F413811

General Info

Members Datasets Scaffolds Average Seq Length
339 167 678 131

Family's Representative Sequence

Representative Sequence 3300005356|Ga0070674_102176126|Ga0070674_1021761261
Length 142
Sequence MLTSAQSFSASSILMNPELVAKAAAAREGAQARYSGFKVGAALATQDGKVFTGCNVESASYGLSMCAERVALSKALSEGARDFHEIAIVTDAETLTSPCGACRQLLWEYCGDIKVLLHSTKGLTAEHRLAELLPFPFDGRSL

Samples

Sample ID Description Type Environment
1 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
2 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
3 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
4 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
5 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
6 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
7 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
8 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
9 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
10 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
11 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
12 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
13 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
14 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
15 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
16 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
17 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
18 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
19 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
20 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
21 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
22 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
23 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
24 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
25 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
26 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
27 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
28 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
29 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
30 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
31 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
32 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
33 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
34 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
35 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
36 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
37 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
38 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
39 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
40 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
41 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
42 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
43 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
44 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
45 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
46 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
47 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
48 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
49 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
50 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
51 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
52 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
53 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
54 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
55 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
56 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
57 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
58 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
59 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
60 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
61 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
62 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
63 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
64 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
65 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
66 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
67 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
68 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
95 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
96 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
97 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
98 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
99 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
100 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
101 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
102 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
103 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
104 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
105 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
106 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
107 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
108 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
109 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
110 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
111 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
112 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
113 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
114 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
115 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
116 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
117 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
118 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
119 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
120 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
121 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
122 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
123 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
124 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
125 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
126 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
127 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
128 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
129 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
130 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
131 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
132 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
133 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
134 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
135 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
136 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
137 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
138 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
139 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
140 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
141 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
142 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
143 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
144 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
145 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
146 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
147 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
148 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
149 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
150 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
151 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
152 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
153 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
154 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
155 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
156 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
157 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
158 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
159 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
160 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
161 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
162 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
163 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
164 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
165 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
166 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
167 2671180531 Gemmata sp. SH-PL17 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.71
Metatranscriptomes 0
Isolates 0.29

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 4.72
Rhizosphere 93.81
Stem 0
Stem Tuber 0
Unclassified 25.96

