F413927

General Info

Members Datasets Scaffolds Average Seq Length
339 213 317 243

Family's Representative Sequence

Representative Sequence 3300017792|Ga0163161_10003118|Ga0163161_100031185
Length 285
Sequence MKISPSDDVLIPYPVILGLWVLFLSLSGCIIISPSKKRRITKKMKFSIDHKSPVPLHIQAEELLRNLIKDPEYATKSLPNEVDMAKQLAISRSTLRQALNKLVYEGLLIRKKGIGTKVAVGAVSSKASNWLSFSQEMQARGIPIKNFELHISWVFPDEKLAHFFHIGTDKKILKLERVRGKAEGPFVYFISYFHPRIALTGDEDFKRPLYDILADHSFIATLSKEEISAKGADKFIAEKLNIEIGSPLLFRKRFVFDQGDRPIEYNLGYYLSDSFVYSVESRRNV

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2721755487 Sphingobacterium sp. B29 Isolate Rhizosphere
3 2738541278 Niastella sp. CF465 Isolate Unclassified
4 2738541283 Pedobacter sp. OK701 Isolate Unclassified
5 2738541284 Pedobacter sp. YR016 Isolate Unclassified
6 2775506987 Pedobacter ginsengisoli T01R-27 Isolate Unclassified
7 2818991442 Chitinophaga pinensis 1204 Isolate Unclassified
8 2818991460 Chitinophaga polysaccharea 1209 Isolate Unclassified
9 2821136567 Chitinophaga sancti 1232 Isolate Unclassified
10 2883068021 Chitinophaga rhizosphaerae T16R-86 Isolate Rhizosphere
11 2884791551 Chitinophaga oryzae 1310 Isolate Unclassified
12 2904467357 Chitinophaga sancti 3198 Isolate Unclassified
13 2904780799 Sphingobacterium sp. 1304 Isolate Rhizosphere
14 2919177583 Sphingobacterium sp. 2149 Isolate Rhizosphere
15 2919186247 Pedobacter africanus 2697 Isolate Rhizosphere
16 2919437846 Mucilaginibacter pocheonensis 3262 Isolate Rhizosphere
17 2929177148 Chitinophaga sp. R-72269 Hybrid assembly Isolate Unclassified
18 2929239360 Chitinophaga sp. R-73072 Hybrid assembly Isolate Unclassified
19 2929921140 Chitinophaga sp. R-72609 Hybrid assembly Isolate Unclassified
20 2939664404 Pedobacter africanus 2990 Isolate Rhizosphere
21 2945977869 Chitinophaga sp. W2I13 Isolate Rhizosphere
22 2946013367 Chitinophaga sp. W3I9 Isolate Rhizosphere
23 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
24 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
25 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
26 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
27 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
28 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
29 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
30 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
31 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
32 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
33 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
34 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
35 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
36 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
37 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
38 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
39 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
40 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
41 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
42 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
43 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
44 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
45 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
46 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
47 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
48 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
49 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
50 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
51 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
52 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
53 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
54 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
55 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
56 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
57 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
58 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
59 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
60 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
61 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
62 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
63 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
64 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
65 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
66 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
67 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
68 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
69 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
70 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
71 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
72 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
73 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
75 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
77 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
78 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
79 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
80 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
81 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
82 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
83 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
84 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
85 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
86 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
87 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
88 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
89 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
90 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
91 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
92 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
93 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
94 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
95 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
96 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
97 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
98 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
99 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
100 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
101 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
102 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
103 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
104 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
105 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
106 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
107 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
108 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
109 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
110 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
111 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
112 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
113 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
114 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
115 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
116 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
117 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
118 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
119 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
120 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
151 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
152 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
153 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
154 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
155 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
156 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
157 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
158 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
159 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
160 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
161 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
162 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
163 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
164 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
165 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
166 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
167 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
168 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
169 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
170 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
171 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
172 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
173 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
174 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
175 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
176 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
177 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
178 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
179 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
180 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
181 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
182 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
183 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
184 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
185 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
186 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
187 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
188 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
189 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
190 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
191 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
192 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
193 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
194 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
195 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
196 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
197 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
198 3300053100 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere Metagenome Endosphere
199 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
200 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
201 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
202 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
203 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
204 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
205 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
206 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
207 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
208 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
209 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
210 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
211 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
212 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
213 8003151029 Chitinophaga sp. GbtcB8 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 93.51
Metatranscriptomes 0
Isolates 6.49

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 19.17
Nodule 0
Rhizoplane 0
Rhizosphere 66.96
Stem 0
Stem Tuber 0
Unclassified 13.86

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_2582835 2162886007 Bacteria 31450
2 JGI24736J21556_1011822 3300001904 Bacteria 1417
3 JGI24740J21852_10005198 3300001979 Bacteria 5525
4 JGI24740J21852_10042885 3300001979 Bacteria 1352
5 JGI25154J39366_1000007 3300002738 Bacteria 335932
6 JGI25157J39369_1006585 3300002741 Bacteria 1751
7 JGI25152J39213_1000017 3300002773 Bacteria 109718
8 JGI25150J39212_1000001 3300002774 Bacteria 1318726
9 JGI25159J45721_1014150 3300002987 Bacteria 1814
10 JGI25151J46595_10000001 3300003187 Bacteria 887211
11 JGI25153J46596_10000053 3300003215 Bacteria 138301
12 JGI25153J46596_10003698 3300003215 Bacteria 8455
13 rootH1_10090452 3300003316 Bacteria 6753
14 rootH2_10313354 3300003320 Bacteria 1137
15 rootL2_10062071 3300003322 Bacteria 1299
16 rootL2_10160414 3300003322 Bacteria 5459
17 rootL2_10188103 3300003322 Bacteria 2148
18 rootL2_10252890 3300003322 Bacteria 6178
19 rootH1_10010762 3300003323 Bacteria 5572
20 rootH1_10159685 3300003323 Bacteria 1548
21 rootH1_10378434 3300003323 Bacteria 3143
22 JGI25160J50197_1005189 3300003354 Bacteria 5465
23 JGI25160J50197_1010063 3300003354 Bacteria 3452
24 JGI25160J50197_1031579 3300003354 Unclassified 1361
25 Ga0055535_1002818 3300003761 Bacteria 5520
26 Ga0055536_1000011 3300003781 Bacteria 275969
27 Ga0055536_1025583 3300003781 Bacteria 1677
28 Ga0055530_10000680 3300003791 Bacteria 28903
29 Ga0065165_1000451 3300005262 Bacteria 64388
30 Ga0065165_1014990 3300005262 Bacteria 2979
31 Ga0065714_10002468 3300005288 Bacteria 47042
32 Ga0065714_10002578 3300005288 Bacteria 14748
33 Ga0065714_10020153 3300005288 Bacteria 1631
34 Ga0065714_10072898 3300005288 Bacteria 3280
35 Ga0065704_10000216 3300005289 Bacteria 79434
36 Ga0065704_10001141 3300005289 Bacteria 9730
37 Ga0070658_10424087 3300005327 Bacteria 1144
38 Ga0068869_100097182 3300005334 Bacteria 2223
39 Ga0070666_10000047 3300005335 Bacteria 106512
40 Ga0068868_100096393 3300005338 Bacteria 2389
41 Ga0068868_100104714 3300005338 Bacteria 2293
42 Ga0068868_100142388 3300005338 Bacteria 1969
43 Ga0070689_100046046 3300005340 Bacteria 3360
44 Ga0070668_100254809 3300005347 Bacteria 1458
45 Ga0070671_100246008 3300005355 Bacteria 1518
46 Ga0070674_100329709 3300005356 Bacteria 1226
47 Ga0070673_100048404 3300005364 Bacteria 3314
48 Ga0070673_100157991 3300005364 Bacteria 1926
49 Ga0070667_100260607 3300005367 Bacteria 1552
50 Ga0070667_100806690 3300005367 Bacteria 871
51 Ga0070678_100393627 3300005456 Unclassified 1202
52 Ga0070662_100000130 3300005457 Bacteria 42139
53 Ga0068867_100037369 3300005459 Bacteria 3529
54 Ga0070685_10195522 3300005466 Bacteria 1311
55 Ga0068853_100029891 3300005539 Bacteria 4597
56 Ga0068853_100557032 3300005539 Bacteria 1086
57 Ga0070672_100318497 3300005543 Bacteria 1322
58 Ga0070665_100961658 3300005548 Bacteria 866
59 Ga0068855_100059005 3300005563 Bacteria 4491
60 Ga0068855_100627749 3300005563 Bacteria 1156
61 Ga0068854_100213852 3300005578 Bacteria 1522
62 Ga0068856_100192354 3300005614 Bacteria 2054
63 Ga0068852_100022013 3300005616 Bacteria 5102
64 Ga0068852_100304268 3300005616 Bacteria 1544
65 Ga0068859_100000030 3300005617 Bacteria 175435
66 Ga0068859_100165546 3300005617 Bacteria 2291
67 Ga0068864_100019899 3300005618 Bacteria 5611
68 Ga0068866_10400188 3300005718 Bacteria 885
69 Ga0068851_10027170 3300005834 Bacteria 2819
70 Ga0068851_10171626 3300005834 Bacteria 1197
71 Ga0068863_100001320 3300005841 Bacteria 24709
72 Ga0068863_100009494 3300005841 Bacteria 9488
73 Ga0068858_100024628 3300005842 Bacteria 5607
74 Ga0068858_100232697 3300005842 Bacteria 1747
75 Ga0068858_100648538 3300005842 Bacteria 1026
76 Ga0068860_100002795 3300005843 Bacteria 18152
77 Ga0068860_100337299 3300005843 Bacteria 1482
78 Ga0068862_100072658 3300005844 Bacteria 2972
79 Ga0068862_100343866 3300005844 Bacteria 1382
80 Ga0075366_10381046 3300006195 Bacteria 867
81 Ga0097621_100029518 3300006237 Bacteria 4332
82 Ga0097621_100480142 3300006237 Bacteria 1123
83 Ga0068871_100062545 3300006358 Bacteria 3042
84 Ga0068871_100918070 3300006358 Bacteria 812
85 Ga0097620_100000030 3300006931 Bacteria 175435
86 Ga0097620_100165546 3300006931 Bacteria 2291
87 Ga0105240_10001644 3300009093 Bacteria 37960
88 Ga0105240_10013344 3300009093 Bacteria 11291
89 Ga0105240_10015198 3300009093 Bacteria 10475
90 Ga0105240_10505495 3300009093 Bacteria 1343
91 Ga0105247_10029974 3300009101 Bacteria 3298
92 Ga0105243_10000012 3300009148 Bacteria 300885
93 Ga0105241_10005723 3300009174 Bacteria 9174
94 Ga0105241_10055253 3300009174 Bacteria 3042
95 Ga0105242_10078179 3300009176 Bacteria 2761
96 Ga0105242_10088237 3300009176 Bacteria 2605
97 Ga0105237_10002280 3300009545 Bacteria 23870
98 Ga0105237_10007254 3300009545 Bacteria 12158
99 Ga0105237_10011253 3300009545 Bacteria 9467
100 Ga0105237_10029904 3300009545 Bacteria 5534
101 Ga0105237_10069631 3300009545 Unclassified 3514
102 Ga0105237_10410755 3300009545 Bacteria 1359
103 Ga0105237_10411904 3300009545 Bacteria 1357
104 Ga0105237_10611167 3300009545 Bacteria 1097
105 Ga0105238_10078892 3300009551 Bacteria 3283
106 Ga0105238_10234557 3300009551 Bacteria 1812
107 Ga0105249_10286133 3300009553 Bacteria 1648
108 Ga0105249_10432946 3300009553 Bacteria 1351
109 Ga0105239_10000004 3300010375 Bacteria 532483
110 Ga0105239_10002087 3300010375 Bacteria 25905
111 Ga0105239_10007705 3300010375 Bacteria 12327
112 Ga0105239_10022935 3300010375 Bacteria 6882
113 Ga0105246_10024945 3300011119 Bacteria 3893
114 Ga0105246_10173986 3300011119 Bacteria 1651
115 Ga0105246_10366892 3300011119 Bacteria 1185
116 Ga0157373_10000172 3300013100 Bacteria 52820
117 Ga0157373_10003630 3300013100 Bacteria 11655
118 Ga0157373_10009289 3300013100 Bacteria 7270
119 Ga0157373_10296279 3300013100 Bacteria 1147
120 Ga0157371_10000693 3300013102 Bacteria 39719
121 Ga0157371_10000997 3300013102 Bacteria 31307
122 Ga0157371_10031140 3300013102 Bacteria 3844
123 Ga0157371_10173319 3300013102 Bacteria 1542
124 Ga0157370_10004607 3300013104 Bacteria 15766
125 Ga0157370_10006092 3300013104 Bacteria 13384
126 Ga0157370_10011222 3300013104 Bacteria 9394
127 Ga0157370_10020855 3300013104 Bacteria 6539
128 Ga0157370_10022158 3300013104 Bacteria 6325
129 Ga0157370_10202837 3300013104 Bacteria 1839
130 Ga0157374_10007835 3300013296 Bacteria 9118
131 Ga0157374_10058575 3300013296 Bacteria 3600
132 Ga0157374_10719934 3300013296 Bacteria 1012
133 Ga0157378_10005079 3300013297 Bacteria 11561
134 Ga0163162_10001435 3300013306 Bacteria 22200
135 Ga0163162_10010646 3300013306 Bacteria 8944
136 Ga0163162_10311143 3300013306 Bacteria 1707
137 Ga0163162_10705555 3300013306 Bacteria 1130
138 Ga0157372_10008932 3300013307 Bacteria 10649
139 Ga0157375_10197828 3300013308 Bacteria 2165
140 Ga0157375_10300713 3300013308 Bacteria 1768
141 Ga0163163_10023063 3300014325 Bacteria 5902
142 Ga0182008_10000008 3300014497 Bacteria 371823
143 Ga0182008_10000091 3300014497 Bacteria 69363
144 Ga0157377_10092736 3300014745 Bacteria 1786
145 Ga0157379_10201825 3300014968 Bacteria 1798
146 Ga0182006_1005087 3300015261 Bacteria 6321
147 Ga0182006_1007928 3300015261 Bacteria 4832
148 Ga0182007_10034146 3300015262 Bacteria 1721
149 Ga0182005_1000039 3300015265 Bacteria 155210
150 Ga0163161_10000905 3300017792 Bacteria 22916
151 Ga0163161_10002742 3300017792 Bacteria 12533
152 Ga0163161_10003118 3300017792 Bacteria 11686
153 Ga0209436_100239 3300025208 Bacteria 25230
154 Ga0209436_101170 3300025208 Bacteria 9670
155 Ga0209436_103224 3300025208 Bacteria 4433
156 Ga0207427_100043 3300025231 Bacteria 249595
157 Ga0209437_100170 3300025233 Bacteria 142489
158 Ga0209258_100285 3300025242 Bacteria 83382
159 Ga0207425_1000002 3300025245 Bacteria 1362590
160 Ga0209646_1000002 3300025246 Bacteria 1425781
161 Ga0209026_1000086 3300025250 Bacteria 185551
162 Ga0209026_1005368 3300025250 Bacteria 3467
163 Ga0209026_1008151 3300025250 Bacteria 2231
164 Ga0209148_1000257 3300025254 Bacteria 83444
165 Ga0209129_1000002 3300025258 Bacteria 1359086
166 Ga0209129_1014068 3300025258 Bacteria 1723
167 Ga0209233_1000507 3300025261 Bacteria 23118
168 Ga0209455_1002291 3300025272 Bacteria 7527
169 Ga0209455_1006137 3300025272 Bacteria 3605
170 Ga0209130_1000599 3300025284 Bacteria 34930
171 Ga0209130_1001909 3300025284 Bacteria 11747
172 Ga0209676_1000001 3300025292 Bacteria 1852142
173 Ga0209676_1000321 3300025292 Bacteria 92845
174 Ga0209025_1000004 3300025294 Bacteria 1361782
175 Ga0209564_1007248 3300025295 Bacteria 5765
176 Ga0209758_1000006 3300025297 Bacteria 1359562
177 Ga0209758_1006887 3300025297 Bacteria 7939
178 Ga0209758_1034082 3300025297 Bacteria 2032
179 Ga0209050_1000016 3300025298 Bacteria 729149
180 Ga0207426_1000034 3300025302 Bacteria 454016
181 Ga0207426_1000216 3300025302 Bacteria 136337
182 Ga0207426_1002704 3300025302 Bacteria 10808
183 Ga0207426_1021501 3300025302 Bacteria 2231
184 Ga0207656_10033630 3300025321 Bacteria 2137
185 Ga0207642_10310905 3300025899 Bacteria 917
186 Ga0207710_10046386 3300025900 Bacteria 1940
187 Ga0207680_10000387 3300025903 Bacteria 21026
188 Ga0207647_10000170 3300025904 Bacteria 52044
189 Ga0207647_10092682 3300025904 Bacteria 1801
190 Ga0207705_10171850 3300025909 Bacteria 1632
191 Ga0207654_10011988 3300025911 Bacteria 4434
192 Ga0207695_10001273 3300025913 Bacteria 42881
193 Ga0207695_10013273 3300025913 Bacteria 9828
194 Ga0207671_10001884 3300025914 Bacteria 23313
195 Ga0207671_10003405 3300025914 Bacteria 15902
196 Ga0207671_10003991 3300025914 Bacteria 14342
197 Ga0207671_10009640 3300025914 Bacteria 8050
198 Ga0207671_10021636 3300025914 Bacteria 4875
199 Ga0207706_10000279 3300025933 Bacteria 55729
200 Ga0207686_10061224 3300025934 Bacteria 2385
201 Ga0207686_10136133 3300025934 Bacteria 1691
202 Ga0207709_10000006 3300025935 Bacteria 800946
203 Ga0207670_10168112 3300025936 Bacteria 1642
204 Ga0207704_10163302 3300025938 Bacteria 1588
205 Ga0207689_10001108 3300025942 Bacteria 25980
206 Ga0207689_10009840 3300025942 Bacteria 8240
207 Ga0207689_10014653 3300025942 Bacteria 6661
208 Ga0207667_10135798 3300025949 Bacteria 2533
209 Ga0207667_10295625 3300025949 Bacteria 1654
210 Ga0207651_10089254 3300025960 Bacteria 2250
211 Ga0207712_10007512 3300025961 Bacteria 6882
212 Ga0207668_10177401 3300025972 Bacteria 1677
213 Ga0207658_10177362 3300025986 Bacteria 1761
214 Ga0207677_10012017 3300026023 Bacteria 4959
215 Ga0207677_10044497 3300026023 Bacteria 2958
216 Ga0207703_10005809 3300026035 Bacteria 9889
217 Ga0207703_10604987 3300026035 Bacteria 1037
218 Ga0207639_10226169 3300026041 Bacteria 1619
219 Ga0207639_10381999 3300026041 Bacteria 1265
220 Ga0207702_10213947 3300026078 Bacteria 1793
221 Ga0207641_10000061 3300026088 Bacteria 160161
222 Ga0207641_10044995 3300026088 Bacteria 3714
223 Ga0207648_10008307 3300026089 Bacteria 10079
224 Ga0207676_10124192 3300026095 Bacteria 2182
225 Ga0207675_100014181 3300026118 Bacteria 7431
226 Ga0207698_10030723 3300026142 Bacteria 3868
227 Ga0207698_10627920 3300026142 Bacteria 1062
228 Ga0207698_11049682 3300026142 Bacteria 827
229 Ga0268266_10172332 3300028379 Bacteria 1965
230 Ga0307517_10223487 3300028786 Bacteria 1141
231 Ga0307515_10000071 3300028794 Bacteria 238152
232 Ga0307515_10082654 3300028794 Bacteria 4150
233 Ga0307513_10033760 3300031456 Bacteria 5748
234 Ga0307513_10081952 3300031456 Bacteria 3323
235 Ga0307513_10400599 3300031456 Bacteria 1107
236 Ga0307509_10074770 3300031507 Bacteria 3522
237 Ga0307508_10000372 3300031616 Bacteria 54456
238 Ga0307405_10067014 3300031731 Bacteria 2291
239 Ga0307412_10000009 3300031911 Bacteria 445987
240 Ga0307412_10174453 3300031911 Bacteria 1610
241 Ga0307416_100000001 3300032002 Bacteria 515017
242 Ga0307414_10000207 3300032004 Bacteria 39639
243 Ga0307414_10002105 3300032004 Bacteria 10373
244 Ga0307414_10020830 3300032004 Bacteria 4095
245 Ga0307414_10070267 3300032004 Bacteria 2521
246 Ga0307414_10114131 3300032004 Bacteria 2063
247 Ga0307414_10282012 3300032004 Bacteria 1396
248 Ga0307414_10496188 3300032004 Bacteria 1079
249 Ga0307510_10000497 3300033180 Bacteria 38862
250 Ga0439436_0005311 3300041404 Bacteria 3950
251 Ga0451853_3333784 3300041512 Bacteria 1282
252 Ga0439434_0053589 3300042435 Bacteria 1253
253 Ga0466972_0007549 3300044658 Bacteria 5458
254 Ga0466972_0215514 3300044658 Bacteria 898
255 Ga0466961_0297787 3300044693 Bacteria 986
256 Ga0453684_0411699 3300044712 Bacteria 1512
257 Ga0466959_0125852 3300045049 Unclassified 1819
258 Ga0495638_0030318 3300046460 Unclassified 3483
259 Ga0495638_0052305 3300046460 Bacteria 2544
260 Ga0495651_0132642 3300046462 Bacteria 1817
261 Ga0495605_0082143 3300046474 Bacteria 1506
262 Ga0495585_0005987 3300046492 Bacteria 7609
263 Ga0495606_0008250 3300046507 Bacteria 9092
264 Ga0495606_0019935 3300046507 Bacteria 4965
265 Ga0495608_0236738 3300046511 Bacteria 1142
266 Ga0495610_0000733 3300046512 Bacteria 31050
267 Ga0495610_0002378 3300046512 Bacteria 15866
268 Ga0495616_0002973 3300046513 Bacteria 11008
269 Ga0495637_0011954 3300046520 Bacteria 4161
270 Ga0495643_0113470 3300046522 Bacteria 1375
271 Ga0495648_0005974 3300046524 Bacteria 10008
272 Ga0495648_0010779 3300046524 Bacteria 6941
273 Ga0495652_0087346 3300046529 Bacteria 2558
274 Ga0495625_0000252 3300046660 Bacteria 83831
275 Ga0495625_0005223 3300046660 Bacteria 11955
276 Ga0495625_0071392 3300046660 Bacteria 2436
277 Ga0495661_0000134 3300046665 Bacteria 87487
278 Ga0495661_0002237 3300046665 Bacteria 14994
279 Ga0495671_0050751 3300046692 Bacteria 2065
280 Ga0495589_0143074 3300046794 Bacteria 1144
281 Ga0495686_0011932 3300047472 Bacteria 6105
282 Ga0495686_0142236 3300047472 Bacteria 1415
283 Ga0496116_0004290 3300048919 Bacteria 13667
284 Ga0496117_0029797 3300048920 Bacteria 4201
285 Ga0496117_0397829 3300048920 Bacteria 696
286 Ga0496122_0000435 3300048925 Bacteria 87533
287 Ga0496122_0006722 3300048925 Bacteria 13087
288 Ga0496123_0008241 3300048926 Bacteria 9608
289 Ga0496123_0045308 3300048926 Bacteria 2998
290 Ga0496125_0098806 3300048928 Bacteria 2159
291 Ga0496125_0205364 3300048928 Bacteria 1285
292 Ga0495678_045625 3300049459 Bacteria 1727
293 Ga0501047_0076928 3300049581 Bacteria 3211
294 Ga0501238_001774 3300049671 Bacteria 2518
295 Ga0501241_002881 3300049758 Bacteria 3298
296 Ga0500578_0000358 3300053086 Bacteria 56123
297 Ga0500644_0001909 3300053088 Bacteria 5347
298 Ga0500646_0100545 3300053090 Bacteria 907
299 Ga0500583_0001162 3300053092 Bacteria 7505
300 Ga0500651_0006585 3300053093 Bacteria 6707
301 Ga0500660_179769 3300053100 Bacteria 766
302 Ga0500569_000144 3300053109 Bacteria 11327
303 Ga0500618_000191 3300053125 Bacteria 50316
304 Ga0500658_0034951 3300053134 Unclassified 1987
305 Ga0500559_0007655 3300053136 Bacteria 4770
306 Ga0500568_0013505 3300053139 Bacteria 3721
307 Ga0500568_0037645 3300053139 Unclassified 1961
308 Ga0500577_0021993 3300053142 Unclassified 2109
309 Ga0500589_023736 3300053147 Bacteria 2829
310 Ga0500604_0005692 3300053151 Bacteria 3289
311 Ga0500616_0009444 3300053153 Bacteria 5933
312 Ga0500622_0007866 3300053156 Bacteria 6005
313 Ga0500622_0157943 3300053156 Bacteria 1066
314 Ga0500633_0000675 3300053160 Bacteria 5732
315 Ga0500636_0031674 3300053177 Bacteria 3129
316 Ga0500637_0060585 3300053178 Bacteria 2168
317 Ga0500661_006197 3300055283 Bacteria 2228

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2818991460 2819681892 216
2 iso_pu_bacteria 2929177148 2929179595 216
3 3300048920 Ga0496117_0397829 Ga0496117_0397829_19_681 220
4 3300053100 Ga0500660_179769 Ga0500660_179769_63_725 220
5 3300026078 Ga0207702_10213947 Ga0207702_102139471 226
6 3300046794 Ga0495589_0143074 Ga0495589_0143074_16_702 228
7 3300013306 Ga0163162_10311143 Ga0163162_103111432 232
8 iso_pu_bacteria 2919437846 2919443116 238
9 iso_pu_bacteria 2738541278 2738731026 239
10 iso_pu_bacteria 2738541283 2738757433 239
11 iso_pu_bacteria 2738541284 2738760612 239
12 iso_pu_bacteria 2775506987 2776612767 239
13 iso_pu_bacteria 2818991442 2819574023 239
14 iso_pu_bacteria 2821136567 2821137339 239
15 iso_pu_bacteria 2883068021 2883070966 239
16 iso_pu_bacteria 2884791551 2884794332 239
17 iso_pu_bacteria 2904467357 2904467920 239
18 iso_pu_bacteria 2919186247 2919190142 239
19 iso_pu_bacteria 2929239360 2929243122 239
20 iso_pu_bacteria 2929921140 2929923546 239
21 iso_pu_bacteria 2939664404 2939668423 239
22 iso_pu_bacteria 2945977869 2945982013 239
23 iso_pu_bacteria 8003151029 8003154416 239
24 iso_pu_bacteria 2721755487 2722729189 240
25 iso_pu_bacteria 2904780799 2904780909 240
26 iso_pu_bacteria 2919177583 2919180627 240
27 3300003316 rootH1_10090452 rootH1_100904525 241
28 3300003322 rootL2_10188103 rootL2_101881032 241
29 3300017792 Ga0163161_10003118 Ga0163161_100031185 241
30 3300001904 JGI24736J21556_1011822 JGI24736J21556_10118222 242
31 3300001979 JGI24740J21852_10042885 JGI24740J21852_100428852 242
32 3300002773 JGI25152J39213_1000017 JGI25152J39213_100001770 242
33 3300002774 JGI25150J39212_1000001 JGI25150J39212_1000001744 242
34 3300002987 JGI25159J45721_1014150 JGI25159J45721_10141502 242
35 3300003187 JGI25151J46595_10000001 JGI25151J46595_1000000161 242
36 3300003215 JGI25153J46596_10000053 JGI25153J46596_1000005351 242
37 3300003320 rootH2_10313354 rootH2_103133541 242
38 3300003322 rootL2_10062071 rootL2_100620712 242
39 3300003322 rootL2_10160414 rootL2_101604143 242
40 3300003322 rootL2_10252890 rootL2_102528903 242
41 3300003323 rootH1_10378434 rootH1_103784343 242
42 3300003781 Ga0055536_1000011 Ga0055536_100001143 242
43 3300003791 Ga0055530_10000680 Ga0055530_1000068013 242
44 3300005288 Ga0065714_10020153 Ga0065714_100201531 242
45 3300005327 Ga0070658_10424087 Ga0070658_104240871 242
46 3300005334 Ga0068869_100097182 Ga0068869_1000971822 242
47 3300005335 Ga0070666_10000047 Ga0070666_1000004775 242
48 3300005338 Ga0068868_100096393 Ga0068868_1000963932 242
49 3300005338 Ga0068868_100104714 Ga0068868_1001047142 242
50 3300005338 Ga0068868_100142388 Ga0068868_1001423882 242
51 3300005340 Ga0070689_100046046 Ga0070689_1000460462 242
52 3300005347 Ga0070668_100254809 Ga0070668_1002548092 242
53 3300005355 Ga0070671_100246008 Ga0070671_1002460082 242
54 3300005356 Ga0070674_100329709 Ga0070674_1003297092 242
55 3300005364 Ga0070673_100048404 Ga0070673_1000484042 242
56 3300005364 Ga0070673_100157991 Ga0070673_1001579911 242
57 3300005367 Ga0070667_100806690 Ga0070667_1008066901 242
58 3300005457 Ga0070662_100000130 Ga0070662_10000013024 242
59 3300005466 Ga0070685_10195522 Ga0070685_101955222 242
60 3300005539 Ga0068853_100029891 Ga0068853_1000298911 242
61 3300005539 Ga0068853_100557032 Ga0068853_1005570321 242
62 3300005543 Ga0070672_100318497 Ga0070672_1003184972 242
63 3300005563 Ga0068855_100059005 Ga0068855_1000590054 242
64 3300005563 Ga0068855_100627749 Ga0068855_1006277492 242
65 3300005578 Ga0068854_100213852 Ga0068854_1002138522 242
66 3300005614 Ga0068856_100192354 Ga0068856_1001923542 242
67 3300005616 Ga0068852_100022013 Ga0068852_1000220132 242
68 3300005616 Ga0068852_100304268 Ga0068852_1003042682 242
69 3300005617 Ga0068859_100000030 Ga0068859_10000003069 242
70 3300005617 Ga0068859_100165546 Ga0068859_1001655463 242
71 3300005618 Ga0068864_100019899 Ga0068864_1000198992 242
72 3300005718 Ga0068866_10400188 Ga0068866_104001881 242
73 3300005834 Ga0068851_10027170 Ga0068851_100271702 242
74 3300005834 Ga0068851_10171626 Ga0068851_101716261 242
75 3300005841 Ga0068863_100001320 Ga0068863_10000132015 242
76 3300005841 Ga0068863_100009494 Ga0068863_1000094945 242
77 3300005842 Ga0068858_100024628 Ga0068858_1000246282 242
78 3300005842 Ga0068858_100232697 Ga0068858_1002326972 242
79 3300005842 Ga0068858_100648538 Ga0068858_1006485382 242
80 3300005843 Ga0068860_100002795 Ga0068860_10000279512 242
81 3300005844 Ga0068862_100343866 Ga0068862_1003438662 242
82 3300006195 Ga0075366_10381046 Ga0075366_103810461 242
83 3300006237 Ga0097621_100029518 Ga0097621_1000295184 242
84 3300006237 Ga0097621_100480142 Ga0097621_1004801421 242
85 3300006358 Ga0068871_100062545 Ga0068871_1000625452 242
86 3300006358 Ga0068871_100918070 Ga0068871_1009180701 242
87 3300006931 Ga0097620_100000030 Ga0097620_10000003076 242
88 3300006931 Ga0097620_100165546 Ga0097620_1001655463 242
89 3300009093 Ga0105240_10001644 Ga0105240_1000164432 242
90 3300009093 Ga0105240_10013344 Ga0105240_100133445 242
91 3300009093 Ga0105240_10015198 Ga0105240_100151988 242
92 3300009093 Ga0105240_10505495 Ga0105240_105054952 242
93 3300009101 Ga0105247_10029974 Ga0105247_100299742 242
94 3300009174 Ga0105241_10005723 Ga0105241_100057236 242
95 3300009174 Ga0105241_10055253 Ga0105241_100552533 242
96 3300009176 Ga0105242_10078179 Ga0105242_100781792 242
97 3300009176 Ga0105242_10088237 Ga0105242_100882372 242
98 3300009545 Ga0105237_10002280 Ga0105237_100022806 242
99 3300009545 Ga0105237_10011253 Ga0105237_100112536 242
100 3300009545 Ga0105237_10029904 Ga0105237_100299042 242
101 3300009545 Ga0105237_10069631 Ga0105237_100696312 242
102 3300009545 Ga0105237_10410755 Ga0105237_104107553 242
103 3300009545 Ga0105237_10411904 Ga0105237_104119043 242
104 3300009545 Ga0105237_10611167 Ga0105237_106111671 242
105 3300009551 Ga0105238_10234557 Ga0105238_102345574 242
106 3300009553 Ga0105249_10286133 Ga0105249_102861332 242
107 3300009553 Ga0105249_10432946 Ga0105249_104329461 242
108 3300010375 Ga0105239_10000004 Ga0105239_10000004342 242
109 3300010375 Ga0105239_10002087 Ga0105239_100020876 242
110 3300010375 Ga0105239_10007705 Ga0105239_100077052 242
111 3300010375 Ga0105239_10022935 Ga0105239_100229353 242
112 3300011119 Ga0105246_10024945 Ga0105246_100249451 242
113 3300011119 Ga0105246_10173986 Ga0105246_101739862 242
114 3300011119 Ga0105246_10366892 Ga0105246_103668922 242
115 3300013100 Ga0157373_10003630 Ga0157373_100036303 242
116 3300013100 Ga0157373_10009289 Ga0157373_100092895 242
117 3300013102 Ga0157371_10031140 Ga0157371_100311402 242
118 3300013104 Ga0157370_10006092 Ga0157370_100060924 242
119 3300013104 Ga0157370_10020855 Ga0157370_100208551 242
120 3300013104 Ga0157370_10022158 Ga0157370_100221584 242
121 3300013296 Ga0157374_10007835 Ga0157374_100078357 242
122 3300013296 Ga0157374_10058575 Ga0157374_100585754 242
123 3300013296 Ga0157374_10719934 Ga0157374_107199342 242
124 3300013297 Ga0157378_10005079 Ga0157378_1000507913 242
125 3300013306 Ga0163162_10001435 Ga0163162_1000143516 242
126 3300013306 Ga0163162_10705555 Ga0163162_107055551 242
127 3300013307 Ga0157372_10008932 Ga0157372_100089322 242
128 3300013308 Ga0157375_10197828 Ga0157375_101978282 242
129 3300013308 Ga0157375_10300713 Ga0157375_103007131 242
130 3300014325 Ga0163163_10023063 Ga0163163_100230633 242
131 3300014745 Ga0157377_10092736 Ga0157377_100927362 242
132 3300014968 Ga0157379_10201825 Ga0157379_102018252 242
133 3300015262 Ga0182007_10034146 Ga0182007_100341461 242
134 3300017792 Ga0163161_10002742 Ga0163161_100027422 242
135 3300025208 Ga0209436_100239 Ga0209436_1002395 242
136 3300025231 Ga0207427_100043 Ga0207427_100043107 242
137 3300025233 Ga0209437_100170 Ga0209437_10017013 242
138 3300025245 Ga0207425_1000002 Ga0207425_1000002434 242
139 3300025250 Ga0209026_1005368 Ga0209026_10053684 242
140 3300025250 Ga0209026_1008151 Ga0209026_10081511 242
141 3300025258 Ga0209129_1000002 Ga0209129_1000002434 242
142 3300025261 Ga0209233_1000507 Ga0209233_100050712 242
143 3300025272 Ga0209455_1002291 Ga0209455_10022914 242
144 3300025272 Ga0209455_1006137 Ga0209455_10061372 242
145 3300025284 Ga0209130_1000599 Ga0209130_100059914 242
146 3300025292 Ga0209676_1000001 Ga0209676_1000001910 242
147 3300025294 Ga0209025_1000004 Ga0209025_1000004756 242
148 3300025297 Ga0209758_1000006 Ga0209758_1000006756 242
149 3300025298 Ga0209050_1000016 Ga0209050_1000016576 242
150 3300025302 Ga0207426_1000216 Ga0207426_100021657 242
151 3300025321 Ga0207656_10033630 Ga0207656_100336302 242
152 3300025899 Ga0207642_10310905 Ga0207642_103109051 242
153 3300025900 Ga0207710_10046386 Ga0207710_100463862 242
154 3300025903 Ga0207680_10000387 Ga0207680_100003872 242
155 3300025904 Ga0207647_10000170 Ga0207647_1000017021 242
156 3300025904 Ga0207647_10092682 Ga0207647_100926822 242
157 3300025909 Ga0207705_10171850 Ga0207705_101718502 242
158 3300025911 Ga0207654_10011988 Ga0207654_100119882 242
159 3300025913 Ga0207695_10001273 Ga0207695_1000127332 242
160 3300025913 Ga0207695_10013273 Ga0207695_100132732 242
161 3300025914 Ga0207671_10001884 Ga0207671_100018842 242
162 3300025914 Ga0207671_10003405 Ga0207671_1000340516 242
163 3300025914 Ga0207671_10003991 Ga0207671_100039911 242
164 3300025914 Ga0207671_10009640 Ga0207671_100096401 242
165 3300025914 Ga0207671_10021636 Ga0207671_100216364 242
166 3300025933 Ga0207706_10000279 Ga0207706_100002799 242
167 3300025934 Ga0207686_10061224 Ga0207686_100612241 242
168 3300025934 Ga0207686_10136133 Ga0207686_101361331 242
169 3300025936 Ga0207670_10168112 Ga0207670_101681122 242
170 3300025942 Ga0207689_10001108 Ga0207689_100011082 242
171 3300025942 Ga0207689_10014653 Ga0207689_100146532 242
172 3300025949 Ga0207667_10135798 Ga0207667_101357982 242
173 3300025949 Ga0207667_10295625 Ga0207667_102956254 242
174 3300025960 Ga0207651_10089254 Ga0207651_100892541 242
175 3300025961 Ga0207712_10007512 Ga0207712_100075123 242
176 3300026023 Ga0207677_10012017 Ga0207677_100120173 242
177 3300026023 Ga0207677_10044497 Ga0207677_100444972 242
178 3300026035 Ga0207703_10005809 Ga0207703_100058093 242
179 3300026035 Ga0207703_10604987 Ga0207703_106049872 242
180 3300026041 Ga0207639_10226169 Ga0207639_102261692 242
181 3300026088 Ga0207641_10000061 Ga0207641_100000613 242
182 3300026088 Ga0207641_10044995 Ga0207641_100449952 242
183 3300026095 Ga0207676_10124192 Ga0207676_101241922 242
184 3300026142 Ga0207698_10030723 Ga0207698_100307232 242
185 3300026142 Ga0207698_10627920 Ga0207698_106279201 242
186 3300026142 Ga0207698_11049682 Ga0207698_110496821 242
187 3300028794 Ga0307515_10000071 Ga0307515_100000716 242
188 3300028794 Ga0307515_10082654 Ga0307515_100826543 242
189 3300031507 Ga0307509_10074770 Ga0307509_100747702 242
190 3300032002 Ga0307416_100000001 Ga0307416_100000001209 242
191 3300033180 Ga0307510_10000497 Ga0307510_100004972 242
192 3300042435 Ga0439434_0053589 Ga0439434_0053589_206_937 242
193 3300044712 Ga0453684_0411699 Ga0453684_0411699_445_1173 242
194 3300046460 Ga0495638_0030318 Ga0495638_0030318_730_1458 242
195 3300046462 Ga0495651_0132642 Ga0495651_0132642_26_754 242
196 3300046492 Ga0495585_0005987 Ga0495585_0005987_5767_6495 242
197 3300046507 Ga0495606_0008250 Ga0495606_0008250_4483_5211 242
198 3300046507 Ga0495606_0019935 Ga0495606_0019935_545_1273 242
199 3300046511 Ga0495608_0236738 Ga0495608_0236738_18_746 242
200 3300046512 Ga0495610_0000733 Ga0495610_0000733_18309_19055 242
201 3300046512 Ga0495610_0002378 Ga0495610_0002378_5831_6559 242
202 3300046513 Ga0495616_0002973 Ga0495616_0002973_6935_7663 242
203 3300046520 Ga0495637_0011954 Ga0495637_0011954_2374_3102 242
204 3300046522 Ga0495643_0113470 Ga0495643_0113470_323_1054 242
205 3300046524 Ga0495648_0010779 Ga0495648_0010779_5213_5941 242
206 3300046529 Ga0495652_0087346 Ga0495652_0087346_238_966 242
207 3300046660 Ga0495625_0000252 Ga0495625_0000252_64291_65019 242
208 3300046660 Ga0495625_0005223 Ga0495625_0005223_752_1480 242
209 3300046660 Ga0495625_0071392 Ga0495625_0071392_596_1324 242
210 3300046665 Ga0495661_0000134 Ga0495661_0000134_5645_6373 242
211 3300046665 Ga0495661_0002237 Ga0495661_0002237_820_1548 242
212 3300046692 Ga0495671_0050751 Ga0495671_0050751_161_889 242
213 3300049459 Ga0495678_045625 Ga0495678_045625_192_920 242
214 3300053090 Ga0500646_0100545 Ga0500646_0100545_168_896 242
215 3300053125 Ga0500618_000191 Ga0500618_000191_30558_31295 242
216 3300053156 Ga0500622_0007866 Ga0500622_0007866_838_1566 242
217 3300053156 Ga0500622_0157943 Ga0500622_0157943_257_985 242
218 2162886007 SwRhRL2b_contig_2582835 SwRhRL2b_0630.00001190 243
219 3300001979 JGI24740J21852_10005198 JGI24740J21852_100051983 243
220 3300002738 JGI25154J39366_1000007 JGI25154J39366_1000007256 243
221 3300002741 JGI25157J39369_1006585 JGI25157J39369_10065851 243
222 3300003215 JGI25153J46596_10003698 JGI25153J46596_100036986 243
223 3300003323 rootH1_10010762 rootH1_100107621 243
224 3300003323 rootH1_10159685 rootH1_101596852 243
225 3300003354 JGI25160J50197_1005189 JGI25160J50197_10051893 243
226 3300003354 JGI25160J50197_1010063 JGI25160J50197_10100632 243
227 3300003354 JGI25160J50197_1031579 JGI25160J50197_10315792 243
228 3300003761 Ga0055535_1002818 Ga0055535_10028185 243
229 3300003781 Ga0055536_1025583 Ga0055536_10255832 243
230 3300005262 Ga0065165_1000451 Ga0065165_100045140 243
231 3300005262 Ga0065165_1014990 Ga0065165_10149904 243
232 3300005288 Ga0065714_10002468 Ga0065714_1000246812 243
233 3300005288 Ga0065714_10002578 Ga0065714_100025784 243
234 3300005288 Ga0065714_10072898 Ga0065714_100728982 243
235 3300005289 Ga0065704_10000216 Ga0065704_1000021620 243
236 3300005289 Ga0065704_10001141 Ga0065704_100011419 243
237 3300005367 Ga0070667_100260607 Ga0070667_1002606071 243
238 3300005456 Ga0070678_100393627 Ga0070678_1003936271 243
239 3300005459 Ga0068867_100037369 Ga0068867_1000373692 243
240 3300005548 Ga0070665_100961658 Ga0070665_1009616581 243
241 3300005843 Ga0068860_100337299 Ga0068860_1003372992 243
242 3300005844 Ga0068862_100072658 Ga0068862_1000726582 243
243 3300009148 Ga0105243_10000012 Ga0105243_10000012203 243
244 3300009545 Ga0105237_10007254 Ga0105237_100072545 243
245 3300009551 Ga0105238_10078892 Ga0105238_100788922 243
246 3300013100 Ga0157373_10000172 Ga0157373_1000017218 243
247 3300013100 Ga0157373_10296279 Ga0157373_102962791 243
248 3300013102 Ga0157371_10000693 Ga0157371_1000069312 243
249 3300013102 Ga0157371_10000997 Ga0157371_1000099710 243
250 3300013102 Ga0157371_10173319 Ga0157371_101733191 243
251 3300013104 Ga0157370_10004607 Ga0157370_1000460710 243
252 3300013104 Ga0157370_10011222 Ga0157370_100112223 243
253 3300013104 Ga0157370_10202837 Ga0157370_102028371 243
254 3300013306 Ga0163162_10010646 Ga0163162_100106462 243
255 3300014497 Ga0182008_10000008 Ga0182008_1000000877 243
256 3300014497 Ga0182008_10000091 Ga0182008_1000009119 243
257 3300015261 Ga0182006_1005087 Ga0182006_10050872 243
258 3300015261 Ga0182006_1007928 Ga0182006_10079281 243
259 3300015265 Ga0182005_1000039 Ga0182005_100003954 243
260 3300017792 Ga0163161_10000905 Ga0163161_1000090516 243
261 3300025208 Ga0209436_101170 Ga0209436_1011704 243
262 3300025208 Ga0209436_103224 Ga0209436_1032242 243
263 3300025242 Ga0209258_100285 Ga0209258_1002853 243
264 3300025246 Ga0209646_1000002 Ga0209646_1000002863 243
265 3300025250 Ga0209026_1000086 Ga0209026_1000086127 243
266 3300025254 Ga0209148_1000257 Ga0209148_10002573 243
267 3300025258 Ga0209129_1014068 Ga0209129_10140682 243
268 3300025284 Ga0209130_1001909 Ga0209130_10019095 243
269 3300025292 Ga0209676_1000321 Ga0209676_10003216 243
270 3300025295 Ga0209564_1007248 Ga0209564_10072489 243
271 3300025297 Ga0209758_1006887 Ga0209758_10068873 243
272 3300025297 Ga0209758_1034082 Ga0209758_10340822 243
273 3300025302 Ga0207426_1000034 Ga0207426_1000034335 243
274 3300025302 Ga0207426_1002704 Ga0207426_100270410 243
275 3300025302 Ga0207426_1021501 Ga0207426_10215012 243
276 3300025935 Ga0207709_10000006 Ga0207709_10000006540 243
277 3300025938 Ga0207704_10163302 Ga0207704_101633022 243
278 3300025942 Ga0207689_10009840 Ga0207689_100098402 243
279 3300025972 Ga0207668_10177401 Ga0207668_101774012 243
280 3300025986 Ga0207658_10177362 Ga0207658_101773622 243
281 3300026041 Ga0207639_10381999 Ga0207639_103819991 243
282 3300026089 Ga0207648_10008307 Ga0207648_100083075 243
283 3300026118 Ga0207675_100014181 Ga0207675_1000141812 243
284 3300028379 Ga0268266_10172332 Ga0268266_101723322 243
285 3300028786 Ga0307517_10223487 Ga0307517_102234871 243
286 3300031456 Ga0307513_10033760 Ga0307513_100337603 243
287 3300031456 Ga0307513_10081952 Ga0307513_100819522 243
288 3300031456 Ga0307513_10400599 Ga0307513_104005991 243
289 3300031616 Ga0307508_10000372 Ga0307508_100003725 243
290 3300031731 Ga0307405_10067014 Ga0307405_100670144 243
291 3300031911 Ga0307412_10000009 Ga0307412_10000009353 243
292 3300031911 Ga0307412_10174453 Ga0307412_101744532 243
293 3300032004 Ga0307414_10000207 Ga0307414_1000020721 243
294 3300032004 Ga0307414_10002105 Ga0307414_100021054 243
295 3300032004 Ga0307414_10020830 Ga0307414_100208304 243
296 3300032004 Ga0307414_10070267 Ga0307414_100702672 243
297 3300032004 Ga0307414_10114131 Ga0307414_101141311 243
298 3300032004 Ga0307414_10282012 Ga0307414_102820121 243
299 3300032004 Ga0307414_10496188 Ga0307414_104961881 243
300 3300041404 Ga0439436_0005311 Ga0439436_0005311_2994_3725 243
301 3300041512 Ga0451853_3333784 Ga0451853_3333784_382_1113 243
302 3300044658 Ga0466972_0007549 Ga0466972_0007549_652_1383 243
303 3300044658 Ga0466972_0215514 Ga0466972_0215514_75_806 243
304 3300044693 Ga0466961_0297787 Ga0466961_0297787_13_744 243
305 3300045049 Ga0466959_0125852 Ga0466959_0125852_807_1538 243
306 3300046460 Ga0495638_0052305 Ga0495638_0052305_592_1326 243
307 3300046474 Ga0495605_0082143 Ga0495605_0082143_471_1205 243
308 3300046524 Ga0495648_0005974 Ga0495648_0005974_6984_7718 243
309 3300047472 Ga0495686_0011932 Ga0495686_0011932_19_750 243
310 3300047472 Ga0495686_0142236 Ga0495686_0142236_485_1216 243
311 3300048919 Ga0496116_0004290 Ga0496116_0004290_11510_12247 243
312 3300048920 Ga0496117_0029797 Ga0496117_0029797_1363_2100 243
313 3300048925 Ga0496122_0000435 Ga0496122_0000435_20732_21463 243
314 3300048925 Ga0496122_0006722 Ga0496122_0006722_4726_5463 243
315 3300048926 Ga0496123_0008241 Ga0496123_0008241_1286_2017 243
316 3300048926 Ga0496123_0045308 Ga0496123_0045308_1315_2052 243
317 3300048928 Ga0496125_0098806 Ga0496125_0098806_624_1355 243
318 3300048928 Ga0496125_0205364 Ga0496125_0205364_75_812 243
319 3300049581 Ga0501047_0076928 Ga0501047_0076928_286_1017 243
320 3300049671 Ga0501238_001774 Ga0501238_001774_781_1512 243
321 3300049758 Ga0501241_002881 Ga0501241_002881_1782_2513 243
322 3300053086 Ga0500578_0000358 Ga0500578_0000358_29824_30555 243
323 3300053088 Ga0500644_0001909 Ga0500644_0001909_986_1717 243
324 3300053092 Ga0500583_0001162 Ga0500583_0001162_4072_4803 243
325 3300053093 Ga0500651_0006585 Ga0500651_0006585_4249_4980 243
326 3300053109 Ga0500569_000144 Ga0500569_000144_4634_5365 243
327 3300053134 Ga0500658_0034951 Ga0500658_0034951_1199_1930 243
328 3300053136 Ga0500559_0007655 Ga0500559_0007655_1173_1904 243
329 3300053139 Ga0500568_0013505 Ga0500568_0013505_1529_2260 243
330 3300053139 Ga0500568_0037645 Ga0500568_0037645_636_1367 243
331 3300053142 Ga0500577_0021993 Ga0500577_0021993_720_1451 243
332 3300053147 Ga0500589_023736 Ga0500589_023736_456_1187 243
333 3300053151 Ga0500604_0005692 Ga0500604_0005692_1475_2239 243
334 3300053153 Ga0500616_0009444 Ga0500616_0009444_3047_3778 243
335 3300053160 Ga0500633_0000675 Ga0500633_0000675_2076_2807 243
336 3300053177 Ga0500636_0031674 Ga0500636_0031674_1779_2510 243
337 3300053178 Ga0500637_0060585 Ga0500637_0060585_618_1352 243
338 3300055283 Ga0500661_006197 Ga0500661_006197_553_1284 243
339 iso_pu_bacteria 2946013367 2946018590 243

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07702

UTRA

UTRA domain

139

276

0.96

PF00392

GntR

Bacterial regulatory proteins, gntR family

56

118

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
4h0e-assembly1.cif.gz_A crystal structure of mutant orr3 in complex with ntd of arar 0.9564 11 77
4u0y-assembly1.cif.gz_A crystal structure of the dna-binding domains of yvoa in complex with palindromic operator dna 0.9297 3 76
5d4s-assembly1.cif.gz_B crystal structure of arar(dbd) in complex with operator orx1 0.9232 3 77
4u0y-assembly1.cif.gz_A crystal structure of the dna-binding domains of yvoa in complex with palindromic operator dna 0.9067 3 76
4h0e-assembly1.cif.gz_A crystal structure of mutant orr3 in complex with ntd of arar 0.9045 11 77
ID Description Score Start End Superfamily
5d4sA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9526 11 77 1.10.10.10
af_P45544_5_80_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9456 14 78 1.10.10.10
af_P31453_1_69_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9431 12 77 1.10.10.10
af_Q2G0T8_1_76_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9317 14 76 1.10.10.10
af_Q2G1P1_1_44_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9269 35 76 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A7V9JTD4-F1-model_v4 GntR family transcriptional regulator 0.9372 3 80 GO:0003677
GO:0003700
GO:0045892
AF-A0A7Z9WQH9-F1-model_v4 Extracellular solute-binding protein 0.9194 1 76 GO:0003677
GO:0003700
GO:0030313
AF-B1MLL4-F1-model_v4 Transcriptional regulator, GntR family 0.9117 3 77 GO:0003677
GO:0003700
GO:0009058
GO:0030170
AF-A0A2M7GX99-F1-model_v4 HTH gntR-type domain-containing protein 0.91 3 83 GO:0000976
GO:0003700
AF-A0A496QYX2-F1-model_v4 GntR family transcriptional regulator 0.8955 1 82 GO:0003677
GO:0003700
GO:0045892

Feature Viewer

pLDDT pTM Quality
83.83 0.6 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map