 Ga0495602_0011230 3300048088 Bacteria 9262
309 Ga0495602_0042967 3300048088 Bacteria 4114
310 Ga0496101_0071720 3300048904 Bacteria 2540
311 Ga0496102_0009752 3300048905 Bacteria 8257
312 Ga0496102_0038164 3300048905 Bacteria 4334
313 Ga0496104_0042990 3300048907 Bacteria 4243
314 Ga0496105_0008434 3300048908 Bacteria 8009
315 Ga0496110_0031533 3300048913 Bacteria 4573
316 Ga0496112_0004218 3300048915 Bacteria 12125
317 Ga0496114_0012261 3300048917 Bacteria 6860
318 Ga0496115_0025330 3300048918 Bacteria 4618
319 Ga0496117_0001731 3300048920 Bacteria 30192
320 Ga0496118_0000005 3300048921 Bacteria 697350
321 Ga0496119_0001923 3300048922 Bacteria 23713
322 Ga0496120_0000242 3300048923 Bacteria 93148
323 Ga0496121_0001771 3300048924 Bacteria 35100
324 Ga0496122_0001352 3300048925 Bacteria 39977
325 Ga0496123_0000465 3300048926 Bacteria 70986
326 Ga0496125_0000781 3300048928 Bacteria 52034
327 Ga0496125_0007118 3300048928 Bacteria 11940
328 Ga0496125_0061216 3300048928 Bacteria 3020
329 Ga0496126_0001566 3300048929 Bacteria 35078
330 Ga0496126_0057449 3300048929 Bacteria 3512
331 Ga0501032_0000913 3300049569 Bacteria 23895
332 Ga0501046_0005267 3300049580 Bacteria 11567
333 Ga0501047_0008103 3300049581 Bacteria 9914
334 Ga0501044_0000738 3300049823 Bacteria 39419
335 nmdc:mga0n895_36259_c1 3300050512 Bacteria 4762
336 nmdc:mga08x19_1155_c1 3300050514 Bacteria 16493
337 Ga0500616_0000105 3300053153 Bacteria 157881