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070674_102176126 3300005356 Unclassified 506
2 Ga0070667_101261652 3300005367 Unclassified 692
3 Ga0070709_10008794 3300005434 Bacteria 5557
4 Ga0070709_10214730 3300005434 Bacteria 1369
5 Ga0070714_100729853 3300005435 Bacteria 957
6 Ga0070713_100009533 3300005436 Bacteria 6959
7 Ga0070713_100433342 3300005436 Unclassified 1232
8 Ga0070711_100006017 3300005439 Bacteria 7287
9 Ga0070711_100218193 3300005439 Unclassified 1481
10 Ga0070705_100004291 3300005440 Bacteria 6953
11 Ga0070708_100007645 3300005445 Bacteria 8657
12 Ga0070708_100013006 3300005445 Bacteria 6801
13 Ga0070708_100051348 3300005445 Bacteria 3653
14 Ga0070708_100339650 3300005445 Bacteria 1415
15 Ga0070708_100367772 3300005445 Bacteria 1355
16 Ga0070708_100481296 3300005445 Unclassified 1171
17 Ga0070708_100570815 3300005445 Bacteria 1067
18 Ga0070708_101820364 3300005445 Unclassified 565
19 Ga0070681_10131286 3300005458 Bacteria 2437
20 Ga0068867_100334918 3300005459 Unclassified 1258
21 Ga0070706_100018844 3300005467 Bacteria 6365
22 Ga0070706_100230138 3300005467 Bacteria 1730
23 Ga0070706_100720660 3300005467 Bacteria 925
24 Ga0070707_100001060 3300005468 Bacteria 27175
25 Ga0070707_100117261 3300005468 Bacteria 2584
26 Ga0070707_100249531 3300005468 Bacteria 1727
27 Ga0070707_100309659 3300005468 Bacteria 1535
28 Ga0070707_100465962 3300005468 Bacteria 1224
29 Ga0070698_100002762 3300005471 Bacteria 19296
30 Ga0070698_100005605 3300005471 Bacteria 13728
31 Ga0070698_100008513 3300005471 Bacteria 11074
32 Ga0070698_100566982 3300005471 Unclassified 1075
33 Ga0070699_100020819 3300005518 Bacteria 5656
34 Ga0070699_100031406 3300005518 Bacteria 4584
35 Ga0070699_100049493 3300005518 Bacteria 3638
36 Ga0070699_100256147 3300005518 Bacteria 1564
37 Ga0070699_100822475 3300005518 Bacteria 850
38 Ga0070699_100976549 3300005518 Bacteria 776
39 Ga0070697_100011368 3300005536 Bacteria 6955
40 Ga0070697_100018316 3300005536 Bacteria 5520
41 Ga0070697_100047824 3300005536 Bacteria 3468
42 Ga0070697_100247964 3300005536 Bacteria 1522
43 Ga0068853_100413987 3300005539 Bacteria 1263
44 Ga0070672_101205882 3300005543 Unclassified 674
45 Ga0070695_100003672 3300005545 Bacteria 8937
46 Ga0070695_100034941 3300005545 Bacteria 3156
47 Ga0070695_100126086 3300005545 Bacteria 1758
48 Ga0070695_100273010 3300005545 Bacteria 1239
49 Ga0070696_100005712 3300005546 Bacteria 8304
50 Ga0070693_100000899 3300005547 Bacteria 13250
51 Ga0070693_100008127 3300005547 Bacteria 5155
52 Ga0070665_100000496 3300005548 Bacteria 56280
53 Ga0070704_100036157 3300005549 Unclassified 3363
54 Ga0070704_100152144 3300005549 Bacteria 1820
55 Ga0070702_100234797 3300005615 Unclassified 1234
56 Ga0068859_100139723 3300005617 Bacteria 2496
57 Ga0068866_10294106 3300005718 Bacteria 1011
58 Ga0068866_10395760 3300005718 Unclassified 890
59 Ga0068863_100006327 3300005841 Bacteria 11612
60 Ga0068863_100055906 3300005841 Bacteria 3737
61 Ga0068858_100019166 3300005842 Bacteria 6401
62 Ga0068860_100000901 3300005843 Bacteria 32961
63 Ga0068860_100196583 3300005843 Bacteria 1953
64 Ga0068860_100530647 3300005843 Bacteria 1177
65 Ga0068860_101100414 3300005843 Unclassified 814
66 Ga0068860_101611533 3300005843 Unclassified 671
67 Ga0068862_100469318 3300005844 Bacteria 1189
68 Ga0081540_1044270 3300005983 Bacteria 2274
69 Ga0070717_10043134 3300006028 Bacteria 3681
70 Ga0070717_10220737 3300006028 Bacteria 1666
71 Ga0070715_10589301 3300006163 Unclassified 650
72 Ga0070716_100127714 3300006173 Bacteria 1602
73 Ga0070716_100180532 3300006173 Bacteria 1385
74 Ga0070716_100306056 3300006173 Bacteria 1107
75 Ga0070716_100973443 3300006173 Unclassified 669
76 Ga0070716_101659705 3300006173 Unclassified 526
77 Ga0070712_100027581 3300006175 Unclassified 3792
78 Ga0070712_100092764 3300006175 Unclassified 2215
79 Ga0070712_101255397 3300006175 Unclassified 645
80 Ga0097621_100017515 3300006237 Bacteria 5442
81 Ga0068871_100002377 3300006358 Bacteria 12832
82 Ga0068871_100322238 3300006358 Unclassified 1361
83 Ga0075428_100230227 3300006844 Bacteria 2000
