F414035
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 339 | 177 | 339 | 71 |
Family's Representative Sequence
| Representative Sequence | 3300045051|Ga0451576_1570583|Ga0451576_1570583_60_308 |
| Length | 82 |
| Sequence | MISMQLPPNVESKFRLVHIASRRAEQLVQGARPKMESRHSKMTRIALEEVGHDLVKWELASTEPPAGELEGVGTDPLPTEAA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300004801 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 2 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 3 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 4 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 6 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 7 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 9 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 10 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 12 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 13 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 14 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 15 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 22 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 28 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 32 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 33 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 38 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 40 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 42 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 45 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 46 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 48 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 49 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 50 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 51 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 52 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 53 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 54 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 56 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 58 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 59 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 60 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 61 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 62 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 63 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 64 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 66 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 88 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 89 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 90 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 91 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 133 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 136 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 137 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 138 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 139 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 140 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 141 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 142 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 143 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 144 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 145 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 146 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 147 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 148 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 149 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 150 | 3300041441 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG | Metagenome | Rhizoplane |
| 151 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 152 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 153 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 154 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 155 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 156 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 165 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 166 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 167 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 168 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 169 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 170 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 171 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 172 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 173 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 174 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 175 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 176 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.71 |
| Metatranscriptomes | 0.29 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 1.18 |
| Rhizosphere | 93.81 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 5.01 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0058860_10937433 | 3300004801 | Bacteria | 685 |
| 2 | Ga0065715_10539242 | 3300005293 | Bacteria | 749 |
| 3 | Ga0065707_10090664 | 3300005295 | Bacteria | 4094 |
| 4 | Ga0070676_10382213 | 3300005328 | Unclassified | 975 |
| 5 | Ga0070676_10400682 | 3300005328 | Bacteria | 955 |
| 6 | Ga0070683_100000068 | 3300005329 | Bacteria | 72997 |
| 7 | Ga0070683_100269134 | 3300005329 | Bacteria | 1621 |
| 8 | Ga0070683_101465384 | 3300005329 | Bacteria | 656 |
| 9 | Ga0070690_100280077 | 3300005330 | Bacteria | 1189 |
| 10 | Ga0070690_100791252 | 3300005330 | Bacteria | 735 |
| 11 | Ga0070670_100000307 | 3300005331 | Bacteria | 42018 |
| 12 | Ga0070670_101066237 | 3300005331 | Bacteria | 736 |
| 13 | Ga0068869_100049503 | 3300005334 | Bacteria | 3042 |
| 14 | Ga0068869_100160079 | 3300005334 | Bacteria | 1752 |
| 15 | Ga0068869_101321765 | 3300005334 | Unclassified | 636 |
| 16 | Ga0068869_101368046 | 3300005334 | Bacteria | 626 |
| 17 | Ga0068869_101462874 | 3300005334 | Unclassified | 606 |
| 18 | Ga0070680_101069128 | 3300005336 | Unclassified | 697 |
| 19 | Ga0070682_100000001 | 3300005337 | Bacteria | 569837 |
| 20 | Ga0070682_100080448 | 3300005337 | Bacteria | 2107 |
| 21 | Ga0068868_100000163 | 3300005338 | Bacteria | 43476 |
| 22 | Ga0068868_100004748 | 3300005338 | Bacteria | 9543 |
| 23 | Ga0070689_100000313 | 3300005340 | Bacteria | 28319 |
| 24 | Ga0070689_101034783 | 3300005340 | Unclassified | 732 |
| 25 | Ga0070687_100011340 | 3300005343 | Bacteria | 3897 |
| 26 | Ga0070687_100657168 | 3300005343 | Bacteria | 727 |
| 27 | Ga0070687_100878694 | 3300005343 | Bacteria | 641 |