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300044658 Ga0466972_0039710 Ga0466972_0039710_51_2285 712
2 3300003322 rootL2_10076151 rootL2_100761512 744
3 3300047444 Ga0495675_0004573 Ga0495675_0004573_5831_8362 758
4 3300053153 Ga0500616_0000105 Ga0500616_0000105_24783_27206 770
5 3300037471 Ga0395905_0030071 Ga0395905_0030071_1195_3702 771
6 3300048929 Ga0496126_0057449 Ga0496126_0057449_57_2453 773
7 3300042876 Ga0451577_0002106 Ga0451577_0002106_8993_11464 774
8 3300006175 Ga0070712_100017806 Ga0070712_1000178062 778
9 3300025915 Ga0207693_10002771 Ga0207693_1000277110 778
10 3300005336 Ga0070680_100006173 Ga0070680_1000061735 780
11 3300025917 Ga0207660_10015966 Ga0207660_100159662 780
12 3300013297 Ga0157378_10004149 Ga0157378_100041495 781
13 iso_pu_bacteria 2928531327 2928532099 781
14 3300005329 Ga0070683_100057389 Ga0070683_1000573892 785
15 3300005439 Ga0070711_100013289 Ga0070711_1000132892 785
16 3300005458 Ga0070681_10000195 Ga0070681_1000019534 785
17 3300005563 Ga0068855_100000978 Ga0068855_10000097828 785
18 3300005563 Ga0068855_100021706 Ga0068855_1000217066 785
19 3300005577 Ga0068857_100002172 Ga0068857_1000021722 785
20 3300005578 Ga0068854_100036852 Ga0068854_1000368522 785
21 3300005614 Ga0068856_100000107 Ga0068856_1000001078 785
22 3300005614 Ga0068856_100002817 Ga0068856_10000281712 785
23 3300005842 Ga0068858_100021414 Ga0068858_1000214144 785
24 3300006237 Ga0097621_100000735 Ga0097621_10000073518 785
25 3300006358 Ga0068871_100000410 Ga0068871_1000004104 785
26 3300006358 Ga0068871_100001081 Ga0068871_1000010817 785
27 3300009174 Ga0105241_10039820 Ga0105241_100398202 785
28 3300009551 Ga0105238_10000090 Ga0105238_1000009077 785
29 3300013105 Ga0157369_10000062 Ga0157369_10000062125 785
30 3300013105 Ga0157369_10018414 Ga0157369_100184146 785
31 3300013296 Ga0157374_10000684 Ga0157374_1000068417 785
32 3300013296 Ga0157374_10001524 Ga0157374_1000152412 785
33 3300013297 Ga0157378_10001362 Ga0157378_100013623 785
34 3300013307 Ga0157372_10002754 Ga0157372_100027549 785
35 3300013307 Ga0157372_10034462 Ga0157372_100344622 785
36 3300014969 Ga0157376_10000724 Ga0157376_100007245 785
37 3300025916 Ga0207663_10024423 Ga0207663_100244232 785
38 3300025924 Ga0207694_10001381 Ga0207694_1000138113 785
39 3300025949 Ga0207667_10001904 Ga0207667_100019047 785
40 3300026023 Ga0207677_10016064 Ga0207677_100160642 785
41 3300026078 Ga0207702_10000103 Ga0207702_1000010346 785
42 3300026078 Ga0207702_10002192 Ga0207702_100021929 785
43 3300026116 Ga0207674_10014847 Ga0207674_100148475 785
44 3300048904 Ga0496101_0071720 Ga0496101_0071720_74_2524 785
45 3300048905 Ga0496102_0038164 Ga0496102_0038164_1518_3968 785
46 3300048915 Ga0496112_0004218 Ga0496112_0004218_1785_4235 785
47 3300031548 Ga0307408_100047659 Ga0307408_1000476591 786
48 3300009093 Ga0105240_10002577 Ga0105240_1000257720 788
49 3300009093 Ga0105240_10006478 Ga0105240_100064783 788
50 3300009545 Ga0105237_10050039 Ga0105237_100500392 788
51 3300009551 Ga0105238_10001060 Ga0105238_1000106018 788
52 3300009551 Ga0105238_10042503 Ga0105238_100425032 788
53 3300013104 Ga0157370_10011091 Ga0157370_100110913 788
54 3300013105 Ga0157369_10002045 Ga0157369_100020454 788
55 3300005336 Ga0070680_100015000 Ga0070680_1000150002 791
56 3300005458 Ga0070681_10008458 Ga0070681_100084584 791
57 3300005458 Ga0070681_10028644 Ga0070681_100286443 791
58 3300005530 Ga0070679_100000864 Ga0070679_10000086417 791