84 Ga0075428_100561419 3300006844 Unclassified 1220
85 Ga0075430_100789729 3300006846 Bacteria 782
86 Ga0075430_100935350 3300006846 Bacteria 714
87 Ga0075430_101248702 3300006846 Bacteria 611
88 Ga0075431_100034032 3300006847 Bacteria 5251
89 Ga0075431_100233522 3300006847 Bacteria 1873
90 Ga0075433_10040628 3300006852 Bacteria 4027
91 Ga0075433_10073006 3300006852 Bacteria 3018
92 Ga0075433_10228963 3300006852 Unclassified 1651
93 Ga0075434_100009337 3300006871 Bacteria 9142
94 Ga0075434_100024391 3300006871 Bacteria 5913
95 Ga0075434_100167424 3300006871 Bacteria 2217
96 Ga0075434_100237130 3300006871 Unclassified 1844
97 Ga0075434_100307579 3300006871 Bacteria 1605
98 Ga0075434_100697772 3300006871 Unclassified 1032
99 Ga0075429_100004470 3300006880 Bacteria 12031
100 Ga0075429_100059084 3300006880 Bacteria 3340
101 Ga0068865_100680701 3300006881 Unclassified 877
102 Ga0068865_100931917 3300006881 Unclassified 757
103 Ga0075436_100069172 3300006914 Bacteria 2439
104 Ga0075436_100738890 3300006914 Bacteria 730
105 Ga0075436_100748121 3300006914 Bacteria 726
106 Ga0097620_100139732 3300006931 Bacteria 2496
107 Ga0075435_100065237 3300007076 Bacteria 2960
108 Ga0075435_100353572 3300007076 Unclassified 1259
109 Ga0099794_10000350 3300007265 Bacteria 15802
110 Ga0099794_10008967 3300007265 Unclassified 4175
111 Ga0099794_10014284 3300007265 Bacteria 3475
112 Ga0099794_10020363 3300007265 Bacteria 3001
113 Ga0099794_10023897 3300007265 Bacteria 2800
114 Ga0099794_10027226 3300007265 Unclassified 2649
115 Ga0099794_10031940 3300007265 Bacteria 2468
116 Ga0099794_10035539 3300007265 Unclassified 2352
117 Ga0099794_10040444 3300007265 Bacteria 2217
118 Ga0099794_10066220 3300007265 Bacteria 1763
119 Ga0099794_10068659 3300007265 Unclassified 1733
120 Ga0099794_10106838 3300007265 Bacteria 1400
121 Ga0099794_10123712 3300007265 Unclassified 1303
122 Ga0099794_10237650 3300007265 Unclassified 938
123 Ga0099794_10238876 3300007265 Bacteria 936
124 Ga0099794_10338345 3300007265 Bacteria 782
125 Ga0099795_10025447 3300007788 Bacteria 1985
126 Ga0099795_10171801 3300007788 Unclassified 901
127 Ga0099795_10293476 3300007788 Bacteria 713
128 Ga0105240_11136102 3300009093 Bacteria 830
129 Ga0111539_10274300 3300009094 Bacteria 1963
130 Ga0105247_10116497 3300009101 Bacteria 1726
131 Ga0105247_10675217 3300009101 Bacteria 775
132 Ga0114129_10000978 3300009147 Bacteria 37409
133 Ga0114129_10532967 3300009147 Bacteria 1530
134 Ga0114129_10680073 3300009147 Bacteria 1325
135 Ga0114129_12606407 3300009147 Bacteria 603
136 Ga0105243_11077258 3300009148 Bacteria 811
137 Ga0105242_10027989 3300009176 Bacteria 4482
138 Ga0105248_10194132 3300009177 Bacteria 2287
139 Ga0105248_10358598 3300009177 Bacteria 1641
140 Ga0105248_11215499 3300009177 Bacteria 852
141 Ga0105237_10061629 3300009545 Unclassified 3750
142 Ga0105238_10724815 3300009551 Bacteria 1007
143 Ga0105249_10200079 3300009553 Bacteria 1955
144 Ga0099796_10013708 3300010159 Bacteria 2322
145 Ga0099796_10091445 3300010159 Unclassified 1132
146 Ga0105239_10054754 3300010375 Bacteria 4376
147 Ga0157378_10000538 3300013297 Bacteria 36003
148 Ga0157378_10073351 3300013297 Bacteria 3077
149 Ga0157378_10074664 3300013297 Bacteria 3051
150 Ga0157372_10036494 3300013307 Bacteria 5418
151 Ga0157375_10253407 3300013308 Unclassified 1921
152 Ga0157375_10901961 3300013308 Unclassified 1028
153 Ga0163163_10410465 3300014325 Bacteria 1413
154 Ga0157379_10055638 3300014968 Bacteria 3535
155 Ga0157379_10445517 3300014968 Bacteria 1195
156 Ga0157376_10000032 3300014969 Bacteria 167294
157 Ga0157376_10000629 3300014969 Bacteria 22878
158 Ga0213876_10047297 3300021384 Unclassified 2274
159 Ga0207653_10003573 3300025885 Unclassified 4897
160 Ga0207692_10329816 3300025898 Bacteria 936
161 Ga0207642_10283243 3300025899 Bacteria 954
162 Ga0207710_10226293 3300025900 Unclassified 930
163 Ga0207710_10322484 3300025900 Bacteria 783
164 Ga0207699_10006971 3300025906 Bacteria 5503
165 Ga0207699_10086994 3300025906 Bacteria 1953
166 Ga0207699_11408571 3300025906 Unclassified 516
167 Ga0207684_10039566 3300025910 Bacteria 3998