| 28 | Ga0070687_101114481 | 3300005343 | Unclassified | 578 |
| 29 | Ga0070692_10043278 | 3300005345 | Bacteria | 2315 |
| 30 | Ga0070669_100912187 | 3300005353 | Bacteria | 751 |
| 31 | Ga0070675_100000005 | 3300005354 | Bacteria | 295918 |
| 32 | Ga0070671_100416294 | 3300005355 | Bacteria | 1151 |
| 33 | Ga0070671_100781588 | 3300005355 | Unclassified | 831 |
| 34 | Ga0070674_100057961 | 3300005356 | Bacteria | 2691 |
| 35 | Ga0070673_100325867 | 3300005364 | Bacteria | 1358 |
| 36 | Ga0070673_100359425 | 3300005364 | Unclassified | 1294 |
| 37 | Ga0070673_101226276 | 3300005364 | Bacteria | 703 |
| 38 | Ga0070673_101326389 | 3300005364 | Unclassified | 676 |
| 39 | Ga0070673_101677165 | 3300005364 | Bacteria | 601 |
| 40 | Ga0070659_100421532 | 3300005366 | Bacteria | 1129 |
| 41 | Ga0070709_11187456 | 3300005434 | Unclassified | 613 |
| 42 | Ga0070709_11486947 | 3300005434 | Unclassified | 550 |
| 43 | Ga0070713_100024778 | 3300005436 | Bacteria | 4681 |
| 44 | Ga0070710_10787237 | 3300005437 | Unclassified | 678 |
| 45 | Ga0070701_10001305 | 3300005438 | Bacteria | 9164 |
| 46 | Ga0070705_100995077 | 3300005440 | Bacteria | 680 |
| 47 | Ga0070700_100000025 | 3300005441 | Bacteria | 126198 |
| 48 | Ga0070700_102022567 | 3300005441 | Unclassified | 500 |
| 49 | Ga0070694_100639164 | 3300005444 | Bacteria | 860 |
| 50 | Ga0070708_100014308 | 3300005445 | Bacteria | 6523 |
| 51 | Ga0070708_100347639 | 3300005445 | Bacteria | 1397 |
| 52 | Ga0070708_101588338 | 3300005445 | Unclassified | 609 |
| 53 | Ga0070678_100096947 | 3300005456 | Bacteria | 2276 |
| 54 | Ga0070678_100558098 | 3300005456 | Bacteria | 1017 |
| 55 | Ga0070662_100324358 | 3300005457 | Bacteria | 1256 |
| 56 | Ga0070681_10784132 | 3300005458 | Bacteria | 870 |
| 57 | Ga0070685_10072746 | 3300005466 | Bacteria | 2042 |
| 58 | Ga0070706_100001538 | 3300005467 | Bacteria | 24123 |
| 59 | Ga0070706_100021795 | 3300005467 | Bacteria | 5900 |
| 60 | Ga0070706_100042742 | 3300005467 | Bacteria | 4187 |
| 61 | Ga0070706_100188444 | 3300005467 | Bacteria | 1928 |
| 62 | Ga0070707_100020700 | 3300005468 | Bacteria | 6208 |
| 63 | Ga0070707_100057270 | 3300005468 | Bacteria | 3738 |
| 64 | Ga0070707_100793834 | 3300005468 | Unclassified | 910 |
| 65 | Ga0070707_100949909 | 3300005468 | Bacteria | 825 |
| 66 | Ga0070698_100079094 | 3300005471 | Bacteria | 3285 |
| 67 | Ga0070698_100250619 | 3300005471 | Bacteria | 1703 |
| 68 | Ga0070698_100656716 | 3300005471 | Bacteria | 990 |
| 69 | Ga0070698_100744481 | 3300005471 | Bacteria | 923 |
| 70 | Ga0070698_100846711 | 3300005471 | Unclassified | 859 |
| 71 | Ga0070699_100035518 | 3300005518 | Bacteria | 4308 |
| 72 | Ga0070699_100100634 | 3300005518 | Bacteria | 2533 |
| 73 | Ga0070699_101195569 | 3300005518 | Unclassified | 697 |
| 74 | Ga0070684_100000096 | 3300005535 | Bacteria | 56546 |
| 75 | Ga0070697_100055544 | 3300005536 | Bacteria | 3219 |
| 76 | Ga0070697_100493153 | 3300005536 | Bacteria | 1070 |
| 77 | Ga0070697_101711178 | 3300005536 | Bacteria | 563 |
| 78 | Ga0068853_100207944 | 3300005539 | Bacteria | 1783 |
| 79 | Ga0068853_100539148 | 3300005539 | Bacteria | 1104 |
| 80 | Ga0070672_100005534 | 3300005543 | Bacteria | 8388 |
| 81 | Ga0070672_101710245 | 3300005543 | Unclassified | 565 |
| 82 | Ga0070686_100372015 | 3300005544 | Bacteria | 1079 |
| 83 | Ga0070686_101062710 | 3300005544 | Bacteria | 667 |
| 84 | Ga0070686_101314931 | 3300005544 | Unclassified | 604 |
| 85 | Ga0070693_100016918 | 3300005547 | Bacteria | 3782 |
| 86 | Ga0070704_100227795 | 3300005549 | Bacteria | 1519 |
| 87 | Ga0070704_100231282 | 3300005549 | Unclassified | 1508 |
| 88 | Ga0070704_101114808 | 3300005549 | Bacteria | 717 |
| 89 | Ga0068857_100104511 | 3300005577 | Bacteria | 2543 |
| 90 | Ga0068854_100064231 | 3300005578 | Bacteria | 2667 |
| 91 | Ga0068854_100067381 | 3300005578 | Bacteria | 2608 |
| 92 | Ga0068854_100505944 | 3300005578 | Bacteria | 1018 |
| 93 | Ga0068854_100867986 | 3300005578 | Bacteria | 791 |
| 94 | Ga0070702_100035641 | 3300005615 | Bacteria | 2750 |
| 95 | Ga0070702_100351975 | 3300005615 | Bacteria | 1038 |
| 96 | Ga0070702_100404131 | 3300005615 | Bacteria | 978 |
| 97 | Ga0070702_100659702 | 3300005615 | Bacteria | 792 |
| 98 | Ga0070702_100959579 | 3300005615 | Unclassified | 674 |
| 99 | Ga0070702_101011220 | 3300005615 | Bacteria | 659 |
| 100 | Ga0070702_101170829 | 3300005615 | Unclassified | 618 |
| 101 | Ga0068859_100000001 | 3300005617 | Bacteria | 545224 |
| 102 | Ga0068859_102269675 | 3300005617 | Bacteria | 599 |
| 103 | Ga0068864_100000097 | 3300005618 | Bacteria | 85717 |
| 104 | Ga0068864_102582930 | 3300005618 | Unclassified | 514 |
| 105 | Ga0068866_10584789 | 3300005718 | Bacteria | 751 |
| 106 | Ga0068870_10105851 | 3300005840 | Bacteria | 1598 |
| 107 | Ga0068870_10803059 | 3300005840 | Unclassified | 658 |
| 108 | Ga0068870_10848575 | 3300005840 | Bacteria | 642 |
| 109 | Ga0068858_100000535 | 3300005842 | Bacteria | 39601 |
| 110 | Ga0068858_100638470 | 3300005842 | Bacteria | 1034 |
| 111 | Ga0068860_102463809 | 3300005843 | Bacteria | 540 |
| 112 | Ga0068862_102217019 | 3300005844 | Bacteria | 561 |
| 113 | Ga0070717_10000216 | 3300006028 | Bacteria | 40022 |
| 114 | Ga0070717_10641341 | 3300006028 | Bacteria | 964 |
| 115 | Ga0070717_11453840 | 3300006028 | Bacteria | 622 |
| 116 | Ga0070717_11574331 | 3300006028 | Unclassified | 596 |
| 117 | Ga0070716_100083236 | 3300006173 | Bacteria | 1916 |
| 118 | Ga0070716_100116870 | 3300006173 | Bacteria | 1663 |
| 119 | Ga0070716_100644633 | 3300006173 | Bacteria | 802 |
| 120 | Ga0070716_101159875 | 3300006173 | Bacteria | 619 |
| 121 | Ga0070716_101731355 | 3300006173 | Unclassified | 516 |
| 122 | Ga0097621_100118187 | 3300006237 | Bacteria | 2247 |
| 123 | Ga0068871_100271422 | 3300006358 | Bacteria | 1482 |
| 124 | Ga0075428_100052044 | 3300006844 | Bacteria | 4490 |
| 125 | Ga0075431_100085485 | 3300006847 | Bacteria | 3256 |
| 126 | Ga0075431_100625209 | 3300006847 | Bacteria | 1059 |
| 127 | Ga0075434_100448146 | 3300006871 | Bacteria | 1312 |
| 128 | Ga0075434_100569595 | 3300006871 | Bacteria | 1152 |
| 129 | Ga0075434_100866891 | 3300006871 | Unclassified | 918 |
| 130 | Ga0075429_100068657 | 3300006880 | Bacteria | 3085 |
| 131 | Ga0075429_100182636 | 3300006880 | Bacteria | 1838 |
| 132 | Ga0075429_100709584 | 3300006880 | Unclassified | 881 |
| 133 | Ga0075429_101799434 | 3300006880 | Bacteria | 531 |
| 134 | Ga0068865_100318150 | 3300006881 | Bacteria | 1251 |
| 135 | Ga0068865_101478492 | 3300006881 | Bacteria | 608 |