59 3300005563 Ga0068855_100005261 Ga0068855_1000052615 791
60 3300005563 Ga0068855_100009728 Ga0068855_1000097285 791
61 3300025912 Ga0207707_10000796 Ga0207707_1000079620 791
62 3300025912 Ga0207707_10023486 Ga0207707_100234863 791
63 3300025913 Ga0207695_10017572 Ga0207695_100175722 791
64 3300025917 Ga0207660_10006932 Ga0207660_100069322 791
65 3300025921 Ga0207652_10004299 Ga0207652_100042992 791
66 3300025924 Ga0207694_10008938 Ga0207694_100089382 791
67 3300025949 Ga0207667_10013453 Ga0207667_100134533 791
68 3300039447 Ga0436361_0038755 Ga0436361_0038755_325_2934 791
69 3300005458 Ga0070681_10090992 Ga0070681_100909922 792
70 3300033180 Ga0307510_10002386 Ga0307510_100023867 792
71 3300035725 Ga0373947_0020725 Ga0373947_0020725_165_2750 792
72 3300048922 Ga0496119_0001923 Ga0496119_0001923_5092_7560 792
73 3300048923 Ga0496120_0000242 Ga0496120_0000242_57920_60388 792
74 3300048925 Ga0496122_0001352 Ga0496122_0001352_20384_22897 793
75 3300048926 Ga0496123_0000465 Ga0496123_0000465_23255_25768 793
76 3300048928 Ga0496125_0061216 Ga0496125_0061216_463_2943 793
77 3300005355 Ga0070671_100000799 Ga0070671_10000079920 794
78 3300005617 Ga0068859_100003018 Ga0068859_10000301816 794
79 3300005841 Ga0068863_100009590 Ga0068863_1000095903 794
80 3300005842 Ga0068858_100001302 Ga0068858_1000013025 794
81 3300005843 Ga0068860_100031228 Ga0068860_1000312283 794
82 3300006931 Ga0097620_100003018 Ga0097620_10000301816 794
83 3300009101 Ga0105247_10000137 Ga0105247_1000013737 794
84 3300013105 Ga0157369_10001678 Ga0157369_1000167813 794
85 3300025900 Ga0207710_10000317 Ga0207710_1000031721 794
86 3300025921 Ga0207652_10023669 Ga0207652_100236693 794
87 3300025986 Ga0207658_10003615 Ga0207658_100036153 794
88 3300026088 Ga0207641_10010902 Ga0207641_100109023 794
89 3300028381 Ga0268264_10016890 Ga0268264_100168903 794
90 3300028666 Ga0265336_10004529 Ga0265336_100045294 794
91 3300042876 Ga0451577_0026913 Ga0451577_0026913_2224_4743 794
92 3300048924 Ga0496121_0001771 Ga0496121_0001771_3797_6277 794
93 3300048928 Ga0496125_0007118 Ga0496125_0007118_5843_8323 794
94 3300025921 Ga0207652_10021207 Ga0207652_100212074 795
95 3300048905 Ga0496102_0009752 Ga0496102_0009752_5139_7775 795
96 3300048920 Ga0496117_0001731 Ga0496117_0001731_19497_22133 795
97 3300048921 Ga0496118_0000005 Ga0496118_0000005_533864_536500 795
98 3300026023 Ga0207677_10023041 Ga0207677_100230412 796
99 3300031250 Ga0265331_10003684 Ga0265331_100036844 796
100 3300035398 Ga0316574_0009269 Ga0316574_0009269_1262_3772 797
101 iso_pu_bacteria 2919709256 2919712306 797
102 3300033180 Ga0307510_10000016 Ga0307510_1000001612 798
103 3300035117 Ga0373953_0004181 Ga0373953_0004181_524_3046 798
104 3300035118 Ga0373954_0001017 Ga0373954_0001017_1412_3934 798
105 3300035172 Ga0373955_0005619 Ga0373955_0005619_497_3019 798
106 3300035724 Ga0373933_0000438 Ga0373933_0000438_3346_5868 798
107 3300036401 Ga0373937_0000322 Ga0373937_0000322_31209_33731 798
108 3300046536 Ga0495587_0003574 Ga0495587_0003574_1128_3650 798
109 3300047317 Ga0495604_0000783 Ga0495604_0000783_10510_13032 798
110 3300048088 Ga0495602_0011230 Ga0495602_0011230_3412_5934 798
111 3300028800 Ga0265338_10029319 Ga0265338_100293193 799
112 3300031240 Ga0265320_10001228 Ga0265320_100012284 799
113 3300031344 Ga0265316_10003071 Ga0265316_100030714 799
114 3300046462 Ga0495651_0014095 Ga0495651_0014095_2859_5513 799