168 Ga0207684_10859981 3300025910 Bacteria 764
169 Ga0207707_10133199 3300025912 Bacteria 2174
170 Ga0207695_11608924 3300025913 Bacteria 530
171 Ga0207693_10018302 3300025915 Bacteria 5582
172 Ga0207693_10023756 3300025915 Bacteria 4865
173 Ga0207663_10277136 3300025916 Bacteria 1244
174 Ga0207663_10458343 3300025916 Unclassified 984
175 Ga0207663_11045558 3300025916 Unclassified 656
176 Ga0207646_10000305 3300025922 Bacteria 66759
177 Ga0207646_10036483 3300025922 Bacteria 4437
178 Ga0207646_10289412 3300025922 Bacteria 1480
179 Ga0207646_10308830 3300025922 Bacteria 1429
180 Ga0207646_10418403 3300025922 Unclassified 1210
181 Ga0207646_10490079 3300025922 Bacteria 1108
182 Ga0207646_10941969 3300025922 Bacteria 765
183 Ga0207694_10510836 3300025924 Bacteria 1007
184 Ga0207700_10023069 3300025928 Bacteria 4283
185 Ga0207700_11078106 3300025928 Bacteria 718
186 Ga0207664_11197043 3300025929 Bacteria 678
187 Ga0207686_10159451 3300025934 Bacteria 1579
188 Ga0207709_10892889 3300025935 Bacteria 722
189 Ga0207665_10010969 3300025939 Bacteria 5948
190 Ga0207665_10011297 3300025939 Bacteria 5861
191 Ga0207665_10080103 3300025939 Bacteria 2246
192 Ga0207665_10429638 3300025939 Unclassified 1010
193 Ga0207665_10895274 3300025939 Unclassified 704
194 Ga0207665_11120547 3300025939 Bacteria 627
195 Ga0207711_10239356 3300025941 Bacteria 1664
196 Ga0207711_10335456 3300025941 Bacteria 1399
197 Ga0207711_10771325 3300025941 Bacteria 896
198 Ga0207712_10454013 3300025961 Bacteria 1087
199 Ga0207703_10014323 3300026035 Bacteria 6186
200 Ga0207639_10543085 3300026041 Bacteria 1066
201 Ga0207641_10001136 3300026088 Bacteria 26731
202 Ga0207641_10054301 3300026088 Bacteria 3399
203 Ga0207648_10206707 3300026089 Unclassified 1742
204 Ga0209588_1001160 3300027671 Bacteria 6798
205 Ga0209588_1003408 3300027671 Bacteria 4409
206 Ga0209588_1007189 3300027671 Bacteria 3266
207 Ga0209588_1021392 3300027671 Unclassified 2032
208 Ga0209588_1033182 3300027671 Bacteria 1655
209 Ga0209588_1040567 3300027671 Bacteria 1502
210 Ga0209588_1046088 3300027671 Bacteria 1410
211 Ga0209588_1068114 3300027671 Bacteria 1150
212 Ga0209588_1103749 3300027671 Unclassified 914
213 Ga0268266_10000072 3300028379 Bacteria 232245
214 Ga0268264_10047540 3300028381 Bacteria 3568
215 Ga0268264_10158185 3300028381 Bacteria 2038
216 Ga0265334_10007744 3300028573 Unclassified 4602
217 Ga0265338_10498251 3300028800 Bacteria 858
218 Ga0307510_10173508 3300033180 Bacteria 1731
219 Ga0373926_0063481 3300035083 Unclassified 1349
220 Ga0373952_0126082 3300035092 Unclassified 699
221 Ga0373954_0036527 3300035118 Bacteria 2281
222 Ga0373943_0158337 3300035170 Unclassified 1231
223 Ga0373962_0365279 3300035242 Unclassified 524
224 Ga0373962_0399467 3300035242 Unclassified 505
225 Ga0373931_0059161 3300035691 Bacteria 2060
226 Ga0373927_0000181 3300035695 Bacteria 49692
227 Ga0373947_0006847 3300035725 Bacteria 6610
228 Ga0373937_0172566 3300036401 Bacteria 2029
229 Ga0373937_0266903 3300036401 Bacteria 1615
230 Ga0373925_0016750 3300037068 Bacteria 5308
231 Ga0373925_0464206 3300037068 Unclassified 1038
232 Ga0373925_1337663 3300037068 Unclassified 587
233 Ga0436365_1665389 3300039437 Unclassified 676
234 Ga0436362_0695877 3300039453 Unclassified 514
235 Ga0439435_0051438 3300042436 Unclassified 1180
236 Ga0451577_0507671 3300042876 Bacteria 1095
237 Ga0451577_0550389 3300042876 Bacteria 1047
238 Ga0453683_0070045 3300044673 Bacteria 2193
239 Ga0453684_1025329 3300044712 Bacteria 876
240 Ga0453684_1450374 3300044712 Bacteria 710
241 Ga0453684_2413059 3300044712 Bacteria 521
242 Ga0466959_0504008 3300045049 Bacteria 818
243 Ga0451576_0071077 3300045051 Bacteria 3622
244 Ga0451576_0306451 3300045051 Bacteria 1661
245 Ga0451576_0383337 3300045051 Bacteria 1473
246 Ga0495603_0003513 3300046455 Bacteria 9325
247 Ga0495603_0111182 3300046455 Bacteria 1598
248 Ga0495603_0451627 3300046455 Unclassified 736
249 Ga0495629_0126671 3300046459 Unclassified 1779
250 Ga0495641_0023994 3300046461 Bacteria 3018
251 Ga0495641_0038930 3300046461 Bacteria 2220