| 136 | Ga0075436_100000807 | 3300006914 | Bacteria | 20806 |
| 137 | Ga0075436_100387512 | 3300006914 | Unclassified | 1011 |
| 138 | Ga0075436_100645829 | 3300006914 | Bacteria | 781 |
| 139 | Ga0097620_100000001 | 3300006931 | Bacteria | 545224 |
| 140 | Ga0097620_102269605 | 3300006931 | Bacteria | 599 |
| 141 | Ga0075435_100000252 | 3300007076 | Bacteria | 33173 |
| 142 | Ga0075435_100012323 | 3300007076 | Bacteria | 6326 |
| 143 | Ga0075435_100142723 | 3300007076 | Bacteria | 2010 |
| 144 | Ga0075435_100196059 | 3300007076 | Bacteria | 1710 |
| 145 | Ga0075435_101373173 | 3300007076 | Bacteria | 619 |
| 146 | Ga0105240_10068609 | 3300009093 | Bacteria | 4391 |
| 147 | Ga0111539_10000052 | 3300009094 | Bacteria | 116307 |
| 148 | Ga0105245_10000004 | 3300009098 | Bacteria | 470684 |
| 149 | Ga0105245_10000937 | 3300009098 | Bacteria | 26512 |
| 150 | Ga0105245_10064849 | 3300009098 | Bacteria | 3302 |
| 151 | Ga0105245_10151159 | 3300009098 | Bacteria | 2196 |
| 152 | Ga0105245_11732452 | 3300009098 | Unclassified | 677 |
| 153 | Ga0105247_10116919 | 3300009101 | Bacteria | 1723 |
| 154 | Ga0114129_10377191 | 3300009147 | Bacteria | 1874 |
| 155 | Ga0114129_11464743 | 3300009147 | Bacteria | 840 |
| 156 | Ga0114129_12082223 | 3300009147 | Bacteria | 685 |
| 157 | Ga0105243_11025416 | 3300009148 | Unclassified | 829 |
| 158 | Ga0105242_10030591 | 3300009176 | Bacteria | 4299 |
| 159 | Ga0105242_11318007 | 3300009176 | Bacteria | 746 |
| 160 | Ga0105248_12853461 | 3300009177 | Unclassified | 551 |
| 161 | Ga0105238_10000001 | 3300009551 | Bacteria | 2036163 |
| 162 | Ga0105239_10012662 | 3300010375 | Bacteria | 9384 |
| 163 | Ga0105246_10091700 | 3300011119 | Bacteria | 2191 |
| 164 | Ga0105246_10685976 | 3300011119 | Bacteria | 896 |
| 165 | Ga0157371_11355388 | 3300013102 | Bacteria | 552 |
| 166 | Ga0157369_10001042 | 3300013105 | Bacteria | 35030 |
| 167 | Ga0157369_10116379 | 3300013105 | Bacteria | 2839 |
| 168 | Ga0157374_10000012 | 3300013296 | Bacteria | 462353 |
| 169 | Ga0157374_10310603 | 3300013296 | Unclassified | 1561 |
| 170 | Ga0157378_10001092 | 3300013297 | Bacteria | 24799 |
| 171 | Ga0157378_10002176 | 3300013297 | Bacteria | 17386 |
| 172 | Ga0157378_10004244 | 3300013297 | Bacteria | 12642 |
| 173 | Ga0157378_11066136 | 3300013297 | Bacteria | 844 |
| 174 | Ga0157378_11446598 | 3300013297 | Unclassified | 731 |
| 175 | Ga0163162_10051092 | 3300013306 | Bacteria | 4146 |
| 176 | Ga0163162_11553377 | 3300013306 | Bacteria | 754 |
| 177 | Ga0157375_10000001 | 3300013308 | Bacteria | 696576 |
| 178 | Ga0157375_10000008 | 3300013308 | Bacteria | 373560 |
| 179 | Ga0157375_10001458 | 3300013308 | Bacteria | 20339 |
| 180 | Ga0163163_10528497 | 3300014325 | Bacteria | 1242 |
| 181 | Ga0163163_10635482 | 3300014325 | Bacteria | 1131 |
| 182 | Ga0157380_10054037 | 3300014326 | Bacteria | 3186 |
| 183 | Ga0157380_10658400 | 3300014326 | Bacteria | 1046 |
| 184 | Ga0157377_10000002 | 3300014745 | Bacteria | 473827 |
| 185 | Ga0157377_10000024 | 3300014745 | Bacteria | 142391 |
| 186 | Ga0157377_10196382 | 3300014745 | Bacteria | 1278 |
| 187 | Ga0157377_11527695 | 3300014745 | Bacteria | 532 |
| 188 | Ga0157376_10000025 | 3300014969 | Bacteria | 214212 |
| 189 | Ga0213873_10000002 | 3300021358 | Bacteria | 1164195 |
| 190 | Ga0213873_10009577 | 3300021358 | Bacteria | 2016 |
| 191 | Ga0213874_10017685 | 3300021377 | Bacteria | 1916 |
| 192 | Ga0213876_10000001 | 3300021384 | Bacteria | 1186326 |
| 193 | Ga0213876_10000080 | 3300021384 | Bacteria | 109125 |
| 194 | Ga0213876_10025189 | 3300021384 | Bacteria | 3140 |
| 195 | Ga0213875_10641497 | 3300021388 | Bacteria | 514 |
| 196 | Ga0207697_10472139 | 3300025315 | Unclassified | 555 |
| 197 | Ga0207656_10163747 | 3300025321 | Bacteria | 1060 |
| 198 | Ga0207692_10703784 | 3300025898 | Unclassified | 656 |
| 199 | Ga0207642_10999773 | 3300025899 | Unclassified | 538 |
| 200 | Ga0207647_10554034 | 3300025904 | Bacteria | 637 |
| 201 | Ga0207645_10273173 | 3300025907 | Unclassified | 1121 |
| 202 | Ga0207643_10233611 | 3300025908 | Bacteria | 1128 |
| 203 | Ga0207643_10328935 | 3300025908 | Unclassified | 956 |
| 204 | Ga0207643_10503181 | 3300025908 | Unclassified | 774 |
| 205 | Ga0207684_10021317 | 3300025910 | Bacteria | 5532 |
| 206 | Ga0207684_10481815 | 3300025910 | Bacteria | 1064 |
| 207 | Ga0207684_11222102 | 3300025910 | Bacteria | 621 |
| 208 | Ga0207707_10492052 | 3300025912 | Bacteria | 1047 |
| 209 | Ga0207695_10115270 | 3300025913 | Bacteria | 2661 |
| 210 | Ga0207660_10224619 | 3300025917 | Bacteria | 1475 |
| 211 | Ga0207662_10018606 | 3300025918 | Bacteria | 3946 |
| 212 | Ga0207662_10273502 | 3300025918 | Unclassified | 1115 |
| 213 | Ga0207662_10665881 | 3300025918 | Bacteria | 728 |
| 214 | Ga0207662_11244460 | 3300025918 | Unclassified | 529 |
| 215 | Ga0207646_10020083 | 3300025922 | Bacteria | 6196 |
| 216 | Ga0207646_10089955 | 3300025922 | Bacteria | 2748 |
| 217 | Ga0207646_10095108 | 3300025922 | Bacteria | 2669 |
| 218 | Ga0207646_10410025 | 3300025922 | Bacteria | 1223 |
| 219 | Ga0207681_11425826 | 3300025923 | Unclassified | 581 |
| 220 | Ga0207694_10000001 | 3300025924 | Bacteria | 4078485 |
| 221 | Ga0207650_10000262 | 3300025925 | Bacteria | 56131 |
| 222 | Ga0207650_10016449 | 3300025925 | Bacteria | 5171 |
| 223 | Ga0207650_10284687 | 3300025925 | Bacteria | 1347 |
| 224 | Ga0207659_10000067 | 3300025926 | Bacteria | 66315 |
| 225 | Ga0207687_10000003 | 3300025927 | Bacteria | 875159 |
| 226 | Ga0207687_10008044 | 3300025927 | Bacteria | 6900 |
| 227 | Ga0207687_11219466 | 3300025927 | Bacteria | 647 |
| 228 | Ga0207687_11646033 | 3300025927 | Unclassified | 550 |
| 229 | Ga0207700_10014335 | 3300025928 | Bacteria | 5192 |
| 230 | Ga0207644_10120812 | 3300025931 | Bacteria | 1994 |
| 231 | Ga0207690_10277415 | 3300025932 | Bacteria | 1304 |
| 232 | Ga0207686_10005136 | 3300025934 | Bacteria | 7037 |
| 233 | Ga0207670_10001392 | 3300025936 | Bacteria | 12715 |
| 234 | Ga0207670_10459894 | 3300025936 | Unclassified | 1027 |
| 235 | Ga0207669_10144148 | 3300025937 | Bacteria | 1658 |
| 236 | Ga0207704_10275075 | 3300025938 | Bacteria | 1277 |
| 237 | Ga0207665_10068514 | 3300025939 | Bacteria | 2418 |
| 238 | Ga0207665_10140207 | 3300025939 | Bacteria | 1723 |
| 239 | Ga0207665_11280864 | 3300025939 | Bacteria | 584 |
| 240 | Ga0207665_11459988 | 3300025939 | Unclassified | 544 |
| 241 | Ga0207691_10001623 | 3300025940 | Bacteria | 22338 |
| 242 | Ga0207689_10069927 | 3300025942 | Bacteria | 2884 |
| 243 | Ga0207689_10193553 | 3300025942 | Bacteria | 1678 |