115 3300046476 Ga0495662_0001310 Ga0495662_0001310_5831_8485 799
116 3300046526 Ga0495666_0000349 Ga0495666_0000349_14199_16853 799
117 3300046529 Ga0495652_0013288 Ga0495652_0013288_2337_4991 799
118 3300046535 Ga0495586_0002005 Ga0495586_0002005_5735_8389 799
119 3300046543 Ga0495645_0000178 Ga0495645_0000178_27692_30346 799
120 3300046559 Ga0495667_0008171 Ga0495667_0008171_841_3495 799
121 3300046680 Ga0495646_0010600 Ga0495646_0010600_1626_4280 799
122 3300047315 Ga0495581_0001009 Ga0495581_0001009_8138_10792 799
123 3300047317 Ga0495604_0002410 Ga0495604_0002410_9108_11762 799
124 3300005548 Ga0070665_100000648 Ga0070665_10000064815 800
125 3300009545 Ga0105237_10031903 Ga0105237_100319033 800
126 3300028379 Ga0268266_10001605 Ga0268266_1000160519 800
127 3300042012 Ga0439455_0001081 Ga0439455_0001081_1140_3692 801
128 3300048929 Ga0496126_0001566 Ga0496126_0001566_12824_15331 801
129 3300035171 Ga0373946_0009327 Ga0373946_0009327_567_3167 802
130 3300035692 Ga0373935_0038303 Ga0373935_0038303_367_2967 802
131 3300037068 Ga0373925_0027604 Ga0373925_0027604_387_2987 802
132 3300042005 Ga0439448_0004360 Ga0439448_0004360_468_2993 802
133 3300046543 Ga0495645_0037299 Ga0495645_0037299_437_3037 802
134 3300009551 Ga0105238_10005061 Ga0105238_100050612 803
135 3300050512 nmdc:mga0n895_36259_c1 nmdc:mga0n895_36259_c1_1591_4269 803
136 3300044673 Ga0453683_0000322 Ga0453683_0000322_14515_17169 804
137 3300006871 Ga0075434_100050264 Ga0075434_1000502643 805
138 3300005338 Ga0068868_100029895 Ga0068868_1000298952 806
139 3300006237 Ga0097621_100029308 Ga0097621_1000293083 806
140 3300036401 Ga0373937_0028719 Ga0373937_0028719_2223_4865 806
141 3300046463 Ga0495653_0002965 Ga0495653_0002965_8288_10942 807
142 3300046499 Ga0495594_0000451 Ga0495594_0000451_3451_6105 807
143 3300046531 Ga0495665_0001001 Ga0495665_0001001_7343_9997 807
144 3300046533 Ga0495640_0001051 Ga0495640_0001051_16272_18926 807
145 3300046642 Ga0495634_0002336 Ga0495634_0002336_3472_6126 807
146 3300046663 Ga0495635_0006444 Ga0495635_0006444_2296_4950 807
147 3300046690 Ga0495624_0003415 Ga0495624_0003415_2380_5034 807
148 3300046809 Ga0495600_0000127 Ga0495600_0000127_32767_35421 807
149 3300047319 Ga0495674_0010605 Ga0495674_0010605_3392_6046 807
150 3300047321 Ga0495676_0000532 Ga0495676_0000532_9116_11770 807
151 3300009093 Ga0105240_10055810 Ga0105240_100558104 808
152 3300025913 Ga0207695_10040953 Ga0207695_100409532 808
153 3300025949 Ga0207667_10000949 Ga0207667_1000094927 808
154 3300005329 Ga0070683_100001452 Ga0070683_1000014524 809
155 3300005329 Ga0070683_100000004 Ga0070683_100000004117 810
156 3300005535 Ga0070684_100000009 Ga0070684_10000000975 810
157 3300009174 Ga0105241_10029522 Ga0105241_100295222 810
158 3300009551 Ga0105238_10021146 Ga0105238_100211462 810
159 3300009553 Ga0105249_10009117 Ga0105249_100091171 810
160 3300025944 Ga0207661_10000017 Ga0207661_1000001737 810
161 3300046472 Ga0495580_0047922 Ga0495580_0047922_156_2834 810
162 3300009174 Ga0105241_10057238 Ga0105241_100572381 811
163 3300009093 Ga0105240_10127687 Ga0105240_101276871 812
164 3300013307 Ga0157372_10019665 Ga0157372_100196654 812
165 3300015262 Ga0182007_10001909 Ga0182007_100019095 813
166 3300045051 Ga0451576_0000932 Ga0451576_0000932_40414_43089 813
167 3300048913 Ga0496110_0031533 Ga0496110_0031533_1295_3970 813
168 3300013306 Ga0163162_10000264 Ga0163162_1000026440 814
