F414035

General Info

Members Datasets Scaffolds Average Seq Length
339 177 339 71

Family's Representative Sequence

Representative Sequence 3300045051|Ga0451576_1570583|Ga0451576_1570583_60_308
Length 82
Sequence MISMQLPPNVESKFRLVHIASRRAEQLVQGARPKMESRHSKMTRIALEEVGHDLVKWELASTEPPAGELEGVGTDPLPTEAA

Samples

Sample ID Description Type Environment
1 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
2 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
22 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
23 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
24 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
25 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
26 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
27 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
28 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
32 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
33 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
34 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
35 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
36 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
37 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
38 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
41 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
42 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
43 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
44 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
45 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
46 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
47 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
48 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
49 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
50 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
51 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
52 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
53 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
54 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
55 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
56 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
58 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
59 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
60 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
61 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
62 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
63 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
64 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
66 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
67 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
69 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
70 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
72 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
73 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
74 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
75 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
76 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
77 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
78 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
79 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
80 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
81 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
82 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
83 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
84 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
85 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
86 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
87 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
88 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
89 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
90 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
91 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
133 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
136 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
137 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
138 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
139 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
140 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
141 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
142 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
143 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
144 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
145 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
146 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
147 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
148 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
149 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
150 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
151 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
152 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
153 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
154 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
155 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
156 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
157 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
158 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
159 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
160 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
161 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
162 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
163 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
164 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
165 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
166 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
167 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
168 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
169 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
170 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
171 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
172 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
173 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
174 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
175 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
176 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
177 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.71
Metatranscriptomes 0.29
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.18
Rhizosphere 93.81
Stem 0
Stem Tuber 0
Unclassified 5.01

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0058860_10937433 3300004801 Bacteria 685
2 Ga0065715_10539242 3300005293 Bacteria 749
3 Ga0065707_10090664 3300005295 Bacteria 4094
4 Ga0070676_10382213 3300005328 Unclassified 975
5 Ga0070676_10400682 3300005328 Bacteria 955
6 Ga0070683_100000068 3300005329 Bacteria 72997
7 Ga0070683_100269134 3300005329 Bacteria 1621
8 Ga0070683_101465384 3300005329 Bacteria 656
9 Ga0070690_100280077 3300005330 Bacteria 1189
10 Ga0070690_100791252 3300005330 Bacteria 735
11 Ga0070670_100000307 3300005331 Bacteria 42018
12 Ga0070670_101066237 3300005331 Bacteria 736
13 Ga0068869_100049503 3300005334 Bacteria 3042
14 Ga0068869_100160079 3300005334 Bacteria 1752
15 Ga0068869_101321765 3300005334 Unclassified 636
16 Ga0068869_101368046 3300005334 Bacteria 626
17 Ga0068869_101462874 3300005334 Unclassified 606
18 Ga0070680_101069128 3300005336 Unclassified 697
19 Ga0070682_100000001 3300005337 Bacteria 569837
20 Ga0070682_100080448 3300005337 Bacteria 2107
21 Ga0068868_100000163 3300005338 Bacteria 43476
22 Ga0068868_100004748 3300005338 Bacteria 9543
23 Ga0070689_100000313 3300005340 Bacteria 28319
24 Ga0070689_101034783 3300005340 Unclassified 732
25 Ga0070687_100011340 3300005343 Bacteria 3897
26 Ga0070687_100657168 3300005343 Bacteria 727
27 Ga0070687_100878694 3300005343 Bacteria 641
28 Ga0070687_101114481 3300005343 Unclassified 578
29 Ga0070692_10043278 3300005345 Bacteria 2315
30 Ga0070669_100912187 3300005353 Bacteria 751
31 Ga0070675_100000005 3300005354 Bacteria 295918
32 Ga0070671_100416294 3300005355 Bacteria 1151
33 Ga0070671_100781588 3300005355 Unclassified 831
34 Ga0070674_100057961 3300005356 Bacteria 2691
35 Ga0070673_100325867 3300005364 Bacteria 1358
36 Ga0070673_100359425 3300005364 Unclassified 1294
37 Ga0070673_101226276 3300005364 Bacteria 703
38 Ga0070673_101326389 3300005364 Unclassified 676
39 Ga0070673_101677165 3300005364 Bacteria 601
40 Ga0070659_100421532 3300005366 Bacteria 1129
41 Ga0070709_11187456 3300005434 Unclassified 613
42 Ga0070709_11486947 3300005434 Unclassified 550
43 Ga0070713_100024778 3300005436 Bacteria 4681
44 Ga0070710_10787237 3300005437 Unclassified 678
45 Ga0070701_10001305 3300005438 Bacteria 9164
46 Ga0070705_100995077 3300005440 Bacteria 680
47 Ga0070700_100000025 3300005441 Bacteria 126198
48 Ga0070700_102022567 3300005441 Unclassified 500
49 Ga0070694_100639164 3300005444 Bacteria 860
50 Ga0070708_100014308 3300005445 Bacteria 6523
51 Ga0070708_100347639 3300005445 Bacteria 1397
52 Ga0070708_101588338 3300005445 Unclassified 609
53 Ga0070678_100096947 3300005456 Bacteria 2276
54 Ga0070678_100558098 3300005456 Bacteria 1017
55 Ga0070662_100324358 3300005457 Bacteria 1256
56 Ga0070681_10784132 3300005458 Bacteria 870
57 Ga0070685_10072746 3300005466 Bacteria 2042
58 Ga0070706_100001538 3300005467 Bacteria 24123
59 Ga0070706_100021795 3300005467 Bacteria 5900
60 Ga0070706_100042742 3300005467 Bacteria 4187
61 Ga0070706_100188444 3300005467 Bacteria 1928
62 Ga0070707_100020700 3300005468 Bacteria 6208
63 Ga0070707_100057270 3300005468 Bacteria 3738
64 Ga0070707_100793834 3300005468 Unclassified 910
65 Ga0070707_100949909 3300005468 Bacteria 825
66 Ga0070698_100079094 3300005471 Bacteria 3285
67 Ga0070698_100250619 3300005471 Bacteria 1703
68 Ga0070698_100656716 3300005471 Bacteria 990
69 Ga0070698_100744481 3300005471 Bacteria 923
70 Ga0070698_100846711 3300005471 Unclassified 859
71 Ga0070699_100035518 3300005518 Bacteria 4308
72 Ga0070699_100100634 3300005518 Bacteria 2533
73 Ga0070699_101195569 3300005518 Unclassified 697
74 Ga0070684_100000096 3300005535 Bacteria 56546
75 Ga0070697_100055544 3300005536 Bacteria 3219
76 Ga0070697_100493153 3300005536 Bacteria 1070
77 Ga0070697_101711178 3300005536 Bacteria 563
78 Ga0068853_100207944 3300005539 Bacteria 1783
79 Ga0068853_100539148 3300005539 Bacteria 1104
80 Ga0070672_100005534 3300005543 Bacteria 8388
81 Ga0070672_101710245 3300005543 Unclassified 565
82 Ga0070686_100372015 3300005544 Bacteria 1079
83 Ga0070686_101062710 3300005544 Bacteria 667
84 Ga0070686_101314931 3300005544 Unclassified 604
85 Ga0070693_100016918 3300005547 Bacteria 3782
86 Ga0070704_100227795 3300005549 Bacteria 1519
87 Ga0070704_100231282 3300005549 Unclassified 1508
88 Ga0070704_101114808 3300005549 Bacteria 717
89 Ga0068857_100104511 3300005577 Bacteria 2543
90 Ga0068854_100064231 3300005578 Bacteria 2667
91 Ga0068854_100067381 3300005578 Bacteria 2608
92 Ga0068854_100505944 3300005578 Bacteria 1018
93 Ga0068854_100867986 3300005578 Bacteria 791
94 Ga0070702_100035641 3300005615 Bacteria 2750
95 Ga0070702_100351975 3300005615 Bacteria 1038
96 Ga0070702_100404131 3300005615 Bacteria 978
97 Ga0070702_100659702 3300005615 Bacteria 792
98 Ga0070702_100959579 3300005615 Unclassified 674
99 Ga0070702_101011220 3300005615 Bacteria 659
100 Ga0070702_101170829 3300005615 Unclassified 618
101 Ga0068859_100000001 3300005617 Bacteria 545224
102 Ga0068859_102269675 3300005617 Bacteria 599
103 Ga0068864_100000097 3300005618 Bacteria 85717
104 Ga0068864_102582930 3300005618 Unclassified 514
105 Ga0068866_10584789 3300005718 Bacteria 751
106 Ga0068870_10105851 3300005840 Bacteria 1598
107 Ga0068870_10803059 3300005840 Unclassified 658
108 Ga0068870_10848575 3300005840 Bacteria 642
109 Ga0068858_100000535 3300005842 Bacteria 39601
110 Ga0068858_100638470 3300005842 Bacteria 1034
111 Ga0068860_102463809 3300005843 Bacteria 540
112 Ga0068862_102217019 3300005844 Bacteria 561
113 Ga0070717_10000216 3300006028 Bacteria 40022
114 Ga0070717_10641341 3300006028 Bacteria 964
115 Ga0070717_11453840 3300006028 Bacteria 622
116 Ga0070717_11574331 3300006028 Unclassified 596
117 Ga0070716_100083236 3300006173 Bacteria 1916
118 Ga0070716_100116870 3300006173 Bacteria 1663
119 Ga0070716_100644633 3300006173 Bacteria 802
120 Ga0070716_101159875 3300006173 Bacteria 619
121 Ga0070716_101731355 3300006173 Unclassified 516
122 Ga0097621_100118187 3300006237 Bacteria 2247
123 Ga0068871_100271422 3300006358 Bacteria 1482
124 Ga0075428_100052044 3300006844 Bacteria 4490
125 Ga0075431_100085485 3300006847 Bacteria 3256
126 Ga0075431_100625209 3300006847 Bacteria 1059
127 Ga0075434_100448146 3300006871 Bacteria 1312
128 Ga0075434_100569595 3300006871 Bacteria 1152
129 Ga0075434_100866891 3300006871 Unclassified 918
130 Ga0075429_100068657 3300006880 Bacteria 3085
131 Ga0075429_100182636 3300006880 Bacteria 1838
132 Ga0075429_100709584 3300006880 Unclassified 881
133 Ga0075429_101799434 3300006880 Bacteria 531
134 Ga0068865_100318150 3300006881 Bacteria 1251
135 Ga0068865_101478492 3300006881 Bacteria 608
136 Ga0075436_100000807 3300006914 Bacteria 20806
137 Ga0075436_100387512 3300006914 Unclassified 1011
138 Ga0075436_100645829 3300006914 Bacteria 781
139 Ga0097620_100000001 3300006931 Bacteria 545224
140 Ga0097620_102269605 3300006931 Bacteria 599
141 Ga0075435_100000252 3300007076 Bacteria 33173
142 Ga0075435_100012323 3300007076 Bacteria 6326
143 Ga0075435_100142723 3300007076 Bacteria 2010
144 Ga0075435_100196059 3300007076 Bacteria 1710
145 Ga0075435_101373173 3300007076 Bacteria 619
146 Ga0105240_10068609 3300009093 Bacteria 4391
147 Ga0111539_10000052 3300009094 Bacteria 116307
148 Ga0105245_10000004 3300009098 Bacteria 470684
149 Ga0105245_10000937 3300009098 Bacteria 26512
150 Ga0105245_10064849 3300009098 Bacteria 3302
151 Ga0105245_10151159 3300009098 Bacteria 2196
152 Ga0105245_11732452 3300009098 Unclassified 677
153 Ga0105247_10116919 3300009101 Bacteria 1723
154 Ga0114129_10377191 3300009147 Bacteria 1874
155 Ga0114129_11464743 3300009147 Bacteria 840
156 Ga0114129_12082223 3300009147 Bacteria 685
157 Ga0105243_11025416 3300009148 Unclassified 829
158 Ga0105242_10030591 3300009176 Bacteria 4299
159 Ga0105242_11318007 3300009176 Bacteria 746
160 Ga0105248_12853461 3300009177 Unclassified 551
161 Ga0105238_10000001 3300009551 Bacteria 2036163
162 Ga0105239_10012662 3300010375 Bacteria 9384
163 Ga0105246_10091700 3300011119 Bacteria 2191
164 Ga0105246_10685976 3300011119 Bacteria 896
165 Ga0157371_11355388 3300013102 Bacteria 552
166 Ga0157369_10001042 3300013105 Bacteria 35030
167 Ga0157369_10116379 3300013105 Bacteria 2839
168 Ga0157374_10000012 3300013296 Bacteria 462353
169 Ga0157374_10310603 3300013296 Unclassified 1561
170 Ga0157378_10001092 3300013297 Bacteria 24799
171 Ga0157378_10002176 3300013297 Bacteria 17386
172 Ga0157378_10004244 3300013297 Bacteria 12642
173 Ga0157378_11066136 3300013297 Bacteria 844
174 Ga0157378_11446598 3300013297 Unclassified 731
175 Ga0163162_10051092 3300013306 Bacteria 4146
176 Ga0163162_11553377 3300013306 Bacteria 754
177 Ga0157375_10000001 3300013308 Bacteria 696576
178 Ga0157375_10000008 3300013308 Bacteria 373560
179 Ga0157375_10001458 3300013308 Bacteria 20339
180 Ga0163163_10528497 3300014325 Bacteria 1242
181 Ga0163163_10635482 3300014325 Bacteria 1131
182 Ga0157380_10054037 3300014326 Bacteria 3186
183 Ga0157380_10658400 3300014326 Bacteria 1046
184 Ga0157377_10000002 3300014745 Bacteria 473827
185 Ga0157377_10000024 3300014745 Bacteria 142391
186 Ga0157377_10196382 3300014745 Bacteria 1278
187 Ga0157377_11527695 3300014745 Bacteria 532
188 Ga0157376_10000025 3300014969 Bacteria 214212
189 Ga0213873_10000002 3300021358 Bacteria 1164195
190 Ga0213873_10009577 3300021358 Bacteria 2016
191 Ga0213874_10017685 3300021377 Bacteria 1916
192 Ga0213876_10000001 3300021384 Bacteria 1186326
193 Ga0213876_10000080 3300021384 Bacteria 109125
194 Ga0213876_10025189 3300021384 Bacteria 3140
195 Ga0213875_10641497 3300021388 Bacteria 514
196 Ga0207697_10472139 3300025315 Unclassified 555
197 Ga0207656_10163747 3300025321 Bacteria 1060
198 Ga0207692_10703784 3300025898 Unclassified 656
199 Ga0207642_10999773 3300025899 Unclassified 538
200 Ga0207647_10554034 3300025904 Bacteria 637
201 Ga0207645_10273173 3300025907 Unclassified 1121
202 Ga0207643_10233611 3300025908 Bacteria 1128
203 Ga0207643_10328935 3300025908 Unclassified 956
204 Ga0207643_10503181 3300025908 Unclassified 774
205 Ga0207684_10021317 3300025910 Bacteria 5532
206 Ga0207684_10481815 3300025910 Bacteria 1064
207 Ga0207684_11222102 3300025910 Bacteria 621
208 Ga0207707_10492052 3300025912 Bacteria 1047
209 Ga0207695_10115270 3300025913 Bacteria 2661
210 Ga0207660_10224619 3300025917 Bacteria 1475
211 Ga0207662_10018606 3300025918 Bacteria 3946
212 Ga0207662_10273502 3300025918 Unclassified 1115
213 Ga0207662_10665881 3300025918 Bacteria 728
214 Ga0207662_11244460 3300025918 Unclassified 529
215 Ga0207646_10020083 3300025922 Bacteria 6196
216 Ga0207646_10089955 3300025922 Bacteria 2748
217 Ga0207646_10095108 3300025922 Bacteria 2669
218 Ga0207646_10410025 3300025922 Bacteria 1223
219 Ga0207681_11425826 3300025923 Unclassified 581
220 Ga0207694_10000001 3300025924 Bacteria 4078485
221 Ga0207650_10000262 3300025925 Bacteria 56131
222 Ga0207650_10016449 3300025925 Bacteria 5171
223 Ga0207650_10284687 3300025925 Bacteria 1347
224 Ga0207659_10000067 3300025926 Bacteria 66315
225 Ga0207687_10000003 3300025927 Bacteria 875159
226 Ga0207687_10008044 3300025927 Bacteria 6900
227 Ga0207687_11219466 3300025927 Bacteria 647
228 Ga0207687_11646033 3300025927 Unclassified 550
229 Ga0207700_10014335 3300025928 Bacteria 5192
230 Ga0207644_10120812 3300025931 Bacteria 1994
231 Ga0207690_10277415 3300025932 Bacteria 1304
232 Ga0207686_10005136 3300025934 Bacteria 7037
233 Ga0207670_10001392 3300025936 Bacteria 12715
234 Ga0207670_10459894 3300025936 Unclassified 1027
235 Ga0207669_10144148 3300025937 Bacteria 1658
236 Ga0207704_10275075 3300025938 Bacteria 1277
237 Ga0207665_10068514 3300025939 Bacteria 2418
238 Ga0207665_10140207 3300025939 Bacteria 1723
239 Ga0207665_11280864 3300025939 Bacteria 584
240 Ga0207665_11459988 3300025939 Unclassified 544
241 Ga0207691_10001623 3300025940 Bacteria 22338
242 Ga0207689_10069927 3300025942 Bacteria 2884
243 Ga0207689_10193553 3300025942 Bacteria 1678
244 Ga0207689_11238340 3300025942 Unclassified 628
245 Ga0207689_11575315 3300025942 Bacteria 547
246 Ga0207661_10000001 3300025944 Bacteria 937688
247 Ga0207661_10442978 3300025944 Bacteria 1182
248 Ga0207661_11162071 3300025944 Bacteria 710
249 Ga0207679_11567472 3300025945 Bacteria 604
250 Ga0207651_10283468 3300025960 Bacteria 1370
251 Ga0207651_11118869 3300025960 Bacteria 706
252 Ga0207651_11318484 3300025960 Bacteria 649
253 Ga0207640_10005221 3300025981 Bacteria 7068
254 Ga0207640_10381888 3300025981 Bacteria 1141
255 Ga0207640_10590295 3300025981 Bacteria 939
256 Ga0207640_11319831 3300025981 Bacteria 644
257 Ga0207677_10000035 3300026023 Bacteria 117469
258 Ga0207677_10000249 3300026023 Bacteria 41568
259 Ga0207703_10000046 3300026035 Bacteria 154474
260 Ga0207703_10538572 3300026035 Bacteria 1100
261 Ga0207703_10936797 3300026035 Bacteria 830
262 Ga0207639_10000051 3300026041 Bacteria 113927
263 Ga0207639_10202741 3300026041 Bacteria 1703
264 Ga0207639_10385253 3300026041 Bacteria 1260
265 Ga0207708_10000052 3300026075 Bacteria 105169
266 Ga0207648_11893564 3300026089 Bacteria 558
267 Ga0207676_10000013 3300026095 Bacteria 343067
268 Ga0207674_10130139 3300026116 Bacteria 2481
269 Ga0207674_10596029 3300026116 Bacteria 1067
270 Ga0207675_102607203 3300026118 Bacteria 515
271 Ga0207683_11353689 3300026121 Bacteria 659
272 Ga0207428_10000003 3300027907 Bacteria 799783
273 Ga0268265_11156655 3300028380 Unclassified 770
274 Ga0268264_11660342 3300028381 Unclassified 649
275 Ga0265338_10340060 3300028800 Bacteria 1082
276 Ga0307511_10006860 3300030521 Bacteria 11483
277 Ga0265316_10049285 3300031344 Bacteria 3319
278 Ga0307408_101806945 3300031548 Bacteria 584
279 Ga0307405_10688404 3300031731 Bacteria 845
280 Ga0307409_101589652 3300031995 Unclassified 682
281 Ga0307416_100757295 3300032002 Bacteria 1064
282 Ga0307416_103330341 3300032002 Bacteria 538
283 Ga0307416_103781217 3300032002 Bacteria 507
284 Ga0307415_102294295 3300032126 Bacteria 529
285 Ga0373932_0000024 3300035112 Bacteria 45717
286 Ga0373941_0122334 3300035115 Bacteria 929
287 Ga0373937_1669576 3300036401 Bacteria 584
288 Ga0436364_0698840 3300037853 Bacteria 514
289 Ga0436365_0138728 3300039437 Bacteria 44994
290 Ga0436365_0204561 3300039437 Bacteria 3341
291 Ga0436365_0205514 3300039437 Bacteria 3338
292 Ga0436365_0404975 3300039437 Bacteria 180420
293 Ga0436365_1060264 3300039437 Bacteria 980
294 Ga0436363_0020087 3300039450 Bacteria 2457
295 Ga0436363_0813118 3300039450 Unclassified 921
296 Ga0436363_1380009 3300039450 Bacteria 832
297 Ga0436362_0456560 3300039453 Bacteria 874
298 Ga0436362_0660519 3300039453 Bacteria 832172
299 Ga0436362_0828847 3300039453 Bacteria 760
300 Ga0436362_0839370 3300039453 Bacteria 3050
301 Ga0451787_277244 3300041441 Unclassified 580
302 Ga0451839_0238746 3300041496 Bacteria 1388
303 Ga0451577_0146517 3300042876 Bacteria 2123
304 Ga0451577_2039693 3300042876 Bacteria 501
305 Ga0453683_0124155 3300044673 Bacteria 1625
306 Ga0453683_0591012 3300044673 Bacteria 724
307 Ga0453684_0043569 3300044712 Bacteria 6029
308 Ga0451576_0373048 3300045051 Bacteria 1495
309 Ga0451576_1570583 3300045051 Bacteria 683
310 Ga0495651_0794567 3300046462 Bacteria 584
311 Ga0495620_0004380 3300046515 Bacteria 7966
312 Ga0495628_0118147 3300046516 Bacteria 2036
313 Ga0495598_0458847 3300046537 Bacteria 505
314 Ga0495621_0145581 3300046539 Unclassified 929
315 Ga0495599_0314835 3300046678 Bacteria 943
316 Ga0495613_0768883 3300046689 Bacteria 630
317 Ga0495636_0682870 3300047318 Bacteria 506
318 Ga0496104_0273844 3300048907 Bacteria 1601
319 Ga0496106_0125645 3300048909 Bacteria 2008
320 Ga0496112_0653403 3300048915 Bacteria 981
321 Ga0501073_0005175 3300049589 Bacteria 9784
322 Ga0501080_1409025 3300049742 Bacteria 594
323 nmdc:mga05p37_1147804_c1 3300050507 Bacteria 808
324 nmdc:mga05p37_1706132_c1 3300050507 Bacteria 614
325 nmdc:mga05p37_2061854_c1 3300050507 Bacteria 536
326 nmdc:mga09592_42023_c1 3300050508 Bacteria 3845
327 nmdc:mga09592_625396_c1 3300050508 Unclassified 921
328 nmdc:mga06r32_1055230_c1 3300050510 Unclassified 763
329 nmdc:mga06r32_76196_c1 3300050510 Bacteria 3257
330 nmdc:mga08y16_4_c1 3300050511 Bacteria 916963
331 nmdc:mga0n895_1656606_c1 3300050512 Unclassified 603
332 nmdc:mga0n895_535159_c1 3300050512 Unclassified 1178
333 nmdc:mga0rr50_198538_c1 3300050513 Bacteria 1647
334 nmdc:mga0rr50_214001_c1 3300050513 Bacteria 1589
335 nmdc:mga0rr50_23010_c1 3300050513 Bacteria 4287
336 nmdc:mga0rr50_37_c1 3300050513 Bacteria 87211
337 nmdc:mga08x19_2353_c1 3300050514 Bacteria 11477
338 Ga0495655_0013697 3300053083 Bacteria 1683
339 Ga0501082_1179635 3300060353 Bacteria 669

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300013297 Ga0157378_11446598 Ga0157378_114465982 64
2 3300009101 Ga0105247_10116919 Ga0105247_101169193 65
3 3300009093 Ga0105240_10068609 Ga0105240_100686092 66
4 3300013105 Ga0157369_10116379 Ga0157369_101163794 66
5 3300005328 Ga0070676_10400682 Ga0070676_104006822 69
6 3300005329 Ga0070683_101465384 Ga0070683_1014653841 69
7 3300005331 Ga0070670_101066237 Ga0070670_1010662371 69
8 3300005334 Ga0068869_100049503 Ga0068869_1000495032 69
9 3300005334 Ga0068869_101368046 Ga0068869_1013680462 69
10 3300005334 Ga0068869_101462874 Ga0068869_1014628741 69
11 3300005337 Ga0070682_100000001 Ga0070682_100000001529 69
12 3300005338 Ga0068868_100004748 Ga0068868_1000047483 69
13 3300005340 Ga0070689_100000313 Ga0070689_1000003132 69
14 3300005353 Ga0070669_100912187 Ga0070669_1009121872 69
15 3300005356 Ga0070674_100057961 Ga0070674_1000579613 69
16 3300005364 Ga0070673_100325867 Ga0070673_1003258672 69
17 3300005364 Ga0070673_101677165 Ga0070673_1016771652 69
18 3300005366 Ga0070659_100421532 Ga0070659_1004215322 69
19 3300005434 Ga0070709_11187456 Ga0070709_111874562 69
20 3300005436 Ga0070713_100024778 Ga0070713_1000247782 69
21 3300005437 Ga0070710_10787237 Ga0070710_107872371 69
22 3300005440 Ga0070705_100995077 Ga0070705_1009950772 69
23 3300005445 Ga0070708_101588338 Ga0070708_1015883381 69
24 3300005456 Ga0070678_100558098 Ga0070678_1005580981 69
25 3300005457 Ga0070662_100324358 Ga0070662_1003243582 69
26 3300005467 Ga0070706_100188444 Ga0070706_1001884443 69
27 3300005468 Ga0070707_100020700 Ga0070707_1000207003 69
28 3300005471 Ga0070698_100744481 Ga0070698_1007444812 69
29 3300005539 Ga0068853_100539148 Ga0068853_1005391482 69
30 3300005543 Ga0070672_100005534 Ga0070672_1000055345 69
31 3300005547 Ga0070693_100016918 Ga0070693_1000169182 69
32 3300005577 Ga0068857_100104511 Ga0068857_1001045112 69
33 3300005578 Ga0068854_100505944 Ga0068854_1005059442 69
34 3300005615 Ga0070702_100035641 Ga0070702_1000356414 69
35 3300005615 Ga0070702_100659702 Ga0070702_1006597021 69
36 3300005615 Ga0070702_101170829 Ga0070702_1011708292 69
37 3300005617 Ga0068859_102269675 Ga0068859_1022696751 69
38 3300005618 Ga0068864_100000097 Ga0068864_10000009711 69
39 3300005618 Ga0068864_102582930 Ga0068864_1025829301 69
40 3300005718 Ga0068866_10584789 Ga0068866_105847892 69
41 3300005840 Ga0068870_10105851 Ga0068870_101058512 69
42 3300005840 Ga0068870_10803059 Ga0068870_108030592 69
43 3300005840 Ga0068870_10848575 Ga0068870_108485751 69
44 3300005842 Ga0068858_100000535 Ga0068858_10000053528 69
45 3300006028 Ga0070717_10000216 Ga0070717_1000021627 69
46 3300006028 Ga0070717_10641341 Ga0070717_106413412 69
47 3300006028 Ga0070717_11453840 Ga0070717_114538402 69
48 3300006028 Ga0070717_11574331 Ga0070717_115743312 69
49 3300006173 Ga0070716_100083236 Ga0070716_1000832363 69
50 3300006173 Ga0070716_100116870 Ga0070716_1001168702 69
51 3300006173 Ga0070716_100644633 Ga0070716_1006446332 69
52 3300006173 Ga0070716_101159875 Ga0070716_1011598752 69
53 3300006871 Ga0075434_100448146 Ga0075434_1004481463 69
54 3300006871 Ga0075434_100569595 Ga0075434_1005695952 69
55 3300006871 Ga0075434_100866891 Ga0075434_1008668912 69
56 3300006881 Ga0068865_100318150 Ga0068865_1003181502 69
57 3300006881 Ga0068865_101478492 Ga0068865_1014784922 69
58 3300006914 Ga0075436_100000807 Ga0075436_10000080711 69
59 3300006914 Ga0075436_100645829 Ga0075436_1006458292 69
60 3300006931 Ga0097620_102269605 Ga0097620_1022696051 69
61 3300007076 Ga0075435_100000252 Ga0075435_10000025218 69
62 3300007076 Ga0075435_100012323 Ga0075435_1000123235 69
63 3300007076 Ga0075435_100142723 Ga0075435_1001427233 69
64 3300007076 Ga0075435_101373173 Ga0075435_1013731732 69
65 3300009098 Ga0105245_10000937 Ga0105245_1000093711 69
66 3300009098 Ga0105245_10064849 Ga0105245_100648492 69
67 3300009098 Ga0105245_10151159 Ga0105245_101511593 69
68 3300009147 Ga0114129_11464743 Ga0114129_114647432 69
69 3300009176 Ga0105242_11318007 Ga0105242_113180072 69
70 3300009177 Ga0105248_12853461 Ga0105248_128534611 69
71 3300010375 Ga0105239_10012662 Ga0105239_100126623 69
72 3300013297 Ga0157378_10004244 Ga0157378_1000424415 69
73 3300013297 Ga0157378_11066136 Ga0157378_110661362 69
74 3300013306 Ga0163162_10051092 Ga0163162_100510922 69
75 3300013306 Ga0163162_11553377 Ga0163162_115533772 69
76 3300013308 Ga0157375_10000001 Ga0157375_1000000117 69
77 3300014326 Ga0157380_10054037 Ga0157380_100540373 69
78 3300014745 Ga0157377_10000024 Ga0157377_10000024132 69
79 3300014745 Ga0157377_10196382 Ga0157377_101963823 69
80 3300021377 Ga0213874_10017685 Ga0213874_100176852 69
81 3300025898 Ga0207692_10703784 Ga0207692_107037841 69
82 3300025899 Ga0207642_10999773 Ga0207642_109997732 69
83 3300025908 Ga0207643_10233611 Ga0207643_102336112 69
84 3300025908 Ga0207643_10503181 Ga0207643_105031812 69
85 3300025910 Ga0207684_11222102 Ga0207684_112221022 69
86 3300025913 Ga0207695_10115270 Ga0207695_101152702 69
87 3300025918 Ga0207662_10665881 Ga0207662_106658812 69
88 3300025922 Ga0207646_10020083 Ga0207646_100200833 69
89 3300025923 Ga0207681_11425826 Ga0207681_114258262 69
90 3300025925 Ga0207650_10284687 Ga0207650_102846873 69
91 3300025927 Ga0207687_10008044 Ga0207687_100080442 69
92 3300025927 Ga0207687_11219466 Ga0207687_112194662 69
93 3300025928 Ga0207700_10014335 Ga0207700_100143356 69
94 3300025932 Ga0207690_10277415 Ga0207690_102774152 69
95 3300025936 Ga0207670_10001392 Ga0207670_1000139210 69
96 3300025937 Ga0207669_10144148 Ga0207669_101441482 69
97 3300025938 Ga0207704_10275075 Ga0207704_102750752 69
98 3300025939 Ga0207665_10068514 Ga0207665_100685144 69
99 3300025939 Ga0207665_10140207 Ga0207665_101402072 69
100 3300025939 Ga0207665_11280864 Ga0207665_112808642 69
101 3300025939 Ga0207665_11459988 Ga0207665_114599882 69
102 3300025940 Ga0207691_10001623 Ga0207691_1000162319 69
103 3300025942 Ga0207689_10069927 Ga0207689_100699274 69
104 3300025942 Ga0207689_11575315 Ga0207689_115753152 69
105 3300025944 Ga0207661_11162071 Ga0207661_111620711 69
106 3300025945 Ga0207679_11567472 Ga0207679_115674722 69
107 3300025960 Ga0207651_10283468 Ga0207651_102834682 69
108 3300025981 Ga0207640_11319831 Ga0207640_113198312 69
109 3300026023 Ga0207677_10000035 Ga0207677_1000003520 69
110 3300026035 Ga0207703_10000046 Ga0207703_10000046130 69
111 3300026035 Ga0207703_10936797 Ga0207703_109367972 69
112 3300026041 Ga0207639_10000051 Ga0207639_1000005166 69
113 3300026041 Ga0207639_10385253 Ga0207639_103852532 69
114 3300026095 Ga0207676_10000013 Ga0207676_10000013234 69
115 3300026116 Ga0207674_10130139 Ga0207674_101301392 69
116 3300026121 Ga0207683_11353689 Ga0207683_113536892 69
117 3300031548 Ga0307408_101806945 Ga0307408_1018069452 69
118 3300031731 Ga0307405_10688404 Ga0307405_106884042 69
119 3300031995 Ga0307409_101589652 Ga0307409_1015896521 69
120 3300032002 Ga0307416_100757295 Ga0307416_1007572952 69
121 3300032002 Ga0307416_103330341 Ga0307416_1033303411 69
122 3300032002 Ga0307416_103781217 Ga0307416_1037812171 69
123 3300035112 Ga0373932_0000024 Ga0373932_0000024_27629_27841 69
124 3300039437 Ga0436365_1060264 Ga0436365_1060264_708_920 69
125 3300039450 Ga0436363_0020087 Ga0436363_0020087_1689_1901 69
126 3300039450 Ga0436363_0813118 Ga0436363_0813118_399_611 69
127 3300039453 Ga0436362_0456560 Ga0436362_0456560_380_589 69
128 3300045051 Ga0451576_0373048 Ga0451576_0373048_961_1170 69
129 3300050507 nmdc:mga05p37_1147804_c1 nmdc:mga05p37_1147804_c1_443_652 69
130 3300050512 nmdc:mga0n895_1656606_c1 nmdc:mga0n895_1656606_c1_183_398 69
131 3300050513 nmdc:mga0rr50_198538_c1 nmdc:mga0rr50_198538_c1_446_661 69
132 3300050513 nmdc:mga0rr50_23010_c1 nmdc:mga0rr50_23010_c1_2811_3020 69
133 3300050513 nmdc:mga0rr50_37_c1 nmdc:mga0rr50_37_c1_33667_33876 69
134 3300050514 nmdc:mga08x19_2353_c1 nmdc:mga08x19_2353_c1_7488_7697 69
135 3300053083 Ga0495655_0013697 Ga0495655_0013697_1424_1633 69
136 3300060353 Ga0501082_1179635 Ga0501082_1179635_241_453 69
137 3300005329 Ga0070683_100000068 Ga0070683_10000006823 70
138 3300005329 Ga0070683_100269134 Ga0070683_1002691342 70
139 3300005331 Ga0070670_100000307 Ga0070670_10000030734 70
140 3300005334 Ga0068869_100160079 Ga0068869_1001600792 70
141 3300005334 Ga0068869_101321765 Ga0068869_1013217652 70
142 3300005336 Ga0070680_101069128 Ga0070680_1010691282 70
143 3300005337 Ga0070682_100080448 Ga0070682_1000804484 70
144 3300005338 Ga0068868_100000163 Ga0068868_10000016332 70
145 3300005345 Ga0070692_10043278 Ga0070692_100432782 70
146 3300005354 Ga0070675_100000005 Ga0070675_10000000530 70
147 3300005364 Ga0070673_100359425 Ga0070673_1003594252 70
148 3300005364 Ga0070673_101226276 Ga0070673_1012262762 70
149 3300005434 Ga0070709_11486947 Ga0070709_114869472 70
150 3300005441 Ga0070700_100000025 Ga0070700_10000002534 70
151 3300005458 Ga0070681_10784132 Ga0070681_107841321 70
152 3300005471 Ga0070698_100656716 Ga0070698_1006567162 70
153 3300005518 Ga0070699_100100634 Ga0070699_1001006344 70
154 3300005535 Ga0070684_100000096 Ga0070684_1000000966 70
155 3300005539 Ga0068853_100207944 Ga0068853_1002079442 70
156 3300005543 Ga0070672_101710245 Ga0070672_1017102451 70
157 3300005549 Ga0070704_101114808 Ga0070704_1011148081 70
158 3300005578 Ga0068854_100064231 Ga0068854_1000642313 70
159 3300005578 Ga0068854_100067381 Ga0068854_1000673812 70
160 3300005578 Ga0068854_100867986 Ga0068854_1008679862 70
161 3300005615 Ga0070702_100404131 Ga0070702_1004041311 70
162 3300005615 Ga0070702_101011220 Ga0070702_1010112202 70
163 3300005842 Ga0068858_100638470 Ga0068858_1006384702 70
164 3300005843 Ga0068860_102463809 Ga0068860_1024638092 70
165 3300005844 Ga0068862_102217019 Ga0068862_1022170192 70
166 3300006237 Ga0097621_100118187 Ga0097621_1001181872 70
167 3300006358 Ga0068871_100271422 Ga0068871_1002714222 70
168 3300006844 Ga0075428_100052044 Ga0075428_1000520443 70
169 3300006847 Ga0075431_100625209 Ga0075431_1006252092 70
170 3300006880 Ga0075429_100182636 Ga0075429_1001826362 70
171 3300006880 Ga0075429_101799434 Ga0075429_1017994342 70
172 3300006914 Ga0075436_100387512 Ga0075436_1003875122 70
173 3300007076 Ga0075435_100196059 Ga0075435_1001960592 70
174 3300009098 Ga0105245_10000004 Ga0105245_1000000435 70
175 3300009147 Ga0114129_10377191 Ga0114129_103771912 70
176 3300009147 Ga0114129_12082223 Ga0114129_120822232 70
177 3300009148 Ga0105243_11025416 Ga0105243_110254162 70
178 3300009176 Ga0105242_10030591 Ga0105242_100305915 70
179 3300009551 Ga0105238_10000001 Ga0105238_10000001554 70
180 3300011119 Ga0105246_10091700 Ga0105246_100917002 70
181 3300011119 Ga0105246_10685976 Ga0105246_106859762 70
182 3300013105 Ga0157369_10001042 Ga0157369_1000104230 70
183 3300013296 Ga0157374_10000012 Ga0157374_10000012119 70
184 3300013296 Ga0157374_10310603 Ga0157374_103106033 70
185 3300013297 Ga0157378_10001092 Ga0157378_1000109226 70
186 3300013297 Ga0157378_10002176 Ga0157378_100021762 70
187 3300013308 Ga0157375_10000008 Ga0157375_10000008210 70
188 3300013308 Ga0157375_10001458 Ga0157375_100014582 70
189 3300014325 Ga0163163_10528497 Ga0163163_105284972 70
190 3300014325 Ga0163163_10635482 Ga0163163_106354822 70
191 3300014745 Ga0157377_10000002 Ga0157377_10000002321 70
192 3300014969 Ga0157376_10000025 Ga0157376_1000002540 70
193 3300021358 Ga0213873_10009577 Ga0213873_100095773 70
194 3300021384 Ga0213876_10000080 Ga0213876_1000008018 70
195 3300025315 Ga0207697_10472139 Ga0207697_104721392 70
196 3300025908 Ga0207643_10328935 Ga0207643_103289352 70
197 3300025912 Ga0207707_10492052 Ga0207707_104920522 70
198 3300025917 Ga0207660_10224619 Ga0207660_102246192 70
199 3300025922 Ga0207646_10089955 Ga0207646_100899554 70
200 3300025924 Ga0207694_10000001 Ga0207694_100000011595 70
201 3300025925 Ga0207650_10000262 Ga0207650_1000026219 70
202 3300025925 Ga0207650_10016449 Ga0207650_100164494 70
203 3300025926 Ga0207659_10000067 Ga0207659_1000006735 70
204 3300025927 Ga0207687_10000003 Ga0207687_10000003253 70
205 3300025934 Ga0207686_10005136 Ga0207686_100051366 70
206 3300025942 Ga0207689_10193553 Ga0207689_101935533 70
207 3300025942 Ga0207689_11238340 Ga0207689_112383402 70
208 3300025944 Ga0207661_10000001 Ga0207661_10000001167 70
209 3300025944 Ga0207661_10442978 Ga0207661_104429782 70
210 3300025960 Ga0207651_11118869 Ga0207651_111188692 70
211 3300025981 Ga0207640_10005221 Ga0207640_100052216 70
212 3300025981 Ga0207640_10381888 Ga0207640_103818882 70
213 3300025981 Ga0207640_10590295 Ga0207640_105902952 70
214 3300026023 Ga0207677_10000249 Ga0207677_1000024924 70
215 3300026035 Ga0207703_10538572 Ga0207703_105385722 70
216 3300026041 Ga0207639_10202741 Ga0207639_102027412 70
217 3300026075 Ga0207708_10000052 Ga0207708_1000005212 70
218 3300026089 Ga0207648_11893564 Ga0207648_118935641 70
219 3300026116 Ga0207674_10596029 Ga0207674_105960292 70
220 3300026118 Ga0207675_102607203 Ga0207675_1026072031 70
221 3300028380 Ga0268265_11156655 Ga0268265_111566552 70
222 3300028381 Ga0268264_11660342 Ga0268264_116603422 70
223 3300030521 Ga0307511_10006860 Ga0307511_100068602 70
224 3300035115 Ga0373941_0122334 Ga0373941_0122334_550_762 70
225 3300036401 Ga0373937_1669576 Ga0373937_1669576_137_349 70
226 3300039437 Ga0436365_0138728 Ga0436365_0138728_35419_35631 70
227 3300039450 Ga0436363_1380009 Ga0436363_1380009_119_331 70
228 3300039453 Ga0436362_0839370 Ga0436362_0839370_1176_1388 70
229 3300041496 Ga0451839_0238746 Ga0451839_0238746_372_584 70
230 3300047318 Ga0495636_0682870 Ga0495636_0682870_128_340 70
231 3300048909 Ga0496106_0125645 Ga0496106_0125645_870_1082 70
232 3300048915 Ga0496112_0653403 Ga0496112_0653403_134_346 70
233 3300049589 Ga0501073_0005175 Ga0501073_0005175_1246_1458 70
234 3300049742 Ga0501080_1409025 Ga0501080_1409025_118_330 70
235 3300050507 nmdc:mga05p37_2061854_c1 nmdc:mga05p37_2061854_c1_280_492 70
236 3300050510 nmdc:mga06r32_1055230_c1 nmdc:mga06r32_1055230_c1_362_574 70
237 3300050512 nmdc:mga0n895_535159_c1 nmdc:mga0n895_535159_c1_503_715 70
238 3300050513 nmdc:mga0rr50_214001_c1 nmdc:mga0rr50_214001_c1_443_655 70
239 3300004801 Ga0058860_10937433 Ga0058860_109374332 71
240 3300005293 Ga0065715_10539242 Ga0065715_105392421 71
241 3300005295 Ga0065707_10090664 Ga0065707_100906641 71
242 3300005328 Ga0070676_10382213 Ga0070676_103822132 71
243 3300005330 Ga0070690_100280077 Ga0070690_1002800772 71
244 3300005330 Ga0070690_100791252 Ga0070690_1007912522 71
245 3300005340 Ga0070689_101034783 Ga0070689_1010347832 71
246 3300005343 Ga0070687_100011340 Ga0070687_1000113403 71
247 3300005343 Ga0070687_100657168 Ga0070687_1006571682 71
248 3300005343 Ga0070687_100878694 Ga0070687_1008786941 71
249 3300005343 Ga0070687_101114481 Ga0070687_1011144812 71
250 3300005355 Ga0070671_100416294 Ga0070671_1004162942 71
251 3300005355 Ga0070671_100781588 Ga0070671_1007815882 71
252 3300005364 Ga0070673_101326389 Ga0070673_1013263892 71
253 3300005438 Ga0070701_10001305 Ga0070701_100013057 71
254 3300005441 Ga0070700_102022567 Ga0070700_1020225672 71
255 3300005444 Ga0070694_100639164 Ga0070694_1006391642 71
256 3300005445 Ga0070708_100014308 Ga0070708_1000143083 71
257 3300005445 Ga0070708_100347639 Ga0070708_1003476392 71
258 3300005456 Ga0070678_100096947 Ga0070678_1000969475 71
259 3300005466 Ga0070685_10072746 Ga0070685_100727462 71
260 3300005467 Ga0070706_100001538 Ga0070706_10000153811 71
261 3300005467 Ga0070706_100021795 Ga0070706_1000217951 71
262 3300005467 Ga0070706_100042742 Ga0070706_1000427425 71
263 3300005468 Ga0070707_100057270 Ga0070707_1000572702 71
264 3300005468 Ga0070707_100793834 Ga0070707_1007938342 71
265 3300005468 Ga0070707_100949909 Ga0070707_1009499092 71
266 3300005471 Ga0070698_100079094 Ga0070698_1000790941 71
267 3300005471 Ga0070698_100250619 Ga0070698_1002506192 71
268 3300005471 Ga0070698_100846711 Ga0070698_1008467112 71
269 3300005518 Ga0070699_100035518 Ga0070699_1000355184 71
270 3300005518 Ga0070699_101195569 Ga0070699_1011955692 71
271 3300005536 Ga0070697_100055544 Ga0070697_1000555445 71
272 3300005536 Ga0070697_100493153 Ga0070697_1004931532 71
273 3300005536 Ga0070697_101711178 Ga0070697_1017111781 71
274 3300005544 Ga0070686_100372015 Ga0070686_1003720152 71
275 3300005544 Ga0070686_101062710 Ga0070686_1010627102 71
276 3300005544 Ga0070686_101314931 Ga0070686_1013149312 71
277 3300005549 Ga0070704_100227795 Ga0070704_1002277952 71
278 3300005549 Ga0070704_100231282 Ga0070704_1002312823 71
279 3300005615 Ga0070702_100351975 Ga0070702_1003519753 71
280 3300005615 Ga0070702_100959579 Ga0070702_1009595792 71
281 3300005617 Ga0068859_100000001 Ga0068859_100000001372 71
282 3300006173 Ga0070716_101731355 Ga0070716_1017313551 71
283 3300006847 Ga0075431_100085485 Ga0075431_1000854853 71
284 3300006880 Ga0075429_100068657 Ga0075429_1000686574 71
285 3300006880 Ga0075429_100709584 Ga0075429_1007095842 71
286 3300006931 Ga0097620_100000001 Ga0097620_100000001372 71
287 3300009094 Ga0111539_10000052 Ga0111539_1000005272 71
288 3300009098 Ga0105245_11732452 Ga0105245_117324522 71
289 3300013102 Ga0157371_11355388 Ga0157371_113553881 71
290 3300014326 Ga0157380_10658400 Ga0157380_106584001 71
291 3300014745 Ga0157377_11527695 Ga0157377_115276951 71
292 3300021358 Ga0213873_10000002 Ga0213873_10000002849 71
293 3300021384 Ga0213876_10000001 Ga0213876_10000001932 71
294 3300021384 Ga0213876_10025189 Ga0213876_100251893 71
295 3300021388 Ga0213875_10641497 Ga0213875_106414972 71
296 3300025321 Ga0207656_10163747 Ga0207656_101637472 71
297 3300025904 Ga0207647_10554034 Ga0207647_105540342 71
298 3300025907 Ga0207645_10273173 Ga0207645_102731732 71
299 3300025910 Ga0207684_10021317 Ga0207684_100213172 71
300 3300025910 Ga0207684_10481815 Ga0207684_104818152 71
301 3300025918 Ga0207662_10018606 Ga0207662_100186063 71
302 3300025918 Ga0207662_10273502 Ga0207662_102735023 71
303 3300025918 Ga0207662_11244460 Ga0207662_112444602 71
304 3300025922 Ga0207646_10095108 Ga0207646_100951083 71
305 3300025922 Ga0207646_10410025 Ga0207646_104100252 71
306 3300025927 Ga0207687_11646033 Ga0207687_116460332 71
307 3300025931 Ga0207644_10120812 Ga0207644_101208122 71
308 3300025936 Ga0207670_10459894 Ga0207670_104598942 71
309 3300025960 Ga0207651_11318484 Ga0207651_113184842 71
310 3300027907 Ga0207428_10000003 Ga0207428_1000000372 71
311 3300028800 Ga0265338_10340060 Ga0265338_103400602 71
312 3300031344 Ga0265316_10049285 Ga0265316_100492854 71
313 3300032126 Ga0307415_102294295 Ga0307415_1022942952 71
314 3300037853 Ga0436364_0698840 Ga0436364_0698840_211_426 71
315 3300039437 Ga0436365_0204561 Ga0436365_0204561_1388_1603 71
316 3300039437 Ga0436365_0205514 Ga0436365_0205514_901_1119 71
317 3300039437 Ga0436365_0404975 Ga0436365_0404975_162065_162280 71
318 3300039453 Ga0436362_0660519 Ga0436362_0660519_75402_75617 71
319 3300039453 Ga0436362_0828847 Ga0436362_0828847_399_617 71
320 3300041441 Ga0451787_277244 Ga0451787_277244_134_349 71
321 3300042876 Ga0451577_0146517 Ga0451577_0146517_855_1130 71
322 3300042876 Ga0451577_2039693 Ga0451577_2039693_133_348 71
323 3300044673 Ga0453683_0124155 Ga0453683_0124155_688_903 71
324 3300044673 Ga0453683_0591012 Ga0453683_0591012_434_649 71
325 3300044712 Ga0453684_0043569 Ga0453684_0043569_3823_4098 71
326 3300045051 Ga0451576_1570583 Ga0451576_1570583_60_308 71
327 3300046462 Ga0495651_0794567 Ga0495651_0794567_43_276 71
328 3300046515 Ga0495620_0004380 Ga0495620_0004380_1643_1858 71
329 3300046516 Ga0495628_0118147 Ga0495628_0118147_1494_1727 71
330 3300046537 Ga0495598_0458847 Ga0495598_0458847_67_282 71
331 3300046539 Ga0495621_0145581 Ga0495621_0145581_612_827 71
332 3300046678 Ga0495599_0314835 Ga0495599_0314835_197_430 71
333 3300046689 Ga0495613_0768883 Ga0495613_0768883_216_446 71
334 3300048907 Ga0496104_0273844 Ga0496104_0273844_992_1240 71
335 3300050507 nmdc:mga05p37_1706132_c1 nmdc:mga05p37_1706132_c1_228_443 71
336 3300050508 nmdc:mga09592_42023_c1 nmdc:mga09592_42023_c1_2837_3052 71
337 3300050508 nmdc:mga09592_625396_c1 nmdc:mga09592_625396_c1_671_886 71
338 3300050510 nmdc:mga06r32_76196_c1 nmdc:mga06r32_76196_c1_1449_1664 71
339 3300050511 nmdc:mga08y16_4_c1 nmdc:mga08y16_4_c1_850542_850757 71

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01192

RNA_pol_Rpb6

RNA polymerase Rpb6

5

56

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
7eu1-assembly1.cif.gz_F the cryo-em structure of a. thaliana pol iv-rdr2 holoenzyme 0.9179 10 55
8i24-assembly1.cif.gz_E clostridium thermocellum rna polymerase transcription open complex with sigi6 and its promoter 0.9163 6 55
8i23-assembly1.cif.gz_E clostridium thermocellum rna polymerase transcription open complex with sigi1 and its promoter 0.9153 6 55
8igs-assembly1.cif.gz_K cryo-em structure of rnap-promoter open complex at lambda promoter pre 0.9151 6 53
7xl3-assembly1.cif.gz_E cryo-em structure of pseudomonas aeruginosa rnap sigmas holoenzyme complexes with transcription factor suta (open lobe) 0.9148 9 54
ID Description Score Start End Superfamily
6n60E00 Alpha Beta;Alpha-Beta Complex;Eukaryotic RPB6 RNA polymerase subunit;RNA polymerase subunit, RPB6/omega 0.8776 6 57 3.90.940.10
6algK00 Alpha Beta;Alpha-Beta Complex;Eukaryotic RPB6 RNA polymerase subunit;RNA polymerase subunit, RPB6/omega 0.8756 6 57 3.90.940.10
5uaqK00 Alpha Beta;Alpha-Beta Complex;Eukaryotic RPB6 RNA polymerase subunit;RNA polymerase subunit, RPB6/omega 0.8754 6 57 3.90.940.10
4llgK00 Alpha Beta;Alpha-Beta Complex;Eukaryotic RPB6 RNA polymerase subunit;RNA polymerase subunit, RPB6/omega 0.8752 6 57 3.90.940.10
5nwtE00 Alpha Beta;Alpha-Beta Complex;Eukaryotic RPB6 RNA polymerase subunit;RNA polymerase subunit, RPB6/omega 0.8734 11 57 3.90.940.10
ID Description Score Start End GO Terms
AF-S0ETR1-F1-model_v4 DNA-directed RNA polymerase subunit omega (RNAP omega subunit) (EC 2.7.7.6) (RNA polymerase omega subunit) (Transcriptase subunit omega) 0.9887 10 51 GO:0000428
GO:0001054
GO:0001055
GO:0001056
GO:0001057
GO:0001058
GO:0001066
GO:0003677
AF-A0A2G2MKC5-F1-model_v4 DNA-directed RNA polymerase subunit omega (RNAP omega subunit) (EC 2.7.7.6) (RNA polymerase omega subunit) (Transcriptase subunit omega) 0.9786 8 53 GO:0000428
GO:0001054
GO:0001055
GO:0001056
GO:0001057
GO:0001058
GO:0001066
GO:0003677
AF-A0A2V7XAB6-F1-model_v4 DNA-directed RNA polymerase subunit omega (RNAP omega subunit) (EC 2.7.7.6) (RNA polymerase omega subunit) (Transcriptase subunit omega) 0.9719 4 56 GO:0000428
GO:0001054
GO:0001055
GO:0001056
GO:0001057
GO:0001058
GO:0001066
GO:0003677
AF-X1PZD2-F1-model_v4 DNA-directed RNA polymerase (EC 2.7.7.6) 0.9691 8 54 GO:0000428
GO:0001054
GO:0001055
GO:0001056
GO:0001057
GO:0001058
GO:0001065
GO:0001066
GO:0003677
AF-A0A2M8C9G0-F1-model_v4 DNA-directed RNA polymerase subunit omega (EC 2.7.7.6) (Transcriptase subunit omega) 0.9637 9 56 GO:0000428
GO:0001054
GO:0001055
GO:0001056
GO:0001057
GO:0001058
GO:0001066
GO:0003677

Feature Viewer

pLDDT pTM Quality
80.27 0.62 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map