| 244 | Ga0207689_11238340 | 3300025942 | Unclassified | 628 |
| 245 | Ga0207689_11575315 | 3300025942 | Bacteria | 547 |
| 246 | Ga0207661_10000001 | 3300025944 | Bacteria | 937688 |
| 247 | Ga0207661_10442978 | 3300025944 | Bacteria | 1182 |
| 248 | Ga0207661_11162071 | 3300025944 | Bacteria | 710 |
| 249 | Ga0207679_11567472 | 3300025945 | Bacteria | 604 |
| 250 | Ga0207651_10283468 | 3300025960 | Bacteria | 1370 |
| 251 | Ga0207651_11118869 | 3300025960 | Bacteria | 706 |
| 252 | Ga0207651_11318484 | 3300025960 | Bacteria | 649 |
| 253 | Ga0207640_10005221 | 3300025981 | Bacteria | 7068 |
| 254 | Ga0207640_10381888 | 3300025981 | Bacteria | 1141 |
| 255 | Ga0207640_10590295 | 3300025981 | Bacteria | 939 |
| 256 | Ga0207640_11319831 | 3300025981 | Bacteria | 644 |
| 257 | Ga0207677_10000035 | 3300026023 | Bacteria | 117469 |
| 258 | Ga0207677_10000249 | 3300026023 | Bacteria | 41568 |
| 259 | Ga0207703_10000046 | 3300026035 | Bacteria | 154474 |
| 260 | Ga0207703_10538572 | 3300026035 | Bacteria | 1100 |
| 261 | Ga0207703_10936797 | 3300026035 | Bacteria | 830 |
| 262 | Ga0207639_10000051 | 3300026041 | Bacteria | 113927 |
| 263 | Ga0207639_10202741 | 3300026041 | Bacteria | 1703 |
| 264 | Ga0207639_10385253 | 3300026041 | Bacteria | 1260 |
| 265 | Ga0207708_10000052 | 3300026075 | Bacteria | 105169 |
| 266 | Ga0207648_11893564 | 3300026089 | Bacteria | 558 |
| 267 | Ga0207676_10000013 | 3300026095 | Bacteria | 343067 |
| 268 | Ga0207674_10130139 | 3300026116 | Bacteria | 2481 |
| 269 | Ga0207674_10596029 | 3300026116 | Bacteria | 1067 |
| 270 | Ga0207675_102607203 | 3300026118 | Bacteria | 515 |
| 271 | Ga0207683_11353689 | 3300026121 | Bacteria | 659 |
| 272 | Ga0207428_10000003 | 3300027907 | Bacteria | 799783 |
| 273 | Ga0268265_11156655 | 3300028380 | Unclassified | 770 |
| 274 | Ga0268264_11660342 | 3300028381 | Unclassified | 649 |
| 275 | Ga0265338_10340060 | 3300028800 | Bacteria | 1082 |
| 276 | Ga0307511_10006860 | 3300030521 | Bacteria | 11483 |
| 277 | Ga0265316_10049285 | 3300031344 | Bacteria | 3319 |
| 278 | Ga0307408_101806945 | 3300031548 | Bacteria | 584 |
| 279 | Ga0307405_10688404 | 3300031731 | Bacteria | 845 |
| 280 | Ga0307409_101589652 | 3300031995 | Unclassified | 682 |
| 281 | Ga0307416_100757295 | 3300032002 | Bacteria | 1064 |
| 282 | Ga0307416_103330341 | 3300032002 | Bacteria | 538 |
| 283 | Ga0307416_103781217 | 3300032002 | Bacteria | 507 |
| 284 | Ga0307415_102294295 | 3300032126 | Bacteria | 529 |
| 285 | Ga0373932_0000024 | 3300035112 | Bacteria | 45717 |
| 286 | Ga0373941_0122334 | 3300035115 | Bacteria | 929 |
| 287 | Ga0373937_1669576 | 3300036401 | Bacteria | 584 |
| 288 | Ga0436364_0698840 | 3300037853 | Bacteria | 514 |
| 289 | Ga0436365_0138728 | 3300039437 | Bacteria | 44994 |
| 290 | Ga0436365_0204561 | 3300039437 | Bacteria | 3341 |
| 291 | Ga0436365_0205514 | 3300039437 | Bacteria | 3338 |
| 292 | Ga0436365_0404975 | 3300039437 | Bacteria | 180420 |
| 293 | Ga0436365_1060264 | 3300039437 | Bacteria | 980 |
| 294 | Ga0436363_0020087 | 3300039450 | Bacteria | 2457 |
| 295 | Ga0436363_0813118 | 3300039450 | Unclassified | 921 |
| 296 | Ga0436363_1380009 | 3300039450 | Bacteria | 832 |
| 297 | Ga0436362_0456560 | 3300039453 | Bacteria | 874 |
| 298 | Ga0436362_0660519 | 3300039453 | Bacteria | 832172 |
| 299 | Ga0436362_0828847 | 3300039453 | Bacteria | 760 |
| 300 | Ga0436362_0839370 | 3300039453 | Bacteria | 3050 |
| 301 | Ga0451787_277244 | 3300041441 | Unclassified | 580 |
| 302 | Ga0451839_0238746 | 3300041496 | Bacteria | 1388 |
| 303 | Ga0451577_0146517 | 3300042876 | Bacteria | 2123 |
| 304 | Ga0451577_2039693 | 3300042876 | Bacteria | 501 |
| 305 | Ga0453683_0124155 | 3300044673 | Bacteria | 1625 |
| 306 | Ga0453683_0591012 | 3300044673 | Bacteria | 724 |
| 307 | Ga0453684_0043569 | 3300044712 | Bacteria | 6029 |
| 308 | Ga0451576_0373048 | 3300045051 | Bacteria | 1495 |
| 309 | Ga0451576_1570583 | 3300045051 | Bacteria | 683 |
| 310 | Ga0495651_0794567 | 3300046462 | Bacteria | 584 |
| 311 | Ga0495620_0004380 | 3300046515 | Bacteria | 7966 |
| 312 | Ga0495628_0118147 | 3300046516 | Bacteria | 2036 |
| 313 | Ga0495598_0458847 | 3300046537 | Bacteria | 505 |
| 314 | Ga0495621_0145581 | 3300046539 | Unclassified | 929 |
| 315 | Ga0495599_0314835 | 3300046678 | Bacteria | 943 |
| 316 | Ga0495613_0768883 | 3300046689 | Bacteria | 630 |
| 317 | Ga0495636_0682870 | 3300047318 | Bacteria | 506 |
| 318 | Ga0496104_0273844 | 3300048907 | Bacteria | 1601 |
| 319 | Ga0496106_0125645 | 3300048909 | Bacteria | 2008 |
| 320 | Ga0496112_0653403 | 3300048915 | Bacteria | 981 |
| 321 | Ga0501073_0005175 | 3300049589 | Bacteria | 9784 |
| 322 | Ga0501080_1409025 | 3300049742 | Bacteria | 594 |
| 323 | nmdc:mga05p37_1147804_c1 | 3300050507 | Bacteria | 808 |
| 324 | nmdc:mga05p37_1706132_c1 | 3300050507 | Bacteria | 614 |
| 325 | nmdc:mga05p37_2061854_c1 | 3300050507 | Bacteria | 536 |
| 326 | nmdc:mga09592_42023_c1 | 3300050508 | Bacteria | 3845 |
| 327 | nmdc:mga09592_625396_c1 | 3300050508 | Unclassified | 921 |
| 328 | nmdc:mga06r32_1055230_c1 | 3300050510 | Unclassified | 763 |
| 329 | nmdc:mga06r32_76196_c1 | 3300050510 | Bacteria | 3257 |
| 330 | nmdc:mga08y16_4_c1 | 3300050511 | Bacteria | 916963 |
| 331 | nmdc:mga0n895_1656606_c1 | 3300050512 | Unclassified | 603 |
| 332 | nmdc:mga0n895_535159_c1 | 3300050512 | Unclassified | 1178 |
| 333 | nmdc:mga0rr50_198538_c1 | 3300050513 | Bacteria | 1647 |
| 334 | nmdc:mga0rr50_214001_c1 | 3300050513 | Bacteria | 1589 |
| 335 | nmdc:mga0rr50_23010_c1 | 3300050513 | Bacteria | 4287 |
| 336 | nmdc:mga0rr50_37_c1 | 3300050513 | Bacteria | 87211 |
| 337 | nmdc:mga08x19_2353_c1 | 3300050514 | Bacteria | 11477 |
| 338 | Ga0495655_0013697 | 3300053083 | Bacteria | 1683 |
| 339 | Ga0501082_1179635 | 3300060353 | Bacteria | 669 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300013297 | Ga0157378_11446598 | Ga0157378_114465982 | 64 |
| 2 | 3300009101 | Ga0105247_10116919 | Ga0105247_101169193 | 65 |
| 3 | 3300009093 | Ga0105240_10068609 | Ga0105240_100686092 | 66 |
| 4 | 3300013105 | Ga0157369_10116379 | Ga0157369_101163794 | 66 |
| 5 | 3300005328 | Ga0070676_10400682 | Ga0070676_104006822 | 69 |
| 6 | 3300005329 | Ga0070683_101465384 | Ga0070683_1014653841 | 69 |
| 7 | 3300005331 | Ga0070670_101066237 | Ga0070670_1010662371 | 69 |
| 8 | 3300005334 | Ga0068869_100049503 | Ga0068869_1000495032 | 69 |
| 9 | 3300005334 | Ga0068869_101368046 | Ga0068869_1013680462 | 69 |
| 10 | 3300005334 | Ga0068869_101462874 | Ga0068869_1014628741 | 69 |
| 11 | 3300005337 | Ga0070682_100000001 | Ga0070682_100000001529 | 69 |
| 12 | 3300005338 | Ga0068868_100004748 | Ga0068868_1000047483 | 69 |
| 13 | 3300005340 | Ga0070689_100000313 | Ga0070689_1000003132 | 69 |
| 14 | 3300005353 | Ga0070669_100912187 | Ga0070669_1009121872 | 69 |
| 15 | 3300005356 | Ga0070674_100057961 | Ga0070674_1000579613 | 69 |
| 16 | 3300005364 | Ga0070673_100325867 | Ga0070673_1003258672 | 69 |
| 17 | 3300005364 | Ga0070673_101677165 | Ga0070673_1016771652 | 69 |
| 18 | 3300005366 | Ga0070659_100421532 | Ga0070659_1004215322 | 69 |
| 19 | 3300005434 | Ga0070709_11187456 | Ga0070709_111874562 | 69 |
| 20 | 3300005436 | Ga0070713_100024778 | Ga0070713_1000247782 | 69 |
| 21 | 3300005437 | Ga0070710_10787237 | Ga0070710_107872371 | 69 |
| 22 | 3300005440 | Ga0070705_100995077 | Ga0070705_1009950772 | 69 |
| 23 | 3300005445 | Ga0070708_101588338 | Ga0070708_1015883381 | 69 |
| 24 | 3300005456 | Ga0070678_100558098 | Ga0070678_1005580981 | 69 |
| 25 | 3300005457 | Ga0070662_100324358 | Ga0070662_1003243582 | 69 |
| 26 | 3300005467 | Ga0070706_100188444 | Ga0070706_1001884443 | 69 |
| 27 | 3300005468 | Ga0070707_100020700 | Ga0070707_1000207003 | 69 |
| 28 | 3300005471 | Ga0070698_100744481 | Ga0070698_1007444812 | 69 |
| 29 | 3300005539 | Ga0068853_100539148 | Ga0068853_1005391482 | 69 |
| 30 | 3300005543 | Ga0070672_100005534 | Ga0070672_1000055345 | 69 |
| 31 | 3300005547 | Ga0070693_100016918 | Ga0070693_1000169182 | 69 |
| 32 | 3300005577 | Ga0068857_100104511 | Ga0068857_1001045112 | 69 |
| 33 | 3300005578 | Ga0068854_100505944 | Ga0068854_1005059442 | 69 |
| 34 | 3300005615 | Ga0070702_100035641 | Ga0070702_1000356414 | 69 |
| 35 | 3300005615 | Ga0070702_100659702 | Ga0070702_1006597021 | 69 |
| 36 | 3300005615 | Ga0070702_101170829 | Ga0070702_1011708292 | 69 |
| 37 | 3300005617 | Ga0068859_102269675 | Ga0068859_1022696751 | 69 |
| 38 | 3300005618 | Ga0068864_100000097 | Ga0068864_10000009711 | 69 |
| 39 | 3300005618 | Ga0068864_102582930 | Ga0068864_1025829301 | 69 |
| 40 | 3300005718 | Ga0068866_10584789 | Ga0068866_105847892 | 69 |
| 41 | 3300005840 | Ga0068870_10105851 | Ga0068870_101058512 | 69 |
| 42 | 3300005840 | Ga0068870_10803059 | Ga0068870_108030592 | 69 |
| 43 | 3300005840 | Ga0068870_10848575 | Ga0068870_108485751 | 69 |
| 44 | 3300005842 | Ga0068858_100000535 | Ga0068858_10000053528 | 69 |
| 45 | 3300006028 | Ga0070717_10000216 | Ga0070717_1000021627 | 69 |
| 46 | 3300006028 | Ga0070717_10641341 | Ga0070717_106413412 | 69 |
| 47 | 3300006028 | Ga0070717_11453840 | Ga0070717_114538402 | 69 |
| 48 | 3300006028 | Ga0070717_11574331 | Ga0070717_115743312 | 69 |
| 49 | 3300006173 | Ga0070716_100083236 | Ga0070716_1000832363 | 69 |
| 50 | 3300006173 | Ga0070716_100116870 | Ga0070716_1001168702 | 69 |
| 51 | 3300006173 | Ga0070716_100644633 | Ga0070716_1006446332 | 69 |
| 52 | 3300006173 | Ga0070716_101159875 | Ga0070716_1011598752 | 69 |
| 53 | 3300006871 | Ga0075434_100448146 | Ga0075434_1004481463 | 69 |
| 54 | 3300006871 | Ga0075434_100569595 | Ga0075434_1005695952 | 69 |
| 55 | 3300006871 | Ga0075434_100866891 | Ga0075434_1008668912 | 69 |
| 56 | 3300006881 | Ga0068865_100318150 | Ga0068865_1003181502 | 69 |
| 57 | 3300006881 | Ga0068865_101478492 | Ga0068865_1014784922 | 69 |
| 58 | 3300006914 | Ga0075436_100000807 | Ga0075436_10000080711 | 69 |
| 59 | 3300006914 | Ga0075436_100645829 | Ga0075436_1006458292 | 69 |
| 60 | 3300006931 | Ga0097620_102269605 | Ga0097620_1022696051 | 69 |
| 61 | 3300007076 | Ga0075435_100000252 | Ga0075435_10000025218 | 69 |
| 62 | 3300007076 | Ga0075435_100012323 | Ga0075435_1000123235 | 69 |
| 63 | 3300007076 | Ga0075435_100142723 | Ga0075435_1001427233 | 69 |
| 64 | 3300007076 | Ga0075435_101373173 | Ga0075435_1013731732 | 69 |
| 65 | 3300009098 | Ga0105245_10000937 | Ga0105245_1000093711 | 69 |
| 66 | 3300009098 | Ga0105245_10064849 | Ga0105245_100648492 | 69 |
| 67 | 3300009098 | Ga0105245_10151159 | Ga0105245_101511593 | 69 |
| 68 | 3300009147 | Ga0114129_11464743 | Ga0114129_114647432 | 69 |
| 69 | 3300009176 | Ga0105242_11318007 | Ga0105242_113180072 | 69 |
| 70 | 3300009177 | Ga0105248_12853461 | Ga0105248_128534611 | 69 |
| 71 | 3300010375 | Ga0105239_10012662 | Ga0105239_100126623 | 69 |
| 72 | 3300013297 | Ga0157378_10004244 | Ga0157378_1000424415 | 69 |
| 73 | 3300013297 | Ga0157378_11066136 | Ga0157378_110661362 | 69 |
| 74 | 3300013306 | Ga0163162_10051092 | Ga0163162_100510922 | 69 |
| 75 | 3300013306 | Ga0163162_11553377 | Ga0163162_115533772 | 69 |
| 76 | 3300013308 | Ga0157375_10000001 | Ga0157375_1000000117 | 69 |
| 77 | 3300014326 | Ga0157380_10054037 | Ga0157380_100540373 | 69 |
| 78 | 3300014745 | Ga0157377_10000024 | Ga0157377_10000024132 | 69 |
| 79 | 3300014745 | Ga0157377_10196382 | Ga0157377_101963823 | 69 |
| 80 | 3300021377 | Ga0213874_10017685 | Ga0213874_100176852 | 69 |
| 81 | 3300025898 | Ga0207692_10703784 | Ga0207692_107037841 | 69 |
| 82 | 3300025899 | Ga0207642_10999773 | Ga0207642_109997732 | 69 |
| 83 | 3300025908 | Ga0207643_10233611 | Ga0207643_102336112 | 69 |
| 84 | 3300025908 | Ga0207643_10503181 | Ga0207643_105031812 | 69 |
| 85 | 3300025910 | Ga0207684_11222102 | Ga0207684_112221022 | 69 |
| 86 | 3300025913 | Ga0207695_10115270 | Ga0207695_101152702 | 69 |
| 87 | 3300025918 | Ga0207662_10665881 | Ga0207662_106658812 | 69 |
| 88 | 3300025922 | Ga0207646_10020083 | Ga0207646_100200833 | 69 |
| 89 | 3300025923 | Ga0207681_11425826 | Ga0207681_114258262 | 69 |
| 90 | 3300025925 | Ga0207650_10284687 | Ga0207650_102846873 | 69 |
| 91 | 3300025927 | Ga0207687_10008044 | Ga0207687_100080442 | 69 |
| 92 | 3300025927 | Ga0207687_11219466 | Ga0207687_112194662 | 69 |
| 93 | 3300025928 | Ga0207700_10014335 | Ga0207700_100143356 | 69 |
| 94 | 3300025932 | Ga0207690_10277415 | Ga0207690_102774152 | 69 |
| 95 | 3300025936 | Ga0207670_10001392 | Ga0207670_1000139210 | 69 |
| 96 | 3300025937 | Ga0207669_10144148 | Ga0207669_101441482 | 69 |
| 97 | 3300025938 | Ga0207704_10275075 | Ga0207704_102750752 | 69 |
| 98 | 3300025939 | Ga0207665_10068514 | Ga0207665_100685144 | 69 |
| 99 | 3300025939 | Ga0207665_10140207 | Ga0207665_101402072 | 69 |
| 100 | 3300025939 | Ga0207665_11280864 | Ga0207665_112808642 | 69 |
| 101 | 3300025939 | Ga0207665_11459988 | Ga0207665_114599882 | 69 |
| 102 | 3300025940 | Ga0207691_10001623 | Ga0207691_1000162319 | 69 |
| 103 | 3300025942 | Ga0207689_10069927 | Ga0207689_100699274 | 69 |
| 104 | 3300025942 | Ga0207689_11575315 | Ga0207689_115753152 | 69 |
| 105 | 3300025944 | Ga0207661_11162071 | Ga0207661_111620711 | 69 |