169 3300028800 Ga0265338_10045616 Ga0265338_100456162 814
170 3300005614 Ga0068856_100005406 Ga0068856_1000054064 815
171 3300009093 Ga0105240_10000060 Ga0105240_100000602 816
172 3300025915 Ga0207693_10004954 Ga0207693_100049542 817
173 3300046472 Ga0495580_0001878 Ga0495580_0001878_12054_15083 817
174 3300046473 Ga0495582_0013068 Ga0495582_0013068_608_3637 817
175 3300005347 Ga0070668_100008822 Ga0070668_1000088222 819
176 3300005445 Ga0070708_100020170 Ga0070708_1000201703 819
177 3300005457 Ga0070662_100006877 Ga0070662_1000068773 819
178 3300005614 Ga0068856_100001248 Ga0068856_1000012482 819
179 3300009093 Ga0105240_10021620 Ga0105240_100216202 819
180 3300009551 Ga0105238_10038112 Ga0105238_100381123 819
181 3300025910 Ga0207684_10037228 Ga0207684_100372282 819
182 3300025911 Ga0207654_10007996 Ga0207654_100079963 819
183 3300025913 Ga0207695_10070903 Ga0207695_100709032 819
184 3300025933 Ga0207706_10009145 Ga0207706_100091452 819
185 3300026078 Ga0207702_10017107 Ga0207702_100171073 819
186 3300026089 Ga0207648_10004931 Ga0207648_100049312 819
187 3300026116 Ga0207674_10007556 Ga0207674_100075562 819
188 3300039450 Ga0436363_0013612 Ga0436363_0013612_1762_4398 819
189 3300048907 Ga0496104_0042990 Ga0496104_0042990_1444_4116 819
190 3300005337 Ga0070682_100026993 Ga0070682_1000269931 820
191 3300005614 Ga0068856_100025827 Ga0068856_1000258272 820
192 3300025981 Ga0207640_10023799 Ga0207640_100237991 820
193 3300035170 Ga0373943_0011111 Ga0373943_0011111_1356_4007 820
194 3300005614 Ga0068856_100041283 Ga0068856_1000412832 821
195 3300006175 Ga0070712_100000067 Ga0070712_10000006734 822
196 3300025915 Ga0207693_10000252 Ga0207693_100002524 822
197 3300025928 Ga0207700_10000381 Ga0207700_1000038117 822
198 3300005290 Ga0065712_10075645 Ga0065712_100756452 823
199 3300025919 Ga0207657_10001956 Ga0207657_1000195618 823
200 3300026121 Ga0207683_10027311 Ga0207683_100273112 823
201 3300046529 Ga0495652_0011242 Ga0495652_0011242_2428_5130 823
202 3300047444 Ga0495675_0000425 Ga0495675_0000425_23374_26076 823
203 3300047471 Ga0495684_0046661 Ga0495684_0046661_393_3095 823
204 3300048088 Ga0495602_0042967 Ga0495602_0042967_262_2964 823
205 3300005329 Ga0070683_100028187 Ga0070683_1000281871 824
206 3300009551 Ga0105238_10011181 Ga0105238_100111814 824
207 3300013307 Ga0157372_10009660 Ga0157372_100096603 824
208 3300025944 Ga0207661_10009281 Ga0207661_100092815 824
209 3300026116 Ga0207674_10000799 Ga0207674_1000079910 824
210 3300031241 Ga0265325_10001576 Ga0265325_100015766 824
211 3300005439 Ga0070711_100022730 Ga0070711_1000227304 825
212 3300031712 Ga0265342_10018234 Ga0265342_100182343 825
213 3300048908 Ga0496105_0008434 Ga0496105_0008434_4161_6839 825
214 3300048917 Ga0496114_0012261 Ga0496114_0012261_1642_4320 825
215 3300048918 Ga0496115_0025330 Ga0496115_0025330_1895_4573 825
216 3300009093 Ga0105240_10000792 Ga0105240_1000079234 826
217 3300009093 Ga0105240_10033965 Ga0105240_100339652 826
218 3300025913 Ga0207695_10003305 Ga0207695_1000330513 826
219 3300037068 Ga0373925_0016755 Ga0373925_0016755_2265_4910 826
220 3300037853 Ga0436364_1460896 Ga0436364_1460896_3456_6164 826
221 3300045051 Ga0451576_0000071 Ga0451576_0000071_67868_70525 826
222 3300005539 Ga0068853_100000052 Ga0068853_10000005249 827
223 3300005563 Ga0068855_100031670 Ga0068855_1000316702 827
224 3300005614 Ga0068856_100016550 Ga0068856_1000165502 827
225 3300005616 Ga0068852_100000319 Ga0068852_1000003192 827
226 3300013105 Ga0157369_10003116 Ga0157369_100031162 827
227 3300025911 Ga0207654_10000100 Ga0207654_100001003 827
228 3300025914 Ga0207671_10000562 Ga0207671_100005622 827
229 3300025949 Ga0207667_10003377 Ga0207667_100033772 827
230 3300026041 Ga0207639_10000666 Ga0207639_1000066614 827
231 3300026078 Ga0207702_10005310 Ga0207702_100053102 827
232 3300028800 Ga0265338_10008595 Ga0265338_100085954 827
233 3300046507 Ga0495606_0025348 Ga0495606_0025348_1378_4083 827
234 3300049569 Ga0501032_0000913 Ga0501032_0000913_13236_15941 827
235 3300049580 Ga0501046_0005267 Ga0501046_0005267_2129_4834 827
236 3300049581 Ga0501047_0008103 Ga0501047_0008103_476_3181 827
237 3300049823 Ga0501044_0000738 Ga0501044_0000738_6717_9422 827
238 3300005614 Ga0068856_100020028 Ga0068856_1000200284 828
239 3300005614 Ga0068856_100032199 Ga0068856_1000321995 828
240 3300009177 Ga0105248_10081726 Ga0105248_100817261 828
241 3300009545 Ga0105237_10019509 Ga0105237_100195091 828
242 3300009551 Ga0105238_10001481 Ga0105238_1000148111 828
243 3300013105 Ga0157369_10001464 Ga0157369_1000146412 828
244 3300025928 Ga0207700_10001805 Ga0207700_100018059 828
245 3300025929 Ga0207664_10029191 Ga0207664_100291912 828
246 3300028800 Ga0265338_10003365 Ga0265338_100033653 828
247 3300031249 Ga0265339_10008842 Ga0265339_100088422 828
248 3300031711 Ga0265314_10040133 Ga0265314_100401331 828
249 3300050514 nmdc:mga08x19_1155_c1 nmdc:mga08x19_1155_c1_12128_14827 828
250 3300005436 Ga0070713_100000788 Ga0070713_10000078821 829
251 3300005436 Ga0070713_100012798 Ga0070713_1000127981 829
252 3300009101 Ga0105247_10010902 Ga0105247_100109021 829
253 3300026067 Ga0207678_10002950 Ga0207678_1000295015 829
254 3300048928 Ga0496125_0000781 Ga0496125_0000781_49339_51987 829
255 3300005436 Ga0070713_100006012 Ga0070713_1000060123 830
256 3300009177 Ga0105248_10000768 Ga0105248_1000076812 830
257 3300042876 Ga0451577_0000639 Ga0451577_0000639_48417_51080 830
258 3300045976 Ga0466967_0036770 Ga0466967_0036770_103_2781 830
259 3300005329 Ga0070683_100048123 Ga0070683_1000481232 831
260 3300005435 Ga0070714_100000096 Ga0070714_10000009622 831
261 3300009093 Ga0105240_10002230 Ga0105240_1000223010 831
262 3300013100 Ga0157373_10023392 Ga0157373_100233921 831
263 3300025929 Ga0207664_10000087 Ga0207664_1000008733 831
264 3300005614 Ga0068856_100073307 Ga0068856_1000733071 832
265 3300031249 Ga0265339_10000003 Ga0265339_10000003192 832
266 3300031712 Ga0265342_10018312 Ga0265342_100183121 832
267 3300005548 Ga0070665_100009299 Ga0070665_1000092992 833
268 3300005563 Ga0068855_100000250 Ga0068855_10000025026 833
269 3300005616 Ga0068852_100000010 Ga0068852_10000001056 833
270 3300009093 Ga0105240_10000436 Ga0105240_1000043660 833
271 3300009093 Ga0105240_10020078 Ga0105240_100200789 833
272 3300009174 Ga0105241_10000014 Ga0105241_1000001422 833
273 3300009177 Ga0105248_10036409 Ga0105248_100364092 833
274 3300013104 Ga0157370_10000005 Ga0157370_1000000566 833
275 3300013105 Ga0157369_10000049 Ga0157369_1000004966 833
276 3300013105 Ga0157369_10006463 Ga0157369_100064637 833
277 3300013297 Ga0157378_10014218 Ga0157378_100142188 833
278 3300013307 Ga0157372_10000047 Ga0157372_1000004775 833
279 3300014325 Ga0163163_10015158 Ga0163163_100151582 833
280 3300025911 Ga0207654_10000018 Ga0207654_1000001825 833
281 3300025913 Ga0207695_10000507 Ga0207695_1000050767 833
282 3300025939 Ga0207665_10000948 Ga0207665_100009486 833
283 3300026142 Ga0207698_10000003 Ga0207698_1000000364 833
284 3300028379 Ga0268266_10012785 Ga0268266_100127851 833
285 3300046472 Ga0495580_0002296 Ga0495580_0002296_2204_4897 833
286 3300046523 Ga0495644_0000580 Ga0495644_0000580_11330_14029 833
287 3300046674 Ga0495588_0012009 Ga0495588_0012009_370_3069 833
288 3300005355 Ga0070671_100002601 Ga0070671_1000026013 834
289 3300013296 Ga0157374_10001112 Ga0157374_100011127 836
290 3300005334 Ga0068869_100003419 Ga0068869_1000034195 837
291 3300005338 Ga0068868_100007085 Ga0068868_1000070857 837
292 3300005355 Ga0070671_100003017 Ga0070671_10000301712 837
293 3300005367 Ga0070667_100015932 Ga0070667_1000159322 837
294 3300005614 Ga0068856_100014380 Ga0068856_1000143809 837
295 3300005843 Ga0068860_100008247 Ga0068860_1000082477 837
296 3300006237 Ga0097621_100007279 Ga0097621_1000072792 837
297 3300009093 Ga0105240_10004439 Ga0105240_1000443913 837
298 3300009093 Ga0105240_10009459 Ga0105240_1000945912 837
299 3300009177 Ga0105248_10010546 Ga0105248_1001054611 837
300 3300009177 Ga0105248_10022140 Ga0105248_100221403 837
301 3300009545 Ga0105237_10019278 Ga0105237_100192781 837
302 3300009551 Ga0105238_10004975 Ga0105238_1000497512 837
303 3300009551 Ga0105238_10012541 Ga0105238_100125413 837
304 3300010375 Ga0105239_10015258 Ga0105239_100152584 837
305 3300013296 Ga0157374_10009547 Ga0157374_100095476 837
306 3300013297 Ga0157378_10040256 Ga0157378_100402563 837
307 3300014968 Ga0157379_10009285 Ga0157379_100092853 837
308 3300025911 Ga0207654_10017987 Ga0207654_100179872 837
309 3300025913 Ga0207695_10000030 Ga0207695_1000003081 837
310 3300025913 Ga0207695_10006198 Ga0207695_1000619810 837
311 3300025914 Ga0207671_10006539 Ga0207671_100065395 837
312 3300025924 Ga0207694_10000749 Ga0207694_100007494 837
313 3300025924 Ga0207694_10007101 Ga0207694_100071013 837
314 3300025942 Ga0207689_10001455 Ga0207689_1000145514 837
315 3300025986 Ga0207658_10009732 Ga0207658_100097326 837
316 3300026088 Ga0207641_10004515 Ga0207641_100045153 837
317 3300028381 Ga0268264_10001478 Ga0268264_1000147815 837
318 3300031711 Ga0265314_10000261 Ga0265314_1000026133 838
319 3300025910 Ga0207684_10000668 Ga0207684_1000066817 839
320 3300005539 Ga0068853_100014901 Ga0068853_1000149014 841
321 3300005842 Ga0068858_100026056 Ga0068858_1000260563 841
322 3300025919 Ga0207657_10001194 Ga0207657_1000119428 841
323 3300028653 Ga0265323_10003237 Ga0265323_100032374 841
324 3300025913 Ga0207695_10000025 Ga0207695_10000025202 843
325 3300005436 Ga0070713_100000125 Ga0070713_1000001255 845
326 3300005439 Ga0070711_100000408 Ga0070711_1000004086 845
327 3300005548 Ga0070665_100013491 Ga0070665_1000134914 846
328 3300028379 Ga0268266_10002193 Ga0268266_1000219310 846
329 3300026035 Ga0207703_10001608 Ga0207703_100016086 847
330 iso_pu_bacteria 2786546940 2788437427 847
331 3300003316 rootH1_10033593 rootH1_100335932 852
332 3300005548 Ga0070665_100004287 Ga0070665_1000042873 852
333 3300005843 Ga0068860_100000358 Ga0068860_10000035833 852
334 3300009093 Ga0105240_10070227 Ga0105240_100702272 852
335 3300025913 Ga0207695_10069187 Ga0207695_100691871 852
336 3300025924 Ga0207694_10042363 Ga0207694_100423631 852
337 3300026067 Ga0207678_10029696 Ga0207678_100296962 852
338 3300026088 Ga0207641_10000458 Ga0207641_1000045832 852
339 3300028381 Ga0268264_10000047 Ga0268264_10000047243 852

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02927

CelD_N

Cellulase N-terminal ig-like domain

400

487

0.87

PF00759

Glyco_hydro_9

Glycosyl hydrolase family 9

497

918

0.76

Structural Annotation

Top 5 Hits

ID Description Score Start End
6fhj-assembly1.cif.gz_A structural dynamics and catalytic properties of a multi-modular xanthanase, native. 0.7004 282 847
6fhn-assembly1.cif.gz_A structural dynamics and catalytic properties of a multi-modular xanthanase (pt derivative) 0.677 282 847
6dht-assembly1.cif.gz_A bacteroides ovatus gh9 bacova_02649 0.6668 282 848
1ut9-assembly1.cif.gz_A structural basis for the exocellulase activity of the cellobiohydrolase cbha from c. thermocellum 0.6601 282 848
6dht-assembly1.cif.gz_A bacteroides ovatus gh9 bacova_02649 0.6591 282 848
ID Description Score Start End Superfamily
3h7lA01 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.8201 282 370 2.60.40.10
5e2jA01 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.8066 279 370 2.60.40.10
5e2jA01 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.7889 279 370 2.60.40.10
3h7lA01 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.7795 282 370 2.60.40.10
3x17B01 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.7783 280 370 2.60.40.10
ID Description Score Start End GO Terms
AF-W4UXP0-F1-model_v4 Glycoside hydrolase 0.9531 20 256
AF-A0A3D2SG80-F1-model_v4 Glycoside hydrolase 0.9422 20 273
AF-A0A7C3DAZ7-F1-model_v4 Glycoside hydrolase 0.9373 19 237 GO:0016787
AF-A0A353TXV0-F1-model_v4 Glycoside hydrolase 0.9354 20 522 GO:0005975
GO:0008810
AF-A0A7C5AVI9-F1-model_v4 Glycoside hydrolase 0.9333 19 400 GO:0005975
GO:0008810

Feature Viewer

pLDDT pTM Quality
79.61 0.83 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map