252 Ga0495580_0018168 3300046472 Bacteria 5240
253 Ga0495580_0058832 3300046472 Unclassified 2702
254 Ga0495580_0171748 3300046472 Bacteria 1499
255 Ga0495580_0284092 3300046472 Bacteria 1129
256 Ga0495580_0988400 3300046472 Unclassified 537
257 Ga0495582_0000718 3300046473 Bacteria 18242
258 Ga0495639_0005520 3300046475 Bacteria 5445
259 Ga0495662_0082106 3300046476 Unclassified 1568
260 Ga0495664_0097888 3300046477 Bacteria 1766
261 Ga0495664_0150530 3300046477 Unclassified 1411
262 Ga0495594_0067896 3300046499 Unclassified 1979
263 Ga0495628_0171212 3300046516 Bacteria 1646
264 Ga0495630_0022984 3300046517 Bacteria 4607
265 Ga0495630_0033365 3300046517 Bacteria 3838
266 Ga0495666_0060133 3300046526 Unclassified 1816
267 Ga0495666_0071313 3300046526 Unclassified 1652
268 Ga0495665_0152421 3300046531 Bacteria 1206
269 Ga0495640_0396255 3300046533 Bacteria 848
270 Ga0495586_0010303 3300046535 Bacteria 4973
271 Ga0495598_0092331 3300046537 Unclassified 989
272 Ga0495645_0015070 3300046543 Bacteria 5492
273 Ga0495599_0125956 3300046678 Bacteria 1592
274 Ga0495623_0149133 3300046679 Bacteria 1384
275 Ga0495647_0011255 3300046681 Unclassified 3063
276 Ga0495658_0336354 3300046683 Unclassified 958
277 Ga0495613_0429167 3300046689 Bacteria 898
278 Ga0495624_0111964 3300046690 Unclassified 1678
279 Ga0495581_0565894 3300047315 Unclassified 659
280 Ga0495604_0205346 3300047317 Bacteria 1364
281 Ga0495674_0148022 3300047319 Unclassified 1970
282 Ga0495676_0013478 3300047321 Bacteria 7348
283 Ga0495676_0136778 3300047321 Unclassified 1761
284 Ga0495676_1105410 3300047321 Unclassified 504
285 Ga0495680_0008611 3300047322 Bacteria 9263
286 Ga0495684_0117730 3300047471 Unclassified 2002
287 Ga0495614_0119920 3300048089 Bacteria 1159
288 Ga0496101_0021969 3300048904 Bacteria 4387
289 Ga0496101_1119727 3300048904 Bacteria 618
290 Ga0496102_0002989 3300048905 Bacteria 14314
291 Ga0496104_0305032 3300048907 Unclassified 1505
292 Ga0496104_0453375 3300048907 Bacteria 1194
293 Ga0496104_1033610 3300048907 Bacteria 725
294 Ga0496104_1651866 3300048907 Unclassified 543
295 Ga0496106_0442554 3300048909 Bacteria 1044
296 Ga0496106_1248354 3300048909 Unclassified 578
297 Ga0496107_1056250 3300048910 Unclassified 588
298 Ga0496114_0055131 3300048917 Bacteria 3315
299 Ga0496114_0206216 3300048917 Unclassified 1723
300 Ga0496115_0032991 3300048918 Bacteria 4087
301 Ga0496115_0145378 3300048918 Bacteria 1957
302 Ga0496115_0241211 3300048918 Bacteria 1490
303 Ga0496115_0354880 3300048918 Unclassified 1195
304 Ga0496126_0568950 3300048929 Bacteria 897
305 Ga0501041_0249928 3300049577 Bacteria 1115
306 Ga0501042_0331539 3300049578 Bacteria 1100
307 Ga0501075_1512815 3300049591 Bacteria 508
308 Ga0501081_0511994 3300049743 Bacteria 895
309 nmdc:mga05p37_1588049_c1 3300050507 Bacteria 645
310 nmdc:mga05p37_1752187_c1 3300050507 Bacteria 602
311 nmdc:mga05p37_210979_c1 3300050507 Bacteria 2348
312 nmdc:mga05p37_362_c1 3300050507 Bacteria 24919
313 nmdc:mga05p37_627954_c1 3300050507 Bacteria 1208
314 nmdc:mga09592_166928_c1 3300050508 Bacteria 1903
315 nmdc:mga0qj67_1040160_c1 3300050509 Bacteria 641
316 nmdc:mga06r32_22729_c1 3300050510 Bacteria 5799
317 nmdc:mga06r32_515786_c1 3300050510 Bacteria 1171
318 nmdc:mga08y16_339016_c1 3300050511 Bacteria 1545
319 nmdc:mga0n895_10216_c1 3300050512 Bacteria 8270
320 nmdc:mga0n895_137609_c1 3300050512 Unclassified 2469
321 nmdc:mga0n895_1996754_c1 3300050512 Bacteria 538
322 nmdc:mga0n895_2118_c1 3300050512 Bacteria 15321
323 nmdc:mga0n895_21336_c1 3300050512 Bacteria 6054
324 nmdc:mga0n895_41205_c1 3300050512 Bacteria 4488
325 nmdc:mga0n895_789928_c1 3300050512 Bacteria 940
326 nmdc:mga0n895_9368_c1 3300050512 Bacteria 8564
327 nmdc:mga0rr50_12540_c1 3300050513 Bacteria 5484
328 nmdc:mga0rr50_31091_c1 3300050513 Bacteria 3787
329 nmdc:mga0rr50_68321_c1 3300050513 Unclassified 2702
330 nmdc:mga08x19_180_c1 3300050514 Bacteria 50906
331 nmdc:mga08x19_441213_c1 3300050514 Bacteria 916
332 nmdc:mga0a205_266658_c1 3300050515 Bacteria 1590
333 nmdc:mga0a205_49879_c1 3300050515 Bacteria 4041
334 nmdc:mga0a205_555767_c1 3300050515 Bacteria 1003
335 nmdc:mga0a205_609702_c1 3300050515 Bacteria 944
336 nmdc:mga0a205_868875_c1 3300050515 Bacteria 749
337 nmdc:mga0a205_9594_c2 3300050515 Bacteria 1818
338 Ga0501084_1534287 3300054114 Bacteria 557
339 2673164407 2671180531 Bacteria 9045424
340 Ga0070674_102176126
341 Ga0070667_101261652
342 Ga0070709_10008794
343 Ga0070709_10214730
344 Ga0070714_100729853
345 Ga0070713_100009533
346 Ga0070713_100433342
347 Ga0070711_100006017
348 Ga0070711_100218193
349 Ga0070705_100004291
350 Ga0070708_100007645
351 Ga0070708_100013006
352 Ga0070708_100051348
353 Ga0070708_100339650
354 Ga0070708_100367772
355 Ga0070708_100481296
356 Ga0070708_100570815
357 Ga0070708_101820364
358 Ga0070681_10131286
359 Ga0068867_100334918
360 Ga0070706_100018844
361 Ga0070706_100230138
362 Ga0070706_100720660
363 Ga0070707_100001060
364 Ga0070707_100117261
365 Ga0070707_100249531
366 Ga0070707_100309659
367 Ga0070707_100465962
368 Ga0070698_100002762
369 Ga0070698_100005605
370 Ga0070698_100008513
371 Ga0070698_100566982
372 Ga0070699_100020819
373 Ga0070699_100031406
374 Ga0070699_100049493
375 Ga0070699_100256147
376 Ga0070699_100822475
377 Ga0070699_100976549
378 Ga0070697_100011368
379 Ga0070697_100018316
380 Ga0070697_100047824
381 Ga0070697_100247964
382 Ga0068853_100413987
383 Ga0070672_101205882
384 Ga0070695_100003672
385 Ga0070695_100034941
386 Ga0070695_100126086
387 Ga0070695_100273010
388 Ga0070696_100005712
389 Ga0070693_100000899
390 Ga0070693_100008127
391 Ga0070665_100000496
392 Ga0070704_100036157
393 Ga0070704_100152144
394 Ga0070702_100234797
395 Ga0068859_100139723
396 Ga0068866_10294106
397 Ga0068866_10395760
398 Ga0068863_100006327
399 Ga0068863_100055906
400 Ga0068858_100019166
401 Ga0068860_100000901
402 Ga0068860_100196583
403 Ga0068860_100530647
404 Ga0068860_101100414
405 Ga0068860_101611533
406 Ga0068862_100469318
407 Ga0081540_1044270
408 Ga0070717_10043134
409 Ga0070717_10220737
410 Ga0070715_10589301
411 Ga0070716_100127714
412 Ga0070716_100180532
413 Ga0070716_100306056
414 Ga0070716_100973443
415 Ga0070716_101659705
416 Ga0070712_100027581
417 Ga0070712_100092764
418 Ga0070712_101255397
419 Ga0097621_100017515
420 Ga0068871_100002377
421 Ga0068871_100322238
422 Ga0075428_100230227
423 Ga0075428_100561419
424 Ga0075430_100789729
425 Ga0075430_100935350
426 Ga0075430_101248702
427 Ga0075431_100034032
428 Ga0075431_100233522
429 Ga0075433_10040628
430 Ga0075433_10073006
431 Ga0075433_10228963
432 Ga0075434_100009337
433 Ga0075434_100024391
434 Ga0075434_100167424
435 Ga0075434_100237130
436 Ga0075434_100307579
437 Ga0075434_100697772
438 Ga0075429_100004470
439 Ga0075429_100059084
440 Ga0068865_100680701
441 Ga0068865_100931917
442 Ga0075436_100069172
443 Ga0075436_100738890
444 Ga0075436_100748121
445 Ga0097620_100139732
446 Ga0075435_100065237
447 Ga0075435_100353572
448 Ga0099794_10000350
449 Ga0099794_10008967
450 Ga0099794_10014284
451 Ga0099794_10020363
452 Ga0099794_10023897
453 Ga0099794_10027226
454 Ga0099794_10031940
455 Ga0099794_10035539
456 Ga0099794_10040444
457 Ga0099794_10066220
458 Ga0099794_10068659
459 Ga0099794_10106838
460 Ga0099794_10123712
461 Ga0099794_10237650
462 Ga0099794_10238876
463 Ga0099794_10338345
464 Ga0099795_10025447
465 Ga0099795_10171801
466 Ga0099795_10293476
467 Ga0105240_11136102
468 Ga0111539_10274300
469 Ga0105247_10116497
470 Ga0105247_10675217
471 Ga0114129_10000978
472 Ga0114129_10532967
473 Ga0114129_10680073
474 Ga0114129_12606407
475 Ga0105243_11077258
476 Ga0105242_10027989
477 Ga0105248_10194132
478 Ga0105248_10358598
479 Ga0105248_11215499
480 Ga0105237_10061629
481 Ga0105238_10724815
482 Ga0105249_10200079
483 Ga0099796_10013708
484 Ga0099796_10091445
485 Ga0105239_10054754
486 Ga0157378_10000538
487 Ga0157378_10073351
488 Ga0157378_10074664
489 Ga0157372_10036494
490 Ga0157375_10253407
491 Ga0157375_10901961
492 Ga0163163_10410465
493 Ga0157379_10055638
494 Ga0157379_10445517
495 Ga0157376_10000032
496 Ga0157376_10000629
497 Ga0213876_10047297
498 Ga0207653_10003573
499 Ga0207692_10329816
500 Ga0207642_10283243
501 Ga0207710_10226293
502 Ga0207710_10322484
503 Ga0207699_10006971
504 Ga0207699_10086994
505 Ga0207699_11408571
506 Ga0207684_10039566
507 Ga0207684_10859981
508 Ga0207707_10133199
509 Ga0207695_11608924
510 Ga0207693_10018302
511 Ga0207693_10023756
512 Ga0207663_10277136
513 Ga0207663_10458343
514 Ga0207663_11045558
515 Ga0207646_10000305
516 Ga0207646_10036483
517 Ga0207646_10289412
518 Ga0207646_10308830
519 Ga0207646_10418403
520 Ga0207646_10490079
521 Ga0207646_10941969
522 Ga0207694_10510836
523 Ga0207700_10023069
524 Ga0207700_11078106
525 Ga0207664_11197043
526 Ga0207686_10159451
527 Ga0207709_10892889
528 Ga0207665_10010969
529 Ga0207665_10011297
530 Ga0207665_10080103
531 Ga0207665_10429638
532 Ga0207665_10895274
533 Ga0207665_11120547
534 Ga0207711_10239356
535 Ga0207711_10335456
536 Ga0207711_10771325
537 Ga0207712_10454013
538 Ga0207703_10014323
539 Ga0207639_10543085
540 Ga0207641_10001136
541 Ga0207641_10054301
542 Ga0207648_10206707
543 Ga0209588_1001160
544 Ga0209588_1003408
545 Ga0209588_1007189
546 Ga0209588_1021392
547 Ga0209588_1033182
548 Ga0209588_1040567
549 Ga0209588_1046088
550 Ga0209588_1068114
551 Ga0209588_1103749
552 Ga0268266_10000072
553 Ga0268264_10047540
554 Ga0268264_10158185
555 Ga0265334_10007744
556 Ga0265338_10498251
557 Ga0307510_10173508
558 Ga0373926_0063481
559 Ga0373952_0126082
560 Ga0373954_0036527
561 Ga0373943_0158337
562 Ga0373962_0365279
563 Ga0373962_0399467
564 Ga0373931_0059161
565 Ga0373927_0000181
566 Ga0373947_0006847
567 Ga0373937_0172566
568 Ga0373937_0266903
569 Ga0373925_0016750
570 Ga0373925_0464206
571 Ga0373925_1337663
572 Ga0436365_1665389
573 Ga0436362_0695877
574 Ga0439435_0051438
575 Ga0451577_0507671
576 Ga0451577_0550389
577 Ga0453683_0070045
578 Ga0453684_1025329
579 Ga0453684_1450374
580 Ga0453684_2413059
581 Ga0466959_0504008
582 Ga0451576_0071077
583 Ga0451576_0306451
584 Ga0451576_0383337
585 Ga0495603_0003513
586 Ga0495603_0111182
587 Ga0495603_0451627
588 Ga0495629_0126671
589 Ga0495641_0023994
590 Ga0495641_0038930
591 Ga0495580_0018168
592 Ga0495580_0058832
593 Ga0495580_0171748
594 Ga0495580_0284092
595 Ga0495580_0988400
596 Ga0495582_0000718
597 Ga0495639_0005520
598 Ga0495662_0082106
599 Ga0495664_0097888
600 Ga0495664_0150530
601 Ga0495594_0067896
602 Ga0495628_0171212
603 Ga0495630_0022984
604 Ga0495630_0033365
605 Ga0495666_0060133
606 Ga0495666_0071313
607 Ga0495665_0152421
608 Ga0495640_0396255
609 Ga0495586_0010303
610 Ga0495598_0092331
611 Ga0495645_0015070
612 Ga0495599_0125956
613 Ga0495623_0149133
614 Ga0495647_0011255
615 Ga0495658_0336354
616 Ga0495613_0429167
617 Ga0495624_0111964
618 Ga0495581_0565894
619 Ga0495604_0205346
620 Ga0495674_0148022
621 Ga0495676_0013478
622 Ga0495676_0136778
623 Ga0495676_1105410
624 Ga0495680_0008611
625 Ga0495684_0117730
626 Ga0495614_0119920
627 Ga0496101_0021969
628 Ga0496101_1119727
629 Ga0496102_0002989
630 Ga0496104_0305032
631 Ga0496104_0453375
632 Ga0496104_1033610
633 Ga0496104_1651866
634 Ga0496106_0442554
635 Ga0496106_1248354
636 Ga0496107_1056250
637 Ga0496114_0055131
638 Ga0496114_0206216
639 Ga0496115_0032991
640 Ga0496115_0145378
641 Ga0496115_0241211
642 Ga0496115_0354880
643 Ga0496126_0568950
644 Ga0501041_0249928
645 Ga0501042_0331539
646 Ga0501075_1512815
647 Ga0501081_0511994
648 nmdc:mga05p37_1588049_c1
649 nmdc:mga05p37_1752187_c1
650 nmdc:mga05p37_210979_c1
651 nmdc:mga05p37_362_c1
652 nmdc:mga05p37_627954_c1
653 nmdc:mga09592_166928_c1
654 nmdc:mga0qj67_1040160_c1
655 nmdc:mga06r32_22729_c1
656 nmdc:mga06r32_515786_c1
657 nmdc:mga08y16_339016_c1
658 nmdc:mga0n895_10216_c1
659 nmdc:mga0n895_137609_c1
660 nmdc:mga0n895_1996754_c1
661 nmdc:mga0n895_2118_c1
662 nmdc:mga0n895_21336_c1
663 nmdc:mga0n895_41205_c1
664 nmdc:mga0n895_789928_c1
665 nmdc:mga0n895_9368_c1
666 nmdc:mga0rr50_12540_c1
667 nmdc:mga0rr50_31091_c1
668 nmdc:mga0rr50_68321_c1
669 nmdc:mga08x19_180_c1
670 nmdc:mga08x19_441213_c1
671 nmdc:mga0a205_266658_c1
672 nmdc:mga0a205_49879_c1
673 nmdc:mga0a205_555767_c1
674 nmdc:mga0a205_609702_c1
675 nmdc:mga0a205_868875_c1
676 nmdc:mga0a205_9594_c2
677 Ga0501084_1534287
678 2673164407

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00383

dCMP_cyt_deam_1

Cytidine and deoxycytidylate deaminase zinc-binding region

15

118

0.87

PF08211

dCMP_cyt_deam_2

Cytidine and deoxycytidylate deaminase zinc-binding region

1

98

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
2d30-assembly1.cif.gz_A crystal structure of cytidine deaminase cdd-2 (ba4525) from bacillus anthracis at 2.40a resolution 0.9576 15 134
3dmo-assembly1.cif.gz_C 1.6 a crystal structure of cytidine deaminase from burkholderia pseudomallei 0.9564 15 134
1r5t-assembly1.cif.gz_D the crystal structure of cytidine deaminase cdd1, an orphan c to u editase from yeast 0.944 17 137
1jtk-assembly1.cif.gz_A crystal structure of cytidine deaminase from bacillus subtilis in complex with the inhibitor tetrahydrodeoxyuridine 0.9279 15 141
1ux1-assembly1.cif.gz_D bacillus subtilis cytidine deaminase with a cys53his and an arg56gln substitution 0.9263 15 141
ID Description Score Start End Superfamily
af_Q2FY04_3_129_3.40.140.10 Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 0.945 15 138 3.40.140.10
1r5tD00 Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 0.944 17 137 3.40.140.10
af_Q9VLR2_22_168_3.40.140.10 Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 0.9345 18 134 3.40.140.10
af_A0A1D8PMQ1_5_145_3.40.140.10 Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 0.9289 17 141 3.40.140.10
af_Q2FY04_3_129_3.40.140.10 Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 0.9166 15 138 3.40.140.10
ID Description Score Start End GO Terms
AF-A0A6A0IFH8-F1-model_v4 Cytidine deaminase (EC 3.5.4.5) (Cytidine aminohydrolase) 0.9717 17 138 GO:0004126
GO:0005829
GO:0008270
GO:0009972
GO:0042802
AF-C0GKW3-F1-model_v4 Cytidine deaminase (EC 3.5.4.5) (Cytidine aminohydrolase) 0.9707 17 120 GO:0004126
GO:0005829
GO:0008270
GO:0009972
AF-A0A832FKR4-F1-model_v4 Cytidine deaminase (EC 3.5.4.5) (Cytidine aminohydrolase) 0.9686 17 134 GO:0004126
GO:0005829
GO:0008270
GO:0009972
AF-A0A2V7WNS3-F1-model_v4 Cytidine deaminase 0.9684 20 122 GO:0004126
GO:0005829
GO:0008270
GO:0009972
GO:0042802
AF-A0A661ACN9-F1-model_v4 Cytidine deaminase (EC 3.5.4.5) (Cytidine aminohydrolase) 0.9666 17 134 GO:0004126
GO:0005829
GO:0008270
GO:0009972
GO:0042802

Map