| 106 | 3300025945 | Ga0207679_11567472 | Ga0207679_115674722 | 69 |
| 107 | 3300025960 | Ga0207651_10283468 | Ga0207651_102834682 | 69 |
| 108 | 3300025981 | Ga0207640_11319831 | Ga0207640_113198312 | 69 |
| 109 | 3300026023 | Ga0207677_10000035 | Ga0207677_1000003520 | 69 |
| 110 | 3300026035 | Ga0207703_10000046 | Ga0207703_10000046130 | 69 |
| 111 | 3300026035 | Ga0207703_10936797 | Ga0207703_109367972 | 69 |
| 112 | 3300026041 | Ga0207639_10000051 | Ga0207639_1000005166 | 69 |
| 113 | 3300026041 | Ga0207639_10385253 | Ga0207639_103852532 | 69 |
| 114 | 3300026095 | Ga0207676_10000013 | Ga0207676_10000013234 | 69 |
| 115 | 3300026116 | Ga0207674_10130139 | Ga0207674_101301392 | 69 |
| 116 | 3300026121 | Ga0207683_11353689 | Ga0207683_113536892 | 69 |
| 117 | 3300031548 | Ga0307408_101806945 | Ga0307408_1018069452 | 69 |
| 118 | 3300031731 | Ga0307405_10688404 | Ga0307405_106884042 | 69 |
| 119 | 3300031995 | Ga0307409_101589652 | Ga0307409_1015896521 | 69 |
| 120 | 3300032002 | Ga0307416_100757295 | Ga0307416_1007572952 | 69 |
| 121 | 3300032002 | Ga0307416_103330341 | Ga0307416_1033303411 | 69 |
| 122 | 3300032002 | Ga0307416_103781217 | Ga0307416_1037812171 | 69 |
| 123 | 3300035112 | Ga0373932_0000024 | Ga0373932_0000024_27629_27841 | 69 |
| 124 | 3300039437 | Ga0436365_1060264 | Ga0436365_1060264_708_920 | 69 |
| 125 | 3300039450 | Ga0436363_0020087 | Ga0436363_0020087_1689_1901 | 69 |
| 126 | 3300039450 | Ga0436363_0813118 | Ga0436363_0813118_399_611 | 69 |
| 127 | 3300039453 | Ga0436362_0456560 | Ga0436362_0456560_380_589 | 69 |
| 128 | 3300045051 | Ga0451576_0373048 | Ga0451576_0373048_961_1170 | 69 |
| 129 | 3300050507 | nmdc:mga05p37_1147804_c1 | nmdc:mga05p37_1147804_c1_443_652 | 69 |
| 130 | 3300050512 | nmdc:mga0n895_1656606_c1 | nmdc:mga0n895_1656606_c1_183_398 | 69 |
| 131 | 3300050513 | nmdc:mga0rr50_198538_c1 | nmdc:mga0rr50_198538_c1_446_661 | 69 |
| 132 | 3300050513 | nmdc:mga0rr50_23010_c1 | nmdc:mga0rr50_23010_c1_2811_3020 | 69 |
| 133 | 3300050513 | nmdc:mga0rr50_37_c1 | nmdc:mga0rr50_37_c1_33667_33876 | 69 |
| 134 | 3300050514 | nmdc:mga08x19_2353_c1 | nmdc:mga08x19_2353_c1_7488_7697 | 69 |
| 135 | 3300053083 | Ga0495655_0013697 | Ga0495655_0013697_1424_1633 | 69 |
| 136 | 3300060353 | Ga0501082_1179635 | Ga0501082_1179635_241_453 | 69 |
| 137 | 3300005329 | Ga0070683_100000068 | Ga0070683_10000006823 | 70 |
| 138 | 3300005329 | Ga0070683_100269134 | Ga0070683_1002691342 | 70 |
| 139 | 3300005331 | Ga0070670_100000307 | Ga0070670_10000030734 | 70 |
| 140 | 3300005334 | Ga0068869_100160079 | Ga0068869_1001600792 | 70 |
| 141 | 3300005334 | Ga0068869_101321765 | Ga0068869_1013217652 | 70 |
| 142 | 3300005336 | Ga0070680_101069128 | Ga0070680_1010691282 | 70 |
| 143 | 3300005337 | Ga0070682_100080448 | Ga0070682_1000804484 | 70 |
| 144 | 3300005338 | Ga0068868_100000163 | Ga0068868_10000016332 | 70 |
| 145 | 3300005345 | Ga0070692_10043278 | Ga0070692_100432782 | 70 |
| 146 | 3300005354 | Ga0070675_100000005 | Ga0070675_10000000530 | 70 |
| 147 | 3300005364 | Ga0070673_100359425 | Ga0070673_1003594252 | 70 |
| 148 | 3300005364 | Ga0070673_101226276 | Ga0070673_1012262762 | 70 |
| 149 | 3300005434 | Ga0070709_11486947 | Ga0070709_114869472 | 70 |
| 150 | 3300005441 | Ga0070700_100000025 | Ga0070700_10000002534 | 70 |
| 151 | 3300005458 | Ga0070681_10784132 | Ga0070681_107841321 | 70 |
| 152 | 3300005471 | Ga0070698_100656716 | Ga0070698_1006567162 | 70 |
| 153 | 3300005518 | Ga0070699_100100634 | Ga0070699_1001006344 | 70 |
| 154 | 3300005535 | Ga0070684_100000096 | Ga0070684_1000000966 | 70 |
| 155 | 3300005539 | Ga0068853_100207944 | Ga0068853_1002079442 | 70 |
| 156 | 3300005543 | Ga0070672_101710245 | Ga0070672_1017102451 | 70 |
| 157 | 3300005549 | Ga0070704_101114808 | Ga0070704_1011148081 | 70 |
| 158 | 3300005578 | Ga0068854_100064231 | Ga0068854_1000642313 | 70 |
| 159 | 3300005578 | Ga0068854_100067381 | Ga0068854_1000673812 | 70 |
| 160 | 3300005578 | Ga0068854_100867986 | Ga0068854_1008679862 | 70 |
| 161 | 3300005615 | Ga0070702_100404131 | Ga0070702_1004041311 | 70 |
| 162 | 3300005615 | Ga0070702_101011220 | Ga0070702_1010112202 | 70 |
| 163 | 3300005842 | Ga0068858_100638470 | Ga0068858_1006384702 | 70 |
| 164 | 3300005843 | Ga0068860_102463809 | Ga0068860_1024638092 | 70 |
| 165 | 3300005844 | Ga0068862_102217019 | Ga0068862_1022170192 | 70 |
| 166 | 3300006237 | Ga0097621_100118187 | Ga0097621_1001181872 | 70 |
| 167 | 3300006358 | Ga0068871_100271422 | Ga0068871_1002714222 | 70 |
| 168 | 3300006844 | Ga0075428_100052044 | Ga0075428_1000520443 | 70 |
| 169 | 3300006847 | Ga0075431_100625209 | Ga0075431_1006252092 | 70 |
| 170 | 3300006880 | Ga0075429_100182636 | Ga0075429_1001826362 | 70 |
| 171 | 3300006880 | Ga0075429_101799434 | Ga0075429_1017994342 | 70 |
| 172 | 3300006914 | Ga0075436_100387512 | Ga0075436_1003875122 | 70 |
| 173 | 3300007076 | Ga0075435_100196059 | Ga0075435_1001960592 | 70 |
| 174 | 3300009098 | Ga0105245_10000004 | Ga0105245_1000000435 | 70 |
| 175 | 3300009147 | Ga0114129_10377191 | Ga0114129_103771912 | 70 |
| 176 | 3300009147 | Ga0114129_12082223 | Ga0114129_120822232 | 70 |
| 177 | 3300009148 | Ga0105243_11025416 | Ga0105243_110254162 | 70 |
| 178 | 3300009176 | Ga0105242_10030591 | Ga0105242_100305915 | 70 |
| 179 | 3300009551 | Ga0105238_10000001 | Ga0105238_10000001554 | 70 |
| 180 | 3300011119 | Ga0105246_10091700 | Ga0105246_100917002 | 70 |
| 181 | 3300011119 | Ga0105246_10685976 | Ga0105246_106859762 | 70 |
| 182 | 3300013105 | Ga0157369_10001042 | Ga0157369_1000104230 | 70 |
| 183 | 3300013296 | Ga0157374_10000012 | Ga0157374_10000012119 | 70 |
| 184 | 3300013296 | Ga0157374_10310603 | Ga0157374_103106033 | 70 |
| 185 | 3300013297 | Ga0157378_10001092 | Ga0157378_1000109226 | 70 |
| 186 | 3300013297 | Ga0157378_10002176 | Ga0157378_100021762 | 70 |
| 187 | 3300013308 | Ga0157375_10000008 | Ga0157375_10000008210 | 70 |
| 188 | 3300013308 | Ga0157375_10001458 | Ga0157375_100014582 | 70 |
| 189 | 3300014325 | Ga0163163_10528497 | Ga0163163_105284972 | 70 |
| 190 | 3300014325 | Ga0163163_10635482 | Ga0163163_106354822 | 70 |
| 191 | 3300014745 | Ga0157377_10000002 | Ga0157377_10000002321 | 70 |
| 192 | 3300014969 | Ga0157376_10000025 | Ga0157376_1000002540 | 70 |
| 193 | 3300021358 | Ga0213873_10009577 | Ga0213873_100095773 | 70 |
| 194 | 3300021384 | Ga0213876_10000080 | Ga0213876_1000008018 | 70 |
| 195 | 3300025315 | Ga0207697_10472139 | Ga0207697_104721392 | 70 |
| 196 | 3300025908 | Ga0207643_10328935 | Ga0207643_103289352 | 70 |
| 197 | 3300025912 | Ga0207707_10492052 | Ga0207707_104920522 | 70 |
| 198 | 3300025917 | Ga0207660_10224619 | Ga0207660_102246192 | 70 |
| 199 | 3300025922 | Ga0207646_10089955 | Ga0207646_100899554 | 70 |
| 200 | 3300025924 | Ga0207694_10000001 | Ga0207694_100000011595 | 70 |
| 201 | 3300025925 | Ga0207650_10000262 | Ga0207650_1000026219 | 70 |
| 202 | 3300025925 | Ga0207650_10016449 | Ga0207650_100164494 | 70 |
| 203 | 3300025926 | Ga0207659_10000067 | Ga0207659_1000006735 | 70 |
| 204 | 3300025927 | Ga0207687_10000003 | Ga0207687_10000003253 | 70 |
| 205 | 3300025934 | Ga0207686_10005136 | Ga0207686_100051366 | 70 |
| 206 | 3300025942 | Ga0207689_10193553 | Ga0207689_101935533 | 70 |
| 207 | 3300025942 | Ga0207689_11238340 | Ga0207689_112383402 | 70 |
| 208 | 3300025944 | Ga0207661_10000001 | Ga0207661_10000001167 | 70 |
| 209 | 3300025944 | Ga0207661_10442978 | Ga0207661_104429782 | 70 |
| 210 | 3300025960 | Ga0207651_11118869 | Ga0207651_111188692 | 70 |
| 211 | 3300025981 | Ga0207640_10005221 | Ga0207640_100052216 | 70 |
| 212 | 3300025981 | Ga0207640_10381888 | Ga0207640_103818882 | 70 |
| 213 | 3300025981 | Ga0207640_10590295 | Ga0207640_105902952 | 70 |
| 214 | 3300026023 | Ga0207677_10000249 | Ga0207677_1000024924 | 70 |
| 215 | 3300026035 | Ga0207703_10538572 | Ga0207703_105385722 | 70 |
| 216 | 3300026041 | Ga0207639_10202741 | Ga0207639_102027412 | 70 |
| 217 | 3300026075 | Ga0207708_10000052 | Ga0207708_1000005212 | 70 |
| 218 | 3300026089 | Ga0207648_11893564 | Ga0207648_118935641 | 70 |
| 219 | 3300026116 | Ga0207674_10596029 | Ga0207674_105960292 | 70 |
| 220 | 3300026118 | Ga0207675_102607203 | Ga0207675_1026072031 | 70 |
| 221 | 3300028380 | Ga0268265_11156655 | Ga0268265_111566552 | 70 |
| 222 | 3300028381 | Ga0268264_11660342 | Ga0268264_116603422 | 70 |
| 223 | 3300030521 | Ga0307511_10006860 | Ga0307511_100068602 | 70 |
| 224 | 3300035115 | Ga0373941_0122334 | Ga0373941_0122334_550_762 | 70 |
| 225 | 3300036401 | Ga0373937_1669576 | Ga0373937_1669576_137_349 | 70 |
| 226 | 3300039437 | Ga0436365_0138728 | Ga0436365_0138728_35419_35631 | 70 |
| 227 | 3300039450 | Ga0436363_1380009 | Ga0436363_1380009_119_331 | 70 |
| 228 | 3300039453 | Ga0436362_0839370 | Ga0436362_0839370_1176_1388 | 70 |
| 229 | 3300041496 | Ga0451839_0238746 | Ga0451839_0238746_372_584 | 70 |
| 230 | 3300047318 | Ga0495636_0682870 | Ga0495636_0682870_128_340 | 70 |
| 231 | 3300048909 | Ga0496106_0125645 | Ga0496106_0125645_870_1082 | 70 |
| 232 | 3300048915 | Ga0496112_0653403 | Ga0496112_0653403_134_346 | 70 |
| 233 | 3300049589 | Ga0501073_0005175 | Ga0501073_0005175_1246_1458 | 70 |
| 234 | 3300049742 | Ga0501080_1409025 | Ga0501080_1409025_118_330 | 70 |
| 235 | 3300050507 | nmdc:mga05p37_2061854_c1 | nmdc:mga05p37_2061854_c1_280_492 | 70 |
| 236 | 3300050510 | nmdc:mga06r32_1055230_c1 | nmdc:mga06r32_1055230_c1_362_574 | 70 |
| 237 | 3300050512 | nmdc:mga0n895_535159_c1 | nmdc:mga0n895_535159_c1_503_715 | 70 |
| 238 | 3300050513 | nmdc:mga0rr50_214001_c1 | nmdc:mga0rr50_214001_c1_443_655 | 70 |
| 239 | 3300004801 | Ga0058860_10937433 | Ga0058860_109374332 | 71 |
| 240 | 3300005293 | Ga0065715_10539242 | Ga0065715_105392421 | 71 |
| 241 | 3300005295 | Ga0065707_10090664 | Ga0065707_100906641 | 71 |
| 242 | 3300005328 | Ga0070676_10382213 | Ga0070676_103822132 | 71 |
| 243 | 3300005330 | Ga0070690_100280077 | Ga0070690_1002800772 | 71 |
| 244 | 3300005330 | Ga0070690_100791252 | Ga0070690_1007912522 | 71 |
| 245 | 3300005340 | Ga0070689_101034783 | Ga0070689_1010347832 | 71 |
| 246 | 3300005343 | Ga0070687_100011340 | Ga0070687_1000113403 | 71 |
| 247 | 3300005343 | Ga0070687_100657168 | Ga0070687_1006571682 | 71 |
| 248 | 3300005343 | Ga0070687_100878694 | Ga0070687_1008786941 | 71 |
| 249 | 3300005343 | Ga0070687_101114481 | Ga0070687_1011144812 | 71 |
| 250 | 3300005355 | Ga0070671_100416294 | Ga0070671_1004162942 | 71 |
| 251 | 3300005355 | Ga0070671_100781588 | Ga0070671_1007815882 | 71 |
| 252 | 3300005364 | Ga0070673_101326389 | Ga0070673_1013263892 | 71 |
| 253 | 3300005438 | Ga0070701_10001305 | Ga0070701_100013057 | 71 |
| 254 | 3300005441 | Ga0070700_102022567 | Ga0070700_1020225672 | 71 |
| 255 | 3300005444 | Ga0070694_100639164 | Ga0070694_1006391642 | 71 |
| 256 | 3300005445 | Ga0070708_100014308 | Ga0070708_1000143083 | 71 |
| 257 | 3300005445 | Ga0070708_100347639 | Ga0070708_1003476392 | 71 |
| 258 | 3300005456 | Ga0070678_100096947 | Ga0070678_1000969475 | 71 |
| 259 | 3300005466 | Ga0070685_10072746 | Ga0070685_100727462 | 71 |
| 260 | 3300005467 | Ga0070706_100001538 | Ga0070706_10000153811 | 71 |
| 261 | 3300005467 | Ga0070706_100021795 | Ga0070706_1000217951 | 71 |
| 262 | 3300005467 | Ga0070706_100042742 | Ga0070706_1000427425 | 71 |
| 263 | 3300005468 | Ga0070707_100057270 | Ga0070707_1000572702 | 71 |
| 264 | 3300005468 | Ga0070707_100793834 | Ga0070707_1007938342 | 71 |
| 265 | 3300005468 | Ga0070707_100949909 | Ga0070707_1009499092 | 71 |
| 266 | 3300005471 | Ga0070698_100079094 | Ga0070698_1000790941 | 71 |
| 267 | 3300005471 | Ga0070698_100250619 | Ga0070698_1002506192 | 71 |
| 268 | 3300005471 | Ga0070698_100846711 | Ga0070698_1008467112 | 71 |
| 269 | 3300005518 | Ga0070699_100035518 | Ga0070699_1000355184 | 71 |
| 270 | 3300005518 | Ga0070699_101195569 | Ga0070699_1011955692 | 71 |
| 271 | 3300005536 | Ga0070697_100055544 | Ga0070697_1000555445 | 71 |
| 272 | 3300005536 | Ga0070697_100493153 | Ga0070697_1004931532 | 71 |
| 273 | 3300005536 | Ga0070697_101711178 | Ga0070697_1017111781 | 71 |
| 274 | 3300005544 | Ga0070686_100372015 | Ga0070686_1003720152 | 71 |
| 275 | 3300005544 | Ga0070686_101062710 | Ga0070686_1010627102 | 71 |
| 276 | 3300005544 | Ga0070686_101314931 | Ga0070686_1013149312 | 71 |
| 277 | 3300005549 | Ga0070704_100227795 | Ga0070704_1002277952 | 71 |
| 278 | 3300005549 | Ga0070704_100231282 | Ga0070704_1002312823 | 71 |
| 279 | 3300005615 | Ga0070702_100351975 | Ga0070702_1003519753 | 71 |
| 280 | 3300005615 | Ga0070702_100959579 | Ga0070702_1009595792 | 71 |
| 281 | 3300005617 | Ga0068859_100000001 | Ga0068859_100000001372 | 71 |
| 282 | 3300006173 | Ga0070716_101731355 | Ga0070716_1017313551 | 71 |
| 283 | 3300006847 | Ga0075431_100085485 | Ga0075431_1000854853 | 71 |
| 284 | 3300006880 | Ga0075429_100068657 | Ga0075429_1000686574 | 71 |
| 285 | 3300006880 | Ga0075429_100709584 | Ga0075429_1007095842 | 71 |
| 286 | 3300006931 | Ga0097620_100000001 | Ga0097620_100000001372 | 71 |
| 287 | 3300009094 | Ga0111539_10000052 | Ga0111539_1000005272 | 71 |
| 288 | 3300009098 | Ga0105245_11732452 | Ga0105245_117324522 | 71 |
| 289 | 3300013102 | Ga0157371_11355388 | Ga0157371_113553881 | 71 |
| 290 | 3300014326 | Ga0157380_10658400 | Ga0157380_106584001 | 71 |
| 291 | 3300014745 | Ga0157377_11527695 | Ga0157377_115276951 | 71 |
| 292 | 3300021358 | Ga0213873_10000002 | Ga0213873_10000002849 | 71 |
| 293 | 3300021384 | Ga0213876_10000001 | Ga0213876_10000001932 | 71 |
| 294 | 3300021384 | Ga0213876_10025189 | Ga0213876_100251893 | 71 |
| 295 | 3300021388 | Ga0213875_10641497 | Ga0213875_106414972 | 71 |
| 296 | 3300025321 | Ga0207656_10163747 | Ga0207656_101637472 | 71 |
| 297 | 3300025904 | Ga0207647_10554034 | Ga0207647_105540342 | 71 |
| 298 | 3300025907 | Ga0207645_10273173 | Ga0207645_102731732 | 71 |
| 299 | 3300025910 | Ga0207684_10021317 | Ga0207684_100213172 | 71 |
| 300 | 3300025910 | Ga0207684_10481815 | Ga0207684_104818152 | 71 |
| 301 | 3300025918 | Ga0207662_10018606 | Ga0207662_100186063 | 71 |
| 302 | 3300025918 | Ga0207662_10273502 | Ga0207662_102735023 | 71 |
| 303 | 3300025918 | Ga0207662_11244460 | Ga0207662_112444602 | 71 |
| 304 | 3300025922 | Ga0207646_10095108 | Ga0207646_100951083 | 71 |
| 305 | 3300025922 | Ga0207646_10410025 | Ga0207646_104100252 | 71 |
| 306 | 3300025927 | Ga0207687_11646033 | Ga0207687_116460332 | 71 |
| 307 | 3300025931 | Ga0207644_10120812 | Ga0207644_101208122 | 71 |
| 308 | 3300025936 | Ga0207670_10459894 | Ga0207670_104598942 | 71 |
| 309 | 3300025960 | Ga0207651_11318484 | Ga0207651_113184842 | 71 |
| 310 | 3300027907 | Ga0207428_10000003 | Ga0207428_1000000372 | 71 |
| 311 | 3300028800 | Ga0265338_10340060 | Ga0265338_103400602 | 71 |
| 312 | 3300031344 | Ga0265316_10049285 | Ga0265316_100492854 | 71 |
| 313 | 3300032126 | Ga0307415_102294295 | Ga0307415_1022942952 | 71 |
| 314 | 3300037853 | Ga0436364_0698840 | Ga0436364_0698840_211_426 | 71 |
| 315 | 3300039437 | Ga0436365_0204561 | Ga0436365_0204561_1388_1603 | 71 |
| 316 | 3300039437 | Ga0436365_0205514 | Ga0436365_0205514_901_1119 | 71 |
| 317 | 3300039437 | Ga0436365_0404975 | Ga0436365_0404975_162065_162280 | 71 |
| 318 | 3300039453 | Ga0436362_0660519 | Ga0436362_0660519_75402_75617 | 71 |
| 319 | 3300039453 | Ga0436362_0828847 | Ga0436362_0828847_399_617 | 71 |
| 320 | 3300041441 | Ga0451787_277244 | Ga0451787_277244_134_349 | 71 |
| 321 | 3300042876 | Ga0451577_0146517 | Ga0451577_0146517_855_1130 | 71 |
| 322 | 3300042876 | Ga0451577_2039693 | Ga0451577_2039693_133_348 | 71 |
| 323 | 3300044673 | Ga0453683_0124155 | Ga0453683_0124155_688_903 | 71 |
| 324 | 3300044673 | Ga0453683_0591012 | Ga0453683_0591012_434_649 | 71 |
| 325 | 3300044712 | Ga0453684_0043569 | Ga0453684_0043569_3823_4098 | 71 |
| 326 | 3300045051 | Ga0451576_1570583 | Ga0451576_1570583_60_308 | 71 |
| 327 | 3300046462 | Ga0495651_0794567 | Ga0495651_0794567_43_276 | 71 |
| 328 | 3300046515 | Ga0495620_0004380 | Ga0495620_0004380_1643_1858 | 71 |
| 329 | 3300046516 | Ga0495628_0118147 | Ga0495628_0118147_1494_1727 | 71 |
| 330 | 3300046537 | Ga0495598_0458847 | Ga0495598_0458847_67_282 | 71 |
| 331 | 3300046539 | Ga0495621_0145581 | Ga0495621_0145581_612_827 | 71 |
| 332 | 3300046678 | Ga0495599_0314835 | Ga0495599_0314835_197_430 | 71 |
| 333 | 3300046689 | Ga0495613_0768883 | Ga0495613_0768883_216_446 | 71 |
| 334 | 3300048907 | Ga0496104_0273844 | Ga0496104_0273844_992_1240 | 71 |
| 335 | 3300050507 | nmdc:mga05p37_1706132_c1 | nmdc:mga05p37_1706132_c1_228_443 | 71 |
| 336 | 3300050508 | nmdc:mga09592_42023_c1 | nmdc:mga09592_42023_c1_2837_3052 | 71 |
| 337 | 3300050508 | nmdc:mga09592_625396_c1 | nmdc:mga09592_625396_c1_671_886 | 71 |
| 338 | 3300050510 | nmdc:mga06r32_76196_c1 | nmdc:mga06r32_76196_c1_1449_1664 | 71 |
| 339 | 3300050511 | nmdc:mga08y16_4_c1 | nmdc:mga08y16_4_c1_850542_850757 | 71 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7eu1-assembly1.cif.gz_F | the cryo-em structure of a. thaliana pol iv-rdr2 holoenzyme | 0.9179 | 10 | 55 |
| 8i24-assembly1.cif.gz_E | clostridium thermocellum rna polymerase transcription open complex with sigi6 and its promoter | 0.9163 | 6 | 55 |
| 8i23-assembly1.cif.gz_E | clostridium thermocellum rna polymerase transcription open complex with sigi1 and its promoter | 0.9153 | 6 | 55 |
| 8igs-assembly1.cif.gz_K | cryo-em structure of rnap-promoter open complex at lambda promoter pre | 0.9151 | 6 | 53 |
| 7xl3-assembly1.cif.gz_E | cryo-em structure of pseudomonas aeruginosa rnap sigmas holoenzyme complexes with transcription factor suta (open lobe) | 0.9148 | 9 | 54 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 6n60E00 | Alpha Beta;Alpha-Beta Complex;Eukaryotic RPB6 RNA polymerase subunit;RNA polymerase subunit, RPB6/omega | 0.8776 | 6 | 57 | 3.90.940.10 |
| 6algK00 | Alpha Beta;Alpha-Beta Complex;Eukaryotic RPB6 RNA polymerase subunit;RNA polymerase subunit, RPB6/omega | 0.8756 | 6 | 57 | 3.90.940.10 |
| 5uaqK00 | Alpha Beta;Alpha-Beta Complex;Eukaryotic RPB6 RNA polymerase subunit;RNA polymerase subunit, RPB6/omega | 0.8754 | 6 | 57 | 3.90.940.10 |
| 4llgK00 | Alpha Beta;Alpha-Beta Complex;Eukaryotic RPB6 RNA polymerase subunit;RNA polymerase subunit, RPB6/omega | 0.8752 | 6 | 57 | 3.90.940.10 |
| 5nwtE00 | Alpha Beta;Alpha-Beta Complex;Eukaryotic RPB6 RNA polymerase subunit;RNA polymerase subunit, RPB6/omega | 0.8734 | 11 | 57 | 3.90.940.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-S0ETR1-F1-model_v4 | DNA-directed RNA polymerase subunit omega (RNAP omega subunit) (EC 2.7.7.6) (RNA polymerase omega subunit) (Transcriptase subunit omega) | 0.9887 | 10 | 51 |
GO:0000428
GO:0001054 GO:0001055 GO:0001056 GO:0001057 GO:0001058 GO:0001066 GO:0003677 |
| AF-A0A2G2MKC5-F1-model_v4 | DNA-directed RNA polymerase subunit omega (RNAP omega subunit) (EC 2.7.7.6) (RNA polymerase omega subunit) (Transcriptase subunit omega) | 0.9786 | 8 | 53 |
GO:0000428
GO:0001054 GO:0001055 GO:0001056 GO:0001057 GO:0001058 GO:0001066 GO:0003677 |
| AF-A0A2V7XAB6-F1-model_v4 | DNA-directed RNA polymerase subunit omega (RNAP omega subunit) (EC 2.7.7.6) (RNA polymerase omega subunit) (Transcriptase subunit omega) | 0.9719 | 4 | 56 |
GO:0000428
GO:0001054 GO:0001055 GO:0001056 GO:0001057 GO:0001058 GO:0001066 GO:0003677 |
| AF-X1PZD2-F1-model_v4 | DNA-directed RNA polymerase (EC 2.7.7.6) | 0.9691 | 8 | 54 |
GO:0000428
GO:0001054 GO:0001055 GO:0001056 GO:0001057 GO:0001058 GO:0001065 GO:0001066 GO:0003677 |
| AF-A0A2M8C9G0-F1-model_v4 | DNA-directed RNA polymerase subunit omega (EC 2.7.7.6) (Transcriptase subunit omega) | 0.9637 | 9 | 56 |
GO:0000428
GO:0001054 GO:0001055 GO:0001056 GO:0001057 GO:0001058 GO:0001066 GO:0003677 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar