F413927
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 339 | 213 | 317 | 243 |
Family's Representative Sequence
| Representative Sequence | 3300017792|Ga0163161_10003118|Ga0163161_100031185 |
| Length | 285 |
| Sequence | MKISPSDDVLIPYPVILGLWVLFLSLSGCIIISPSKKRRITKKMKFSIDHKSPVPLHIQAEELLRNLIKDPEYATKSLPNEVDMAKQLAISRSTLRQALNKLVYEGLLIRKKGIGTKVAVGAVSSKASNWLSFSQEMQARGIPIKNFELHISWVFPDEKLAHFFHIGTDKKILKLERVRGKAEGPFVYFISYFHPRIALTGDEDFKRPLYDILADHSFIATLSKEEISAKGADKFIAEKLNIEIGSPLLFRKRFVFDQGDRPIEYNLGYYLSDSFVYSVESRRNV |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2721755487 | Sphingobacterium sp. B29 | Isolate | Rhizosphere |
| 3 | 2738541278 | Niastella sp. CF465 | Isolate | Unclassified |
| 4 | 2738541283 | Pedobacter sp. OK701 | Isolate | Unclassified |
| 5 | 2738541284 | Pedobacter sp. YR016 | Isolate | Unclassified |
| 6 | 2775506987 | Pedobacter ginsengisoli T01R-27 | Isolate | Unclassified |
| 7 | 2818991442 | Chitinophaga pinensis 1204 | Isolate | Unclassified |
| 8 | 2818991460 | Chitinophaga polysaccharea 1209 | Isolate | Unclassified |
| 9 | 2821136567 | Chitinophaga sancti 1232 | Isolate | Unclassified |
| 10 | 2883068021 | Chitinophaga rhizosphaerae T16R-86 | Isolate | Rhizosphere |
| 11 | 2884791551 | Chitinophaga oryzae 1310 | Isolate | Unclassified |
| 12 | 2904467357 | Chitinophaga sancti 3198 | Isolate | Unclassified |
| 13 | 2904780799 | Sphingobacterium sp. 1304 | Isolate | Rhizosphere |
| 14 | 2919177583 | Sphingobacterium sp. 2149 | Isolate | Rhizosphere |
| 15 | 2919186247 | Pedobacter africanus 2697 | Isolate | Rhizosphere |
| 16 | 2919437846 | Mucilaginibacter pocheonensis 3262 | Isolate | Rhizosphere |
| 17 | 2929177148 | Chitinophaga sp. R-72269 Hybrid assembly | Isolate | Unclassified |
| 18 | 2929239360 | Chitinophaga sp. R-73072 Hybrid assembly | Isolate | Unclassified |
| 19 | 2929921140 | Chitinophaga sp. R-72609 Hybrid assembly | Isolate | Unclassified |
| 20 | 2939664404 | Pedobacter africanus 2990 | Isolate | Rhizosphere |
| 21 | 2945977869 | Chitinophaga sp. W2I13 | Isolate | Rhizosphere |
| 22 | 2946013367 | Chitinophaga sp. W3I9 | Isolate | Rhizosphere |
| 23 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 24 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 25 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 26 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 27 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 28 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 29 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 30 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 31 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 32 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 33 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 34 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 35 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 36 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 37 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 38 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 39 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 40 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 41 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 42 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 43 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 45 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 47 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 48 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 56 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 57 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 58 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 61 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 62 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 63 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 64 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 65 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 66 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 67 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 68 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 69 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 70 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 71 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 72 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 73 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 75 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 96 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 99 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 100 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 101 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 103 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 104 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 105 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 106 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 107 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 108 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 109 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 110 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 111 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 112 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 113 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 114 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 115 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 116 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 117 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 118 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 119 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 120 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 151 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 152 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 153 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 154 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 155 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 156 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 157 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 158 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 159 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 160 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 161 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 162 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 163 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 164 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 165 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 166 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 167 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 185 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 186 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 187 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 188 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 189 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 191 | 3300049671 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought | Metagenome | Rhizosphere |
| 192 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 193 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 194 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 195 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 196 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 197 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 198 | 3300053100 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere | Metagenome | Endosphere |
| 199 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 200 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 201 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 202 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 203 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 204 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 205 | 3300053147 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere | Metagenome | Endosphere |
| 206 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 207 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 208 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 209 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 210 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 211 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 212 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 213 | 8003151029 | Chitinophaga sp. GbtcB8 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 93.51 |
| Metatranscriptomes | 0 |
| Isolates | 6.49 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 19.17 |
| Nodule | 0 |
| Rhizoplane | 0 |
| Rhizosphere | 66.96 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 13.86 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_2582835 | 2162886007 | Bacteria | 31450 |
| 2 | JGI24736J21556_1011822 | 3300001904 | Bacteria | 1417 |
| 3 | JGI24740J21852_10005198 | 3300001979 | Bacteria | 5525 |
| 4 | JGI24740J21852_10042885 | 3300001979 | Bacteria | 1352 |
| 5 | JGI25154J39366_1000007 | 3300002738 | Bacteria | 335932 |
| 6 | JGI25157J39369_1006585 | 3300002741 | Bacteria | 1751 |
| 7 | JGI25152J39213_1000017 | 3300002773 | Bacteria | 109718 |
| 8 | JGI25150J39212_1000001 | 3300002774 | Bacteria | 1318726 |
| 9 | JGI25159J45721_1014150 | 3300002987 | Bacteria | 1814 |
| 10 | JGI25151J46595_10000001 | 3300003187 | Bacteria | 887211 |
| 11 | JGI25153J46596_10000053 | 3300003215 | Bacteria | 138301 |
| 12 | JGI25153J46596_10003698 | 3300003215 | Bacteria | 8455 |
| 13 | rootH1_10090452 | 3300003316 | Bacteria | 6753 |
| 14 | rootH2_10313354 | 3300003320 | Bacteria | 1137 |
| 15 | rootL2_10062071 | 3300003322 | Bacteria | 1299 |
| 16 | rootL2_10160414 | 3300003322 | Bacteria | 5459 |
| 17 | rootL2_10188103 | 3300003322 | Bacteria | 2148 |
| 18 | rootL2_10252890 | 3300003322 | Bacteria | 6178 |
| 19 | rootH1_10010762 | 3300003323 | Bacteria | 5572 |
| 20 | rootH1_10159685 | 3300003323 | Bacteria | 1548 |
| 21 | rootH1_10378434 | 3300003323 | Bacteria | 3143 |
| 22 | JGI25160J50197_1005189 | 3300003354 | Bacteria | 5465 |
| 23 | JGI25160J50197_1010063 | 3300003354 | Bacteria | 3452 |
| 24 | JGI25160J50197_1031579 | 3300003354 | Unclassified | 1361 |
| 25 | Ga0055535_1002818 | 3300003761 | Bacteria | 5520 |
| 26 | Ga0055536_1000011 | 3300003781 | Bacteria | 275969 |
| 27 | Ga0055536_1025583 | 3300003781 | Bacteria | 1677 |
| 28 | Ga0055530_10000680 | 3300003791 | Bacteria | 28903 |
| 29 | Ga0065165_1000451 | 3300005262 | Bacteria | 64388 |
| 30 | Ga0065165_1014990 | 3300005262 | Bacteria | 2979 |
| 31 | Ga0065714_10002468 | 3300005288 | Bacteria | 47042 |
| 32 | Ga0065714_10002578 | 3300005288 | Bacteria | 14748 |
| 33 | Ga0065714_10020153 | 3300005288 | Bacteria | 1631 |
| 34 | Ga0065714_10072898 | 3300005288 | Bacteria | 3280 |
| 35 | Ga0065704_10000216 | 3300005289 | Bacteria | 79434 |
| 36 | Ga0065704_10001141 | 3300005289 | Bacteria | 9730 |
| 37 | Ga0070658_10424087 | 3300005327 | Bacteria | 1144 |
| 38 | Ga0068869_100097182 | 3300005334 | Bacteria | 2223 |
| 39 | Ga0070666_10000047 | 3300005335 | Bacteria | 106512 |
| 40 | Ga0068868_100096393 | 3300005338 | Bacteria | 2389 |
| 41 | Ga0068868_100104714 | 3300005338 | Bacteria | 2293 |
| 42 | Ga0068868_100142388 | 3300005338 | Bacteria | 1969 |
| 43 | Ga0070689_100046046 | 3300005340 | Bacteria | 3360 |
| 44 | Ga0070668_100254809 | 3300005347 | Bacteria | 1458 |
| 45 | Ga0070671_100246008 | 3300005355 | Bacteria | 1518 |
| 46 | Ga0070674_100329709 | 3300005356 | Bacteria | 1226 |
| 47 | Ga0070673_100048404 | 3300005364 | Bacteria | 3314 |
| 48 | Ga0070673_100157991 | 3300005364 | Bacteria | 1926 |
| 49 | Ga0070667_100260607 | 3300005367 | Bacteria | 1552 |
| 50 | Ga0070667_100806690 | 3300005367 | Bacteria | 871 |
| 51 | Ga0070678_100393627 | 3300005456 | Unclassified | 1202 |
| 52 | Ga0070662_100000130 | 3300005457 | Bacteria | 42139 |
| 53 | Ga0068867_100037369 | 3300005459 | Bacteria | 3529 |
| 54 | Ga0070685_10195522 | 3300005466 | Bacteria | 1311 |
| 55 | Ga0068853_100029891 | 3300005539 | Bacteria | 4597 |
| 56 | Ga0068853_100557032 | 3300005539 | Bacteria | 1086 |
| 57 | Ga0070672_100318497 | 3300005543 | Bacteria | 1322 |
| 58 | Ga0070665_100961658 | 3300005548 | Bacteria | 866 |
| 59 | Ga0068855_100059005 | 3300005563 | Bacteria | 4491 |
| 60 | Ga0068855_100627749 | 3300005563 | Bacteria | 1156 |
| 61 | Ga0068854_100213852 | 3300005578 | Bacteria | 1522 |
| 62 | Ga0068856_100192354 | 3300005614 | Bacteria | 2054 |
| 63 | Ga0068852_100022013 | 3300005616 | Bacteria | 5102 |
| 64 | Ga0068852_100304268 | 3300005616 | Bacteria | 1544 |
| 65 | Ga0068859_100000030 | 3300005617 | Bacteria | 175435 |
| 66 | Ga0068859_100165546 | 3300005617 | Bacteria | 2291 |
| 67 | Ga0068864_100019899 | 3300005618 | Bacteria | 5611 |
| 68 | Ga0068866_10400188 | 3300005718 | Bacteria | 885 |
| 69 | Ga0068851_10027170 | 3300005834 | Bacteria | 2819 |
| 70 | Ga0068851_10171626 | 3300005834 | Bacteria | 1197 |
| 71 | Ga0068863_100001320 | 3300005841 | Bacteria | 24709 |
| 72 | Ga0068863_100009494 | 3300005841 | Bacteria | 9488 |
| 73 | Ga0068858_100024628 | 3300005842 | Bacteria | 5607 |
| 74 | Ga0068858_100232697 | 3300005842 | Bacteria | 1747 |
| 75 | Ga0068858_100648538 | 3300005842 | Bacteria | 1026 |
| 76 | Ga0068860_100002795 | 3300005843 | Bacteria | 18152 |
| 77 | Ga0068860_100337299 | 3300005843 | Bacteria | 1482 |
| 78 | Ga0068862_100072658 | 3300005844 | Bacteria | 2972 |
| 79 | Ga0068862_100343866 | 3300005844 | Bacteria | 1382 |
| 80 | Ga0075366_10381046 | 3300006195 | Bacteria | 867 |
| 81 | Ga0097621_100029518 | 3300006237 | Bacteria | 4332 |
| 82 | Ga0097621_100480142 | 3300006237 | Bacteria | 1123 |
| 83 | Ga0068871_100062545 | 3300006358 | Bacteria | 3042 |
| 84 | Ga0068871_100918070 | 3300006358 | Bacteria | 812 |
| 85 | Ga0097620_100000030 | 3300006931 | Bacteria | 175435 |
| 86 | Ga0097620_100165546 | 3300006931 | Bacteria | 2291 |
| 87 | Ga0105240_10001644 | 3300009093 | Bacteria | 37960 |
| 88 | Ga0105240_10013344 | 3300009093 | Bacteria | 11291 |
| 89 | Ga0105240_10015198 | 3300009093 | Bacteria | 10475 |
| 90 | Ga0105240_10505495 | 3300009093 | Bacteria | 1343 |
| 91 | Ga0105247_10029974 | 3300009101 | Bacteria | 3298 |
| 92 | Ga0105243_10000012 | 3300009148 | Bacteria | 300885 |
| 93 | Ga0105241_10005723 | 3300009174 | Bacteria | 9174 |
| 94 | Ga0105241_10055253 | 3300009174 | Bacteria | 3042 |
| 95 | Ga0105242_10078179 | 3300009176 | Bacteria | 2761 |
| 96 | Ga0105242_10088237 | 3300009176 | Bacteria | 2605 |
| 97 | Ga0105237_10002280 | 3300009545 | Bacteria | 23870 |
| 98 | Ga0105237_10007254 | 3300009545 | Bacteria | 12158 |
| 99 | Ga0105237_10011253 | 3300009545 | Bacteria | 9467 |
| 100 | Ga0105237_10029904 | 3300009545 | Bacteria | 5534 |
| 101 | Ga0105237_10069631 | 3300009545 | Unclassified | 3514 |
| 102 | Ga0105237_10410755 | 3300009545 | Bacteria | 1359 |
| 103 | Ga0105237_10411904 | 3300009545 | Bacteria | 1357 |
| 104 | Ga0105237_10611167 | 3300009545 | Bacteria | 1097 |
| 105 | Ga0105238_10078892 | 3300009551 | Bacteria | 3283 |
| 106 | Ga0105238_10234557 | 3300009551 | Bacteria | 1812 |
| 107 | Ga0105249_10286133 | 3300009553 | Bacteria | 1648 |
| 108 | Ga0105249_10432946 | 3300009553 | Bacteria | 1351 |
| 109 | Ga0105239_10000004 | 3300010375 | Bacteria | 532483 |
| 110 | Ga0105239_10002087 | 3300010375 | Bacteria | 25905 |
| 111 | Ga0105239_10007705 | 3300010375 | Bacteria | 12327 |
| 112 | Ga0105239_10022935 | 3300010375 | Bacteria | 6882 |
| 113 | Ga0105246_10024945 | 3300011119 | Bacteria | 3893 |
| 114 | Ga0105246_10173986 | 3300011119 | Bacteria | 1651 |
| 115 | Ga0105246_10366892 | 3300011119 | Bacteria | 1185 |
| 116 | Ga0157373_10000172 | 3300013100 | Bacteria | 52820 |
| 117 | Ga0157373_10003630 | 3300013100 | Bacteria | 11655 |
| 118 | Ga0157373_10009289 | 3300013100 | Bacteria | 7270 |
| 119 | Ga0157373_10296279 | 3300013100 | Bacteria | 1147 |
| 120 | Ga0157371_10000693 | 3300013102 | Bacteria | 39719 |
| 121 | Ga0157371_10000997 | 3300013102 | Bacteria | 31307 |
| 122 | Ga0157371_10031140 | 3300013102 | Bacteria | 3844 |
| 123 | Ga0157371_10173319 | 3300013102 | Bacteria | 1542 |
| 124 | Ga0157370_10004607 | 3300013104 | Bacteria | 15766 |
| 125 | Ga0157370_10006092 | 3300013104 | Bacteria | 13384 |
| 126 | Ga0157370_10011222 | 3300013104 | Bacteria | 9394 |
| 127 | Ga0157370_10020855 | 3300013104 | Bacteria | 6539 |
| 128 | Ga0157370_10022158 | 3300013104 | Bacteria | 6325 |
| 129 | Ga0157370_10202837 | 3300013104 | Bacteria | 1839 |
| 130 | Ga0157374_10007835 | 3300013296 | Bacteria | 9118 |
| 131 | Ga0157374_10058575 | 3300013296 | Bacteria | 3600 |
| 132 | Ga0157374_10719934 | 3300013296 | Bacteria | 1012 |
| 133 | Ga0157378_10005079 | 3300013297 | Bacteria | 11561 |
| 134 | Ga0163162_10001435 | 3300013306 | Bacteria | 22200 |
| 135 | Ga0163162_10010646 | 3300013306 | Bacteria | 8944 |
| 136 | Ga0163162_10311143 | 3300013306 | Bacteria | 1707 |
| 137 | Ga0163162_10705555 | 3300013306 | Bacteria | 1130 |
| 138 | Ga0157372_10008932 | 3300013307 | Bacteria | 10649 |
| 139 | Ga0157375_10197828 | 3300013308 | Bacteria | 2165 |
| 140 | Ga0157375_10300713 | 3300013308 | Bacteria | 1768 |
| 141 | Ga0163163_10023063 | 3300014325 | Bacteria | 5902 |
| 142 | Ga0182008_10000008 | 3300014497 | Bacteria | 371823 |
| 143 | Ga0182008_10000091 | 3300014497 | Bacteria | 69363 |
| 144 | Ga0157377_10092736 | 3300014745 | Bacteria | 1786 |
| 145 | Ga0157379_10201825 | 3300014968 | Bacteria | 1798 |
| 146 | Ga0182006_1005087 | 3300015261 | Bacteria | 6321 |
| 147 | Ga0182006_1007928 | 3300015261 | Bacteria | 4832 |
| 148 | Ga0182007_10034146 | 3300015262 | Bacteria | 1721 |
| 149 | Ga0182005_1000039 | 3300015265 | Bacteria | 155210 |
| 150 | Ga0163161_10000905 | 3300017792 | Bacteria | 22916 |
| 151 | Ga0163161_10002742 | 3300017792 | Bacteria | 12533 |
| 152 | Ga0163161_10003118 | 3300017792 | Bacteria | 11686 |
| 153 | Ga0209436_100239 | 3300025208 | Bacteria | 25230 |
| 154 | Ga0209436_101170 | 3300025208 | Bacteria | 9670 |
| 155 | Ga0209436_103224 | 3300025208 | Bacteria | 4433 |
| 156 | Ga0207427_100043 | 3300025231 | Bacteria | 249595 |
| 157 | Ga0209437_100170 | 3300025233 | Bacteria | 142489 |
| 158 | Ga0209258_100285 | 3300025242 | Bacteria | 83382 |
| 159 | Ga0207425_1000002 | 3300025245 | Bacteria | 1362590 |
| 160 | Ga0209646_1000002 | 3300025246 | Bacteria | 1425781 |
| 161 | Ga0209026_1000086 | 3300025250 | Bacteria | 185551 |
| 162 | Ga0209026_1005368 | 3300025250 | Bacteria | 3467 |
| 163 | Ga0209026_1008151 | 3300025250 | Bacteria | 2231 |
| 164 | Ga0209148_1000257 | 3300025254 | Bacteria | 83444 |
| 165 | Ga0209129_1000002 | 3300025258 | Bacteria | 1359086 |
| 166 | Ga0209129_1014068 | 3300025258 | Bacteria | 1723 |
| 167 | Ga0209233_1000507 | 3300025261 | Bacteria | 23118 |
| 168 | Ga0209455_1002291 | 3300025272 | Bacteria | 7527 |
| 169 | Ga0209455_1006137 | 3300025272 | Bacteria | 3605 |
| 170 | Ga0209130_1000599 | 3300025284 | Bacteria | 34930 |
| 171 | Ga0209130_1001909 | 3300025284 | Bacteria | 11747 |
| 172 | Ga0209676_1000001 | 3300025292 | Bacteria | 1852142 |
| 173 | Ga0209676_1000321 | 3300025292 | Bacteria | 92845 |
| 174 | Ga0209025_1000004 | 3300025294 | Bacteria | 1361782 |
| 175 | Ga0209564_1007248 | 3300025295 | Bacteria | 5765 |
| 176 | Ga0209758_1000006 | 3300025297 | Bacteria | 1359562 |
| 177 | Ga0209758_1006887 | 3300025297 | Bacteria | 7939 |
| 178 | Ga0209758_1034082 | 3300025297 | Bacteria | 2032 |
| 179 | Ga0209050_1000016 | 3300025298 | Bacteria | 729149 |
| 180 | Ga0207426_1000034 | 3300025302 | Bacteria | 454016 |
| 181 | Ga0207426_1000216 | 3300025302 | Bacteria | 136337 |
| 182 | Ga0207426_1002704 | 3300025302 | Bacteria | 10808 |
| 183 | Ga0207426_1021501 | 3300025302 | Bacteria | 2231 |
| 184 | Ga0207656_10033630 | 3300025321 | Bacteria | 2137 |
| 185 | Ga0207642_10310905 | 3300025899 | Bacteria | 917 |
| 186 | Ga0207710_10046386 | 3300025900 | Bacteria | 1940 |
| 187 | Ga0207680_10000387 | 3300025903 | Bacteria | 21026 |
| 188 | Ga0207647_10000170 | 3300025904 | Bacteria | 52044 |
| 189 | Ga0207647_10092682 | 3300025904 | Bacteria | 1801 |
| 190 | Ga0207705_10171850 | 3300025909 | Bacteria | 1632 |
| 191 | Ga0207654_10011988 | 3300025911 | Bacteria | 4434 |
| 192 | Ga0207695_10001273 | 3300025913 | Bacteria | 42881 |
| 193 | Ga0207695_10013273 | 3300025913 | Bacteria | 9828 |
| 194 | Ga0207671_10001884 | 3300025914 | Bacteria | 23313 |
| 195 | Ga0207671_10003405 | 3300025914 | Bacteria | 15902 |
| 196 | Ga0207671_10003991 | 3300025914 | Bacteria | 14342 |
| 197 | Ga0207671_10009640 | 3300025914 | Bacteria | 8050 |
| 198 | Ga0207671_10021636 | 3300025914 | Bacteria | 4875 |
| 199 | Ga0207706_10000279 | 3300025933 | Bacteria | 55729 |
| 200 | Ga0207686_10061224 | 3300025934 | Bacteria | 2385 |
| 201 | Ga0207686_10136133 | 3300025934 | Bacteria | 1691 |
| 202 | Ga0207709_10000006 | 3300025935 | Bacteria | 800946 |
| 203 | Ga0207670_10168112 | 3300025936 | Bacteria | 1642 |
| 204 | Ga0207704_10163302 | 3300025938 | Bacteria | 1588 |
| 205 | Ga0207689_10001108 | 3300025942 | Bacteria | 25980 |
| 206 | Ga0207689_10009840 | 3300025942 | Bacteria | 8240 |
| 207 | Ga0207689_10014653 | 3300025942 | Bacteria | 6661 |
| 208 | Ga0207667_10135798 | 3300025949 | Bacteria | 2533 |
| 209 | Ga0207667_10295625 | 3300025949 | Bacteria | 1654 |
| 210 | Ga0207651_10089254 | 3300025960 | Bacteria | 2250 |
| 211 | Ga0207712_10007512 | 3300025961 | Bacteria | 6882 |
| 212 | Ga0207668_10177401 | 3300025972 | Bacteria | 1677 |
| 213 | Ga0207658_10177362 | 3300025986 | Bacteria | 1761 |
| 214 | Ga0207677_10012017 | 3300026023 | Bacteria | 4959 |
| 215 | Ga0207677_10044497 | 3300026023 | Bacteria | 2958 |
| 216 | Ga0207703_10005809 | 3300026035 | Bacteria | 9889 |
| 217 | Ga0207703_10604987 | 3300026035 | Bacteria | 1037 |
| 218 | Ga0207639_10226169 | 3300026041 | Bacteria | 1619 |
| 219 | Ga0207639_10381999 | 3300026041 | Bacteria | 1265 |
| 220 | Ga0207702_10213947 | 3300026078 | Bacteria | 1793 |
| 221 | Ga0207641_10000061 | 3300026088 | Bacteria | 160161 |
| 222 | Ga0207641_10044995 | 3300026088 | Bacteria | 3714 |
| 223 | Ga0207648_10008307 | 3300026089 | Bacteria | 10079 |
| 224 | Ga0207676_10124192 | 3300026095 | Bacteria | 2182 |
| 225 | Ga0207675_100014181 | 3300026118 | Bacteria | 7431 |
| 226 | Ga0207698_10030723 | 3300026142 | Bacteria | 3868 |
| 227 | Ga0207698_10627920 | 3300026142 | Bacteria | 1062 |
| 228 | Ga0207698_11049682 | 3300026142 | Bacteria | 827 |
| 229 | Ga0268266_10172332 | 3300028379 | Bacteria | 1965 |
| 230 | Ga0307517_10223487 | 3300028786 | Bacteria | 1141 |
| 231 | Ga0307515_10000071 | 3300028794 | Bacteria | 238152 |
| 232 | Ga0307515_10082654 | 3300028794 | Bacteria | 4150 |
| 233 | Ga0307513_10033760 | 3300031456 | Bacteria | 5748 |
| 234 | Ga0307513_10081952 | 3300031456 | Bacteria | 3323 |
| 235 | Ga0307513_10400599 | 3300031456 | Bacteria | 1107 |
| 236 | Ga0307509_10074770 | 3300031507 | Bacteria | 3522 |
| 237 | Ga0307508_10000372 | 3300031616 | Bacteria | 54456 |
| 238 | Ga0307405_10067014 | 3300031731 | Bacteria | 2291 |
| 239 | Ga0307412_10000009 | 3300031911 | Bacteria | 445987 |
| 240 | Ga0307412_10174453 | 3300031911 | Bacteria | 1610 |
| 241 | Ga0307416_100000001 | 3300032002 | Bacteria | 515017 |
| 242 | Ga0307414_10000207 | 3300032004 | Bacteria | 39639 |
| 243 | Ga0307414_10002105 | 3300032004 | Bacteria | 10373 |
| 244 | Ga0307414_10020830 | 3300032004 | Bacteria | 4095 |
| 245 | Ga0307414_10070267 | 3300032004 | Bacteria | 2521 |
| 246 | Ga0307414_10114131 | 3300032004 | Bacteria | 2063 |
| 247 | Ga0307414_10282012 | 3300032004 | Bacteria | 1396 |
| 248 | Ga0307414_10496188 | 3300032004 | Bacteria | 1079 |
| 249 | Ga0307510_10000497 | 3300033180 | Bacteria | 38862 |
| 250 | Ga0439436_0005311 | 3300041404 | Bacteria | 3950 |
| 251 | Ga0451853_3333784 | 3300041512 | Bacteria | 1282 |
| 252 | Ga0439434_0053589 | 3300042435 | Bacteria | 1253 |
| 253 | Ga0466972_0007549 | 3300044658 | Bacteria | 5458 |
| 254 | Ga0466972_0215514 | 3300044658 | Bacteria | 898 |
| 255 | Ga0466961_0297787 | 3300044693 | Bacteria | 986 |
| 256 | Ga0453684_0411699 | 3300044712 | Bacteria | 1512 |
| 257 | Ga0466959_0125852 | 3300045049 | Unclassified | 1819 |
| 258 | Ga0495638_0030318 | 3300046460 | Unclassified | 3483 |
| 259 | Ga0495638_0052305 | 3300046460 | Bacteria | 2544 |
| 260 | Ga0495651_0132642 | 3300046462 | Bacteria | 1817 |
| 261 | Ga0495605_0082143 | 3300046474 | Bacteria | 1506 |
| 262 | Ga0495585_0005987 | 3300046492 | Bacteria | 7609 |
| 263 | Ga0495606_0008250 | 3300046507 | Bacteria | 9092 |
| 264 | Ga0495606_0019935 | 3300046507 | Bacteria | 4965 |
| 265 | Ga0495608_0236738 | 3300046511 | Bacteria | 1142 |
| 266 | Ga0495610_0000733 | 3300046512 | Bacteria | 31050 |
| 267 | Ga0495610_0002378 | 3300046512 | Bacteria | 15866 |
| 268 | Ga0495616_0002973 | 3300046513 | Bacteria | 11008 |
| 269 | Ga0495637_0011954 | 3300046520 | Bacteria | 4161 |
| 270 | Ga0495643_0113470 | 3300046522 | Bacteria | 1375 |
| 271 | Ga0495648_0005974 | 3300046524 | Bacteria | 10008 |
| 272 | Ga0495648_0010779 | 3300046524 | Bacteria | 6941 |
| 273 | Ga0495652_0087346 | 3300046529 | Bacteria | 2558 |
| 274 | Ga0495625_0000252 | 3300046660 | Bacteria | 83831 |
| 275 | Ga0495625_0005223 | 3300046660 | Bacteria | 11955 |
| 276 | Ga0495625_0071392 | 3300046660 | Bacteria | 2436 |
| 277 | Ga0495661_0000134 | 3300046665 | Bacteria | 87487 |
| 278 | Ga0495661_0002237 | 3300046665 | Bacteria | 14994 |
| 279 | Ga0495671_0050751 | 3300046692 | Bacteria | 2065 |
| 280 | Ga0495589_0143074 | 3300046794 | Bacteria | 1144 |
| 281 | Ga0495686_0011932 | 3300047472 | Bacteria | 6105 |
| 282 | Ga0495686_0142236 | 3300047472 | Bacteria | 1415 |
| 283 | Ga0496116_0004290 | 3300048919 | Bacteria | 13667 |
| 284 | Ga0496117_0029797 | 3300048920 | Bacteria | 4201 |
| 285 | Ga0496117_0397829 | 3300048920 | Bacteria | 696 |
| 286 | Ga0496122_0000435 | 3300048925 | Bacteria | 87533 |
| 287 | Ga0496122_0006722 | 3300048925 | Bacteria | 13087 |
| 288 | Ga0496123_0008241 | 3300048926 | Bacteria | 9608 |
| 289 | Ga0496123_0045308 | 3300048926 | Bacteria | 2998 |
| 290 | Ga0496125_0098806 | 3300048928 | Bacteria | 2159 |
| 291 | Ga0496125_0205364 | 3300048928 | Bacteria | 1285 |
| 292 | Ga0495678_045625 | 3300049459 | Bacteria | 1727 |
| 293 | Ga0501047_0076928 | 3300049581 | Bacteria | 3211 |
| 294 | Ga0501238_001774 | 3300049671 | Bacteria | 2518 |
| 295 | Ga0501241_002881 | 3300049758 | Bacteria | 3298 |
| 296 | Ga0500578_0000358 | 3300053086 | Bacteria | 56123 |
| 297 | Ga0500644_0001909 | 3300053088 | Bacteria | 5347 |
| 298 | Ga0500646_0100545 | 3300053090 | Bacteria | 907 |
| 299 | Ga0500583_0001162 | 3300053092 | Bacteria | 7505 |
| 300 | Ga0500651_0006585 | 3300053093 | Bacteria | 6707 |
| 301 | Ga0500660_179769 | 3300053100 | Bacteria | 766 |
| 302 | Ga0500569_000144 | 3300053109 | Bacteria | 11327 |
| 303 | Ga0500618_000191 | 3300053125 | Bacteria | 50316 |
| 304 | Ga0500658_0034951 | 3300053134 | Unclassified | 1987 |
| 305 | Ga0500559_0007655 | 3300053136 | Bacteria | 4770 |
| 306 | Ga0500568_0013505 | 3300053139 | Bacteria | 3721 |
| 307 | Ga0500568_0037645 | 3300053139 | Unclassified | 1961 |
| 308 | Ga0500577_0021993 | 3300053142 | Unclassified | 2109 |
| 309 | Ga0500589_023736 | 3300053147 | Bacteria | 2829 |
| 310 | Ga0500604_0005692 | 3300053151 | Bacteria | 3289 |
| 311 | Ga0500616_0009444 | 3300053153 | Bacteria | 5933 |
| 312 | Ga0500622_0007866 | 3300053156 | Bacteria | 6005 |
| 313 | Ga0500622_0157943 | 3300053156 | Bacteria | 1066 |
| 314 | Ga0500633_0000675 | 3300053160 | Bacteria | 5732 |
| 315 | Ga0500636_0031674 | 3300053177 | Bacteria | 3129 |
| 316 | Ga0500637_0060585 | 3300053178 | Bacteria | 2168 |
| 317 | Ga0500661_006197 | 3300055283 | Bacteria | 2228 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | iso_pu_bacteria | 2818991460 | 2819681892 | 216 |
| 2 | iso_pu_bacteria | 2929177148 | 2929179595 | 216 |
| 3 | 3300048920 | Ga0496117_0397829 | Ga0496117_0397829_19_681 | 220 |
| 4 | 3300053100 | Ga0500660_179769 | Ga0500660_179769_63_725 | 220 |
| 5 | 3300026078 | Ga0207702_10213947 | Ga0207702_102139471 | 226 |
| 6 | 3300046794 | Ga0495589_0143074 | Ga0495589_0143074_16_702 | 228 |
| 7 | 3300013306 | Ga0163162_10311143 | Ga0163162_103111432 | 232 |
| 8 | iso_pu_bacteria | 2919437846 | 2919443116 | 238 |
| 9 | iso_pu_bacteria | 2738541278 | 2738731026 | 239 |
| 10 | iso_pu_bacteria | 2738541283 | 2738757433 | 239 |
| 11 | iso_pu_bacteria | 2738541284 | 2738760612 | 239 |
| 12 | iso_pu_bacteria | 2775506987 | 2776612767 | 239 |
| 13 | iso_pu_bacteria | 2818991442 | 2819574023 | 239 |
| 14 | iso_pu_bacteria | 2821136567 | 2821137339 | 239 |
| 15 | iso_pu_bacteria | 2883068021 | 2883070966 | 239 |
| 16 | iso_pu_bacteria | 2884791551 | 2884794332 | 239 |
| 17 | iso_pu_bacteria | 2904467357 | 2904467920 | 239 |
| 18 | iso_pu_bacteria | 2919186247 | 2919190142 | 239 |
| 19 | iso_pu_bacteria | 2929239360 | 2929243122 | 239 |
| 20 | iso_pu_bacteria | 2929921140 | 2929923546 | 239 |
| 21 | iso_pu_bacteria | 2939664404 | 2939668423 | 239 |
| 22 | iso_pu_bacteria | 2945977869 | 2945982013 | 239 |
| 23 | iso_pu_bacteria | 8003151029 | 8003154416 | 239 |
| 24 | iso_pu_bacteria | 2721755487 | 2722729189 | 240 |
| 25 | iso_pu_bacteria | 2904780799 | 2904780909 | 240 |
| 26 | iso_pu_bacteria | 2919177583 | 2919180627 | 240 |
| 27 | 3300003316 | rootH1_10090452 | rootH1_100904525 | 241 |
| 28 | 3300003322 | rootL2_10188103 | rootL2_101881032 | 241 |
| 29 | 3300017792 | Ga0163161_10003118 | Ga0163161_100031185 | 241 |
| 30 | 3300001904 | JGI24736J21556_1011822 | JGI24736J21556_10118222 | 242 |
| 31 | 3300001979 | JGI24740J21852_10042885 | JGI24740J21852_100428852 | 242 |
| 32 | 3300002773 | JGI25152J39213_1000017 | JGI25152J39213_100001770 | 242 |
| 33 | 3300002774 | JGI25150J39212_1000001 | JGI25150J39212_1000001744 | 242 |
| 34 | 3300002987 | JGI25159J45721_1014150 | JGI25159J45721_10141502 | 242 |
| 35 | 3300003187 | JGI25151J46595_10000001 | JGI25151J46595_1000000161 | 242 |
| 36 | 3300003215 | JGI25153J46596_10000053 | JGI25153J46596_1000005351 | 242 |
| 37 | 3300003320 | rootH2_10313354 | rootH2_103133541 | 242 |
| 38 | 3300003322 | rootL2_10062071 | rootL2_100620712 | 242 |
| 39 | 3300003322 | rootL2_10160414 | rootL2_101604143 | 242 |
| 40 | 3300003322 | rootL2_10252890 | rootL2_102528903 | 242 |
| 41 | 3300003323 | rootH1_10378434 | rootH1_103784343 | 242 |
| 42 | 3300003781 | Ga0055536_1000011 | Ga0055536_100001143 | 242 |
| 43 | 3300003791 | Ga0055530_10000680 | Ga0055530_1000068013 | 242 |
| 44 | 3300005288 | Ga0065714_10020153 | Ga0065714_100201531 | 242 |
| 45 | 3300005327 | Ga0070658_10424087 | Ga0070658_104240871 | 242 |
| 46 | 3300005334 | Ga0068869_100097182 | Ga0068869_1000971822 | 242 |
| 47 | 3300005335 | Ga0070666_10000047 | Ga0070666_1000004775 | 242 |
| 48 | 3300005338 | Ga0068868_100096393 | Ga0068868_1000963932 | 242 |
| 49 | 3300005338 | Ga0068868_100104714 | Ga0068868_1001047142 | 242 |
| 50 | 3300005338 | Ga0068868_100142388 | Ga0068868_1001423882 | 242 |
| 51 | 3300005340 | Ga0070689_100046046 | Ga0070689_1000460462 | 242 |
| 52 | 3300005347 | Ga0070668_100254809 | Ga0070668_1002548092 | 242 |
| 53 | 3300005355 | Ga0070671_100246008 | Ga0070671_1002460082 | 242 |
| 54 | 3300005356 | Ga0070674_100329709 | Ga0070674_1003297092 | 242 |
| 55 | 3300005364 | Ga0070673_100048404 | Ga0070673_1000484042 | 242 |
| 56 | 3300005364 | Ga0070673_100157991 | Ga0070673_1001579911 | 242 |
| 57 | 3300005367 | Ga0070667_100806690 | Ga0070667_1008066901 | 242 |
| 58 | 3300005457 | Ga0070662_100000130 | Ga0070662_10000013024 | 242 |
| 59 | 3300005466 | Ga0070685_10195522 | Ga0070685_101955222 | 242 |
| 60 | 3300005539 | Ga0068853_100029891 | Ga0068853_1000298911 | 242 |
| 61 | 3300005539 | Ga0068853_100557032 | Ga0068853_1005570321 | 242 |
| 62 | 3300005543 | Ga0070672_100318497 | Ga0070672_1003184972 | 242 |
| 63 | 3300005563 | Ga0068855_100059005 | Ga0068855_1000590054 | 242 |
| 64 | 3300005563 | Ga0068855_100627749 | Ga0068855_1006277492 | 242 |
| 65 | 3300005578 | Ga0068854_100213852 | Ga0068854_1002138522 | 242 |
| 66 | 3300005614 | Ga0068856_100192354 | Ga0068856_1001923542 | 242 |
| 67 | 3300005616 | Ga0068852_100022013 | Ga0068852_1000220132 | 242 |
| 68 | 3300005616 | Ga0068852_100304268 | Ga0068852_1003042682 | 242 |
| 69 | 3300005617 | Ga0068859_100000030 | Ga0068859_10000003069 | 242 |
| 70 | 3300005617 | Ga0068859_100165546 | Ga0068859_1001655463 | 242 |
| 71 | 3300005618 | Ga0068864_100019899 | Ga0068864_1000198992 | 242 |
| 72 | 3300005718 | Ga0068866_10400188 | Ga0068866_104001881 | 242 |
| 73 | 3300005834 | Ga0068851_10027170 | Ga0068851_100271702 | 242 |
| 74 | 3300005834 | Ga0068851_10171626 | Ga0068851_101716261 | 242 |
| 75 | 3300005841 | Ga0068863_100001320 | Ga0068863_10000132015 | 242 |
| 76 | 3300005841 | Ga0068863_100009494 | Ga0068863_1000094945 | 242 |
| 77 | 3300005842 | Ga0068858_100024628 | Ga0068858_1000246282 | 242 |
| 78 | 3300005842 | Ga0068858_100232697 | Ga0068858_1002326972 | 242 |
| 79 | 3300005842 | Ga0068858_100648538 | Ga0068858_1006485382 | 242 |
| 80 | 3300005843 | Ga0068860_100002795 | Ga0068860_10000279512 | 242 |
| 81 | 3300005844 | Ga0068862_100343866 | Ga0068862_1003438662 | 242 |
| 82 | 3300006195 | Ga0075366_10381046 | Ga0075366_103810461 | 242 |
| 83 | 3300006237 | Ga0097621_100029518 | Ga0097621_1000295184 | 242 |
| 84 | 3300006237 | Ga0097621_100480142 | Ga0097621_1004801421 | 242 |
| 85 | 3300006358 | Ga0068871_100062545 | Ga0068871_1000625452 | 242 |
| 86 | 3300006358 | Ga0068871_100918070 | Ga0068871_1009180701 | 242 |
| 87 | 3300006931 | Ga0097620_100000030 | Ga0097620_10000003076 | 242 |
| 88 | 3300006931 | Ga0097620_100165546 | Ga0097620_1001655463 | 242 |
| 89 | 3300009093 | Ga0105240_10001644 | Ga0105240_1000164432 | 242 |
| 90 | 3300009093 | Ga0105240_10013344 | Ga0105240_100133445 | 242 |
| 91 | 3300009093 | Ga0105240_10015198 | Ga0105240_100151988 | 242 |
| 92 | 3300009093 | Ga0105240_10505495 | Ga0105240_105054952 | 242 |
| 93 | 3300009101 | Ga0105247_10029974 | Ga0105247_100299742 | 242 |
| 94 | 3300009174 | Ga0105241_10005723 | Ga0105241_100057236 | 242 |
| 95 | 3300009174 | Ga0105241_10055253 | Ga0105241_100552533 | 242 |
| 96 | 3300009176 | Ga0105242_10078179 | Ga0105242_100781792 | 242 |
| 97 | 3300009176 | Ga0105242_10088237 | Ga0105242_100882372 | 242 |
| 98 | 3300009545 | Ga0105237_10002280 | Ga0105237_100022806 | 242 |
| 99 | 3300009545 | Ga0105237_10011253 | Ga0105237_100112536 | 242 |
| 100 | 3300009545 | Ga0105237_10029904 | Ga0105237_100299042 | 242 |
| 101 | 3300009545 | Ga0105237_10069631 | Ga0105237_100696312 | 242 |
| 102 | 3300009545 | Ga0105237_10410755 | Ga0105237_104107553 | 242 |
| 103 | 3300009545 | Ga0105237_10411904 | Ga0105237_104119043 | 242 |
| 104 | 3300009545 | Ga0105237_10611167 | Ga0105237_106111671 | 242 |
| 105 | 3300009551 | Ga0105238_10234557 | Ga0105238_102345574 | 242 |
| 106 | 3300009553 | Ga0105249_10286133 | Ga0105249_102861332 | 242 |
| 107 | 3300009553 | Ga0105249_10432946 | Ga0105249_104329461 | 242 |
| 108 | 3300010375 | Ga0105239_10000004 | Ga0105239_10000004342 | 242 |
| 109 | 3300010375 | Ga0105239_10002087 | Ga0105239_100020876 | 242 |
| 110 | 3300010375 | Ga0105239_10007705 | Ga0105239_100077052 | 242 |
| 111 | 3300010375 | Ga0105239_10022935 | Ga0105239_100229353 | 242 |
| 112 | 3300011119 | Ga0105246_10024945 | Ga0105246_100249451 | 242 |
| 113 | 3300011119 | Ga0105246_10173986 | Ga0105246_101739862 | 242 |
| 114 | 3300011119 | Ga0105246_10366892 | Ga0105246_103668922 | 242 |
| 115 | 3300013100 | Ga0157373_10003630 | Ga0157373_100036303 | 242 |
| 116 | 3300013100 | Ga0157373_10009289 | Ga0157373_100092895 | 242 |
| 117 | 3300013102 | Ga0157371_10031140 | Ga0157371_100311402 | 242 |
| 118 | 3300013104 | Ga0157370_10006092 | Ga0157370_100060924 | 242 |
| 119 | 3300013104 | Ga0157370_10020855 | Ga0157370_100208551 | 242 |
| 120 | 3300013104 | Ga0157370_10022158 | Ga0157370_100221584 | 242 |
| 121 | 3300013296 | Ga0157374_10007835 | Ga0157374_100078357 | 242 |
| 122 | 3300013296 | Ga0157374_10058575 | Ga0157374_100585754 | 242 |
| 123 | 3300013296 | Ga0157374_10719934 | Ga0157374_107199342 | 242 |
| 124 | 3300013297 | Ga0157378_10005079 | Ga0157378_1000507913 | 242 |
| 125 | 3300013306 | Ga0163162_10001435 | Ga0163162_1000143516 | 242 |
| 126 | 3300013306 | Ga0163162_10705555 | Ga0163162_107055551 | 242 |
| 127 | 3300013307 | Ga0157372_10008932 | Ga0157372_100089322 | 242 |
| 128 | 3300013308 | Ga0157375_10197828 | Ga0157375_101978282 | 242 |
| 129 | 3300013308 | Ga0157375_10300713 | Ga0157375_103007131 | 242 |
| 130 | 3300014325 | Ga0163163_10023063 | Ga0163163_100230633 | 242 |
| 131 | 3300014745 | Ga0157377_10092736 | Ga0157377_100927362 | 242 |
| 132 | 3300014968 | Ga0157379_10201825 | Ga0157379_102018252 | 242 |
| 133 | 3300015262 | Ga0182007_10034146 | Ga0182007_100341461 | 242 |
| 134 | 3300017792 | Ga0163161_10002742 | Ga0163161_100027422 | 242 |
| 135 | 3300025208 | Ga0209436_100239 | Ga0209436_1002395 | 242 |
| 136 | 3300025231 | Ga0207427_100043 | Ga0207427_100043107 | 242 |
| 137 | 3300025233 | Ga0209437_100170 | Ga0209437_10017013 | 242 |
| 138 | 3300025245 | Ga0207425_1000002 | Ga0207425_1000002434 | 242 |
| 139 | 3300025250 | Ga0209026_1005368 | Ga0209026_10053684 | 242 |
| 140 | 3300025250 | Ga0209026_1008151 | Ga0209026_10081511 | 242 |
| 141 | 3300025258 | Ga0209129_1000002 | Ga0209129_1000002434 | 242 |
| 142 | 3300025261 | Ga0209233_1000507 | Ga0209233_100050712 | 242 |
| 143 | 3300025272 | Ga0209455_1002291 | Ga0209455_10022914 | 242 |
| 144 | 3300025272 | Ga0209455_1006137 | Ga0209455_10061372 | 242 |
| 145 | 3300025284 | Ga0209130_1000599 | Ga0209130_100059914 | 242 |
| 146 | 3300025292 | Ga0209676_1000001 | Ga0209676_1000001910 | 242 |
| 147 | 3300025294 | Ga0209025_1000004 | Ga0209025_1000004756 | 242 |
| 148 | 3300025297 | Ga0209758_1000006 | Ga0209758_1000006756 | 242 |
| 149 | 3300025298 | Ga0209050_1000016 | Ga0209050_1000016576 | 242 |
| 150 | 3300025302 | Ga0207426_1000216 | Ga0207426_100021657 | 242 |
| 151 | 3300025321 | Ga0207656_10033630 | Ga0207656_100336302 | 242 |
| 152 | 3300025899 | Ga0207642_10310905 | Ga0207642_103109051 | 242 |
| 153 | 3300025900 | Ga0207710_10046386 | Ga0207710_100463862 | 242 |
| 154 | 3300025903 | Ga0207680_10000387 | Ga0207680_100003872 | 242 |
| 155 | 3300025904 | Ga0207647_10000170 | Ga0207647_1000017021 | 242 |
| 156 | 3300025904 | Ga0207647_10092682 | Ga0207647_100926822 | 242 |
| 157 | 3300025909 | Ga0207705_10171850 | Ga0207705_101718502 | 242 |
| 158 | 3300025911 | Ga0207654_10011988 | Ga0207654_100119882 | 242 |
| 159 | 3300025913 | Ga0207695_10001273 | Ga0207695_1000127332 | 242 |
| 160 | 3300025913 | Ga0207695_10013273 | Ga0207695_100132732 | 242 |
| 161 | 3300025914 | Ga0207671_10001884 | Ga0207671_100018842 | 242 |
| 162 | 3300025914 | Ga0207671_10003405 | Ga0207671_1000340516 | 242 |
| 163 | 3300025914 | Ga0207671_10003991 | Ga0207671_100039911 | 242 |
| 164 | 3300025914 | Ga0207671_10009640 | Ga0207671_100096401 | 242 |
| 165 | 3300025914 | Ga0207671_10021636 | Ga0207671_100216364 | 242 |
| 166 | 3300025933 | Ga0207706_10000279 | Ga0207706_100002799 | 242 |
| 167 | 3300025934 | Ga0207686_10061224 | Ga0207686_100612241 | 242 |
| 168 | 3300025934 | Ga0207686_10136133 | Ga0207686_101361331 | 242 |
| 169 | 3300025936 | Ga0207670_10168112 | Ga0207670_101681122 | 242 |
| 170 | 3300025942 | Ga0207689_10001108 | Ga0207689_100011082 | 242 |
| 171 | 3300025942 | Ga0207689_10014653 | Ga0207689_100146532 | 242 |
| 172 | 3300025949 | Ga0207667_10135798 | Ga0207667_101357982 | 242 |
| 173 | 3300025949 | Ga0207667_10295625 | Ga0207667_102956254 | 242 |
| 174 | 3300025960 | Ga0207651_10089254 | Ga0207651_100892541 | 242 |
| 175 | 3300025961 | Ga0207712_10007512 | Ga0207712_100075123 | 242 |
| 176 | 3300026023 | Ga0207677_10012017 | Ga0207677_100120173 | 242 |
| 177 | 3300026023 | Ga0207677_10044497 | Ga0207677_100444972 | 242 |
| 178 | 3300026035 | Ga0207703_10005809 | Ga0207703_100058093 | 242 |
| 179 | 3300026035 | Ga0207703_10604987 | Ga0207703_106049872 | 242 |
| 180 | 3300026041 | Ga0207639_10226169 | Ga0207639_102261692 | 242 |
| 181 | 3300026088 | Ga0207641_10000061 | Ga0207641_100000613 | 242 |
| 182 | 3300026088 | Ga0207641_10044995 | Ga0207641_100449952 | 242 |
| 183 | 3300026095 | Ga0207676_10124192 | Ga0207676_101241922 | 242 |
| 184 | 3300026142 | Ga0207698_10030723 | Ga0207698_100307232 | 242 |
| 185 | 3300026142 | Ga0207698_10627920 | Ga0207698_106279201 | 242 |
| 186 | 3300026142 | Ga0207698_11049682 | Ga0207698_110496821 | 242 |
| 187 | 3300028794 | Ga0307515_10000071 | Ga0307515_100000716 | 242 |
| 188 | 3300028794 | Ga0307515_10082654 | Ga0307515_100826543 | 242 |
| 189 | 3300031507 | Ga0307509_10074770 | Ga0307509_100747702 | 242 |
| 190 | 3300032002 | Ga0307416_100000001 | Ga0307416_100000001209 | 242 |
| 191 | 3300033180 | Ga0307510_10000497 | Ga0307510_100004972 | 242 |
| 192 | 3300042435 | Ga0439434_0053589 | Ga0439434_0053589_206_937 | 242 |
| 193 | 3300044712 | Ga0453684_0411699 | Ga0453684_0411699_445_1173 | 242 |
| 194 | 3300046460 | Ga0495638_0030318 | Ga0495638_0030318_730_1458 | 242 |
| 195 | 3300046462 | Ga0495651_0132642 | Ga0495651_0132642_26_754 | 242 |
| 196 | 3300046492 | Ga0495585_0005987 | Ga0495585_0005987_5767_6495 | 242 |
| 197 | 3300046507 | Ga0495606_0008250 | Ga0495606_0008250_4483_5211 | 242 |
| 198 | 3300046507 | Ga0495606_0019935 | Ga0495606_0019935_545_1273 | 242 |
| 199 | 3300046511 | Ga0495608_0236738 | Ga0495608_0236738_18_746 | 242 |
| 200 | 3300046512 | Ga0495610_0000733 | Ga0495610_0000733_18309_19055 | 242 |
| 201 | 3300046512 | Ga0495610_0002378 | Ga0495610_0002378_5831_6559 | 242 |
| 202 | 3300046513 | Ga0495616_0002973 | Ga0495616_0002973_6935_7663 | 242 |
| 203 | 3300046520 | Ga0495637_0011954 | Ga0495637_0011954_2374_3102 | 242 |
| 204 | 3300046522 | Ga0495643_0113470 | Ga0495643_0113470_323_1054 | 242 |
| 205 | 3300046524 | Ga0495648_0010779 | Ga0495648_0010779_5213_5941 | 242 |
| 206 | 3300046529 | Ga0495652_0087346 | Ga0495652_0087346_238_966 | 242 |
| 207 | 3300046660 | Ga0495625_0000252 | Ga0495625_0000252_64291_65019 | 242 |
| 208 | 3300046660 | Ga0495625_0005223 | Ga0495625_0005223_752_1480 | 242 |
| 209 | 3300046660 | Ga0495625_0071392 | Ga0495625_0071392_596_1324 | 242 |
| 210 | 3300046665 | Ga0495661_0000134 | Ga0495661_0000134_5645_6373 | 242 |
| 211 | 3300046665 | Ga0495661_0002237 | Ga0495661_0002237_820_1548 | 242 |
| 212 | 3300046692 | Ga0495671_0050751 | Ga0495671_0050751_161_889 | 242 |
| 213 | 3300049459 | Ga0495678_045625 | Ga0495678_045625_192_920 | 242 |
| 214 | 3300053090 | Ga0500646_0100545 | Ga0500646_0100545_168_896 | 242 |
| 215 | 3300053125 | Ga0500618_000191 | Ga0500618_000191_30558_31295 | 242 |
| 216 | 3300053156 | Ga0500622_0007866 | Ga0500622_0007866_838_1566 | 242 |
| 217 | 3300053156 | Ga0500622_0157943 | Ga0500622_0157943_257_985 | 242 |
| 218 | 2162886007 | SwRhRL2b_contig_2582835 | SwRhRL2b_0630.00001190 | 243 |
| 219 | 3300001979 | JGI24740J21852_10005198 | JGI24740J21852_100051983 | 243 |
| 220 | 3300002738 | JGI25154J39366_1000007 | JGI25154J39366_1000007256 | 243 |
| 221 | 3300002741 | JGI25157J39369_1006585 | JGI25157J39369_10065851 | 243 |
| 222 | 3300003215 | JGI25153J46596_10003698 | JGI25153J46596_100036986 | 243 |
| 223 | 3300003323 | rootH1_10010762 | rootH1_100107621 | 243 |
| 224 | 3300003323 | rootH1_10159685 | rootH1_101596852 | 243 |
| 225 | 3300003354 | JGI25160J50197_1005189 | JGI25160J50197_10051893 | 243 |
| 226 | 3300003354 | JGI25160J50197_1010063 | JGI25160J50197_10100632 | 243 |
| 227 | 3300003354 | JGI25160J50197_1031579 | JGI25160J50197_10315792 | 243 |
| 228 | 3300003761 | Ga0055535_1002818 | Ga0055535_10028185 | 243 |
| 229 | 3300003781 | Ga0055536_1025583 | Ga0055536_10255832 | 243 |
| 230 | 3300005262 | Ga0065165_1000451 | Ga0065165_100045140 | 243 |
| 231 | 3300005262 | Ga0065165_1014990 | Ga0065165_10149904 | 243 |
| 232 | 3300005288 | Ga0065714_10002468 | Ga0065714_1000246812 | 243 |
| 233 | 3300005288 | Ga0065714_10002578 | Ga0065714_100025784 | 243 |
| 234 | 3300005288 | Ga0065714_10072898 | Ga0065714_100728982 | 243 |
| 235 | 3300005289 | Ga0065704_10000216 | Ga0065704_1000021620 | 243 |
| 236 | 3300005289 | Ga0065704_10001141 | Ga0065704_100011419 | 243 |
| 237 | 3300005367 | Ga0070667_100260607 | Ga0070667_1002606071 | 243 |
| 238 | 3300005456 | Ga0070678_100393627 | Ga0070678_1003936271 | 243 |
| 239 | 3300005459 | Ga0068867_100037369 | Ga0068867_1000373692 | 243 |
| 240 | 3300005548 | Ga0070665_100961658 | Ga0070665_1009616581 | 243 |
| 241 | 3300005843 | Ga0068860_100337299 | Ga0068860_1003372992 | 243 |
| 242 | 3300005844 | Ga0068862_100072658 | Ga0068862_1000726582 | 243 |
| 243 | 3300009148 | Ga0105243_10000012 | Ga0105243_10000012203 | 243 |
| 244 | 3300009545 | Ga0105237_10007254 | Ga0105237_100072545 | 243 |
| 245 | 3300009551 | Ga0105238_10078892 | Ga0105238_100788922 | 243 |
| 246 | 3300013100 | Ga0157373_10000172 | Ga0157373_1000017218 | 243 |
| 247 | 3300013100 | Ga0157373_10296279 | Ga0157373_102962791 | 243 |
| 248 | 3300013102 | Ga0157371_10000693 | Ga0157371_1000069312 | 243 |
| 249 | 3300013102 | Ga0157371_10000997 | Ga0157371_1000099710 | 243 |
| 250 | 3300013102 | Ga0157371_10173319 | Ga0157371_101733191 | 243 |
| 251 | 3300013104 | Ga0157370_10004607 | Ga0157370_1000460710 | 243 |
| 252 | 3300013104 | Ga0157370_10011222 | Ga0157370_100112223 | 243 |
| 253 | 3300013104 | Ga0157370_10202837 | Ga0157370_102028371 | 243 |
| 254 | 3300013306 | Ga0163162_10010646 | Ga0163162_100106462 | 243 |
| 255 | 3300014497 | Ga0182008_10000008 | Ga0182008_1000000877 | 243 |
| 256 | 3300014497 | Ga0182008_10000091 | Ga0182008_1000009119 | 243 |
| 257 | 3300015261 | Ga0182006_1005087 | Ga0182006_10050872 | 243 |
| 258 | 3300015261 | Ga0182006_1007928 | Ga0182006_10079281 | 243 |
| 259 | 3300015265 | Ga0182005_1000039 | Ga0182005_100003954 | 243 |
| 260 | 3300017792 | Ga0163161_10000905 | Ga0163161_1000090516 | 243 |
| 261 | 3300025208 | Ga0209436_101170 | Ga0209436_1011704 | 243 |
| 262 | 3300025208 | Ga0209436_103224 | Ga0209436_1032242 | 243 |
| 263 | 3300025242 | Ga0209258_100285 | Ga0209258_1002853 | 243 |
| 264 | 3300025246 | Ga0209646_1000002 | Ga0209646_1000002863 | 243 |
| 265 | 3300025250 | Ga0209026_1000086 | Ga0209026_1000086127 | 243 |
| 266 | 3300025254 | Ga0209148_1000257 | Ga0209148_10002573 | 243 |
| 267 | 3300025258 | Ga0209129_1014068 | Ga0209129_10140682 | 243 |
| 268 | 3300025284 | Ga0209130_1001909 | Ga0209130_10019095 | 243 |
| 269 | 3300025292 | Ga0209676_1000321 | Ga0209676_10003216 | 243 |
| 270 | 3300025295 | Ga0209564_1007248 | Ga0209564_10072489 | 243 |
| 271 | 3300025297 | Ga0209758_1006887 | Ga0209758_10068873 | 243 |
| 272 | 3300025297 | Ga0209758_1034082 | Ga0209758_10340822 | 243 |
| 273 | 3300025302 | Ga0207426_1000034 | Ga0207426_1000034335 | 243 |
| 274 | 3300025302 | Ga0207426_1002704 | Ga0207426_100270410 | 243 |
| 275 | 3300025302 | Ga0207426_1021501 | Ga0207426_10215012 | 243 |
| 276 | 3300025935 | Ga0207709_10000006 | Ga0207709_10000006540 | 243 |
| 277 | 3300025938 | Ga0207704_10163302 | Ga0207704_101633022 | 243 |
| 278 | 3300025942 | Ga0207689_10009840 | Ga0207689_100098402 | 243 |
| 279 | 3300025972 | Ga0207668_10177401 | Ga0207668_101774012 | 243 |
| 280 | 3300025986 | Ga0207658_10177362 | Ga0207658_101773622 | 243 |
| 281 | 3300026041 | Ga0207639_10381999 | Ga0207639_103819991 | 243 |
| 282 | 3300026089 | Ga0207648_10008307 | Ga0207648_100083075 | 243 |
| 283 | 3300026118 | Ga0207675_100014181 | Ga0207675_1000141812 | 243 |
| 284 | 3300028379 | Ga0268266_10172332 | Ga0268266_101723322 | 243 |
| 285 | 3300028786 | Ga0307517_10223487 | Ga0307517_102234871 | 243 |
| 286 | 3300031456 | Ga0307513_10033760 | Ga0307513_100337603 | 243 |
| 287 | 3300031456 | Ga0307513_10081952 | Ga0307513_100819522 | 243 |
| 288 | 3300031456 | Ga0307513_10400599 | Ga0307513_104005991 | 243 |
| 289 | 3300031616 | Ga0307508_10000372 | Ga0307508_100003725 | 243 |
| 290 | 3300031731 | Ga0307405_10067014 | Ga0307405_100670144 | 243 |
| 291 | 3300031911 | Ga0307412_10000009 | Ga0307412_10000009353 | 243 |
| 292 | 3300031911 | Ga0307412_10174453 | Ga0307412_101744532 | 243 |
| 293 | 3300032004 | Ga0307414_10000207 | Ga0307414_1000020721 | 243 |
| 294 | 3300032004 | Ga0307414_10002105 | Ga0307414_100021054 | 243 |
| 295 | 3300032004 | Ga0307414_10020830 | Ga0307414_100208304 | 243 |
| 296 | 3300032004 | Ga0307414_10070267 | Ga0307414_100702672 | 243 |
| 297 | 3300032004 | Ga0307414_10114131 | Ga0307414_101141311 | 243 |
| 298 | 3300032004 | Ga0307414_10282012 | Ga0307414_102820121 | 243 |
| 299 | 3300032004 | Ga0307414_10496188 | Ga0307414_104961881 | 243 |
| 300 | 3300041404 | Ga0439436_0005311 | Ga0439436_0005311_2994_3725 | 243 |
| 301 | 3300041512 | Ga0451853_3333784 | Ga0451853_3333784_382_1113 | 243 |
| 302 | 3300044658 | Ga0466972_0007549 | Ga0466972_0007549_652_1383 | 243 |
| 303 | 3300044658 | Ga0466972_0215514 | Ga0466972_0215514_75_806 | 243 |
| 304 | 3300044693 | Ga0466961_0297787 | Ga0466961_0297787_13_744 | 243 |
| 305 | 3300045049 | Ga0466959_0125852 | Ga0466959_0125852_807_1538 | 243 |
| 306 | 3300046460 | Ga0495638_0052305 | Ga0495638_0052305_592_1326 | 243 |
| 307 | 3300046474 | Ga0495605_0082143 | Ga0495605_0082143_471_1205 | 243 |
| 308 | 3300046524 | Ga0495648_0005974 | Ga0495648_0005974_6984_7718 | 243 |
| 309 | 3300047472 | Ga0495686_0011932 | Ga0495686_0011932_19_750 | 243 |
| 310 | 3300047472 | Ga0495686_0142236 | Ga0495686_0142236_485_1216 | 243 |
| 311 | 3300048919 | Ga0496116_0004290 | Ga0496116_0004290_11510_12247 | 243 |
| 312 | 3300048920 | Ga0496117_0029797 | Ga0496117_0029797_1363_2100 | 243 |
| 313 | 3300048925 | Ga0496122_0000435 | Ga0496122_0000435_20732_21463 | 243 |
| 314 | 3300048925 | Ga0496122_0006722 | Ga0496122_0006722_4726_5463 | 243 |
| 315 | 3300048926 | Ga0496123_0008241 | Ga0496123_0008241_1286_2017 | 243 |
| 316 | 3300048926 | Ga0496123_0045308 | Ga0496123_0045308_1315_2052 | 243 |
| 317 | 3300048928 | Ga0496125_0098806 | Ga0496125_0098806_624_1355 | 243 |
| 318 | 3300048928 | Ga0496125_0205364 | Ga0496125_0205364_75_812 | 243 |
| 319 | 3300049581 | Ga0501047_0076928 | Ga0501047_0076928_286_1017 | 243 |
| 320 | 3300049671 | Ga0501238_001774 | Ga0501238_001774_781_1512 | 243 |
| 321 | 3300049758 | Ga0501241_002881 | Ga0501241_002881_1782_2513 | 243 |
| 322 | 3300053086 | Ga0500578_0000358 | Ga0500578_0000358_29824_30555 | 243 |
| 323 | 3300053088 | Ga0500644_0001909 | Ga0500644_0001909_986_1717 | 243 |
| 324 | 3300053092 | Ga0500583_0001162 | Ga0500583_0001162_4072_4803 | 243 |
| 325 | 3300053093 | Ga0500651_0006585 | Ga0500651_0006585_4249_4980 | 243 |
| 326 | 3300053109 | Ga0500569_000144 | Ga0500569_000144_4634_5365 | 243 |
| 327 | 3300053134 | Ga0500658_0034951 | Ga0500658_0034951_1199_1930 | 243 |
| 328 | 3300053136 | Ga0500559_0007655 | Ga0500559_0007655_1173_1904 | 243 |
| 329 | 3300053139 | Ga0500568_0013505 | Ga0500568_0013505_1529_2260 | 243 |
| 330 | 3300053139 | Ga0500568_0037645 | Ga0500568_0037645_636_1367 | 243 |
| 331 | 3300053142 | Ga0500577_0021993 | Ga0500577_0021993_720_1451 | 243 |
| 332 | 3300053147 | Ga0500589_023736 | Ga0500589_023736_456_1187 | 243 |
| 333 | 3300053151 | Ga0500604_0005692 | Ga0500604_0005692_1475_2239 | 243 |
| 334 | 3300053153 | Ga0500616_0009444 | Ga0500616_0009444_3047_3778 | 243 |
| 335 | 3300053160 | Ga0500633_0000675 | Ga0500633_0000675_2076_2807 | 243 |
| 336 | 3300053177 | Ga0500636_0031674 | Ga0500636_0031674_1779_2510 | 243 |
| 337 | 3300053178 | Ga0500637_0060585 | Ga0500637_0060585_618_1352 | 243 |
| 338 | 3300055283 | Ga0500661_006197 | Ga0500661_006197_553_1284 | 243 |
| 339 | iso_pu_bacteria | 2946013367 | 2946018590 | 243 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4h0e-assembly1.cif.gz_A | crystal structure of mutant orr3 in complex with ntd of arar | 0.9564 | 11 | 77 |
| 4u0y-assembly1.cif.gz_A | crystal structure of the dna-binding domains of yvoa in complex with palindromic operator dna | 0.9297 | 3 | 76 |
| 5d4s-assembly1.cif.gz_B | crystal structure of arar(dbd) in complex with operator orx1 | 0.9232 | 3 | 77 |
| 4u0y-assembly1.cif.gz_A | crystal structure of the dna-binding domains of yvoa in complex with palindromic operator dna | 0.9067 | 3 | 76 |
| 4h0e-assembly1.cif.gz_A | crystal structure of mutant orr3 in complex with ntd of arar | 0.9045 | 11 | 77 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 5d4sA00 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9526 | 11 | 77 | 1.10.10.10 |
| af_P45544_5_80_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9456 | 14 | 78 | 1.10.10.10 |
| af_P31453_1_69_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9431 | 12 | 77 | 1.10.10.10 |
| af_Q2G0T8_1_76_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9317 | 14 | 76 | 1.10.10.10 |
| af_Q2G1P1_1_44_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9269 | 35 | 76 | 1.10.10.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7V9JTD4-F1-model_v4 | GntR family transcriptional regulator | 0.9372 | 3 | 80 |
GO:0003677
GO:0003700 GO:0045892 |
| AF-A0A7Z9WQH9-F1-model_v4 | Extracellular solute-binding protein | 0.9194 | 1 | 76 |
GO:0003677
GO:0003700 GO:0030313 |
| AF-B1MLL4-F1-model_v4 | Transcriptional regulator, GntR family | 0.9117 | 3 | 77 |
GO:0003677
GO:0003700 GO:0009058 GO:0030170 |
| AF-A0A2M7GX99-F1-model_v4 | HTH gntR-type domain-containing protein | 0.91 | 3 | 83 |
GO:0000976
GO:0003700 |
| AF-A0A496QYX2-F1-model_v4 | GntR family transcriptional regulator | 0.8955 | 1 | 82 |
GO:0003677
GO:0003700 GO:0045892 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar