F413800

General Info

Members Datasets Scaffolds Average Seq Length
339 234 329 401

Family's Representative Sequence

Representative Sequence 3300005330|Ga0070690_100000321|Ga0070690_10000032122
Length 422
Sequence MSQPADPRLPLAGVRILAVEQYGAGPFGTLYLADLGAEVIKIENHKDGGDVGREVGPHFFGPGDSHFFQTFNRNKRSVTLDLKHPEGKAAFGALVKTADAVLDNLRGDLPDKLGLTYEHLKEVNPRIVCAHLSAYGRSGSRKAWPGYDYLMQAEAGHMSLTGEPGSPPTRYGLSIVDLMTGLAAAFGLLAGVLSARETGRGMDVDTSLFDVALHNLNYPGTWFLNAGAVTGRTPRSSHPSLTPSQLYRTRDGWIFIMCNKEKFWGLLAESLGKPEWTKDPAFATFKARLANRERVTQMLDAALMTRTTAEWIEHFAGKVPASPVYDVAQALQSDFVAERDGVVDYRYPDGRSARMIAGPIRVAGVGLPARAAPPMGADTDAELRAAGYSDARIAALRASGVISDSPKTKPGTSESIELAASG

Samples

Sample ID Description Type Environment
1 2597490356 Azospirillum brasilense sp7 Isolate Unclassified
2 2721755763 Pandoraea thiooxydans ATSB16 Isolate Rhizosphere
3 2791355137 Paraburkholderia piptadeniae STM7183 Isolate Unclassified
4 2842333319 Skermanella aerolata SEMIA 4010 Isolate Nodule
5 2846952575 Azospirillum brasilense sp7 Isolate Unclassified
6 2848858292 Azospirillum brasilense Az39 Isolate Unclassified
7 2857542790 Achromobacter sp. R-72367 Isolate Unclassified
8 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
9 2883087390 Paraburkholderia guartelaensis CNPSo 3008 Isolate Unclassified
10 2904615490 Paraburkholderia franconis CNPSo 3157 Isolate Unclassified
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
23 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
24 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
25 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
26 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
27 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
31 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
32 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
33 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
34 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
35 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
36 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
37 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
38 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
39 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
40 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
41 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
42 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
43 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
44 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
45 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
46 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
47 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
48 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
49 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
50 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
51 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
52 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
53 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
54 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
55 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
56 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
58 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
59 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
60 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
61 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
62 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
63 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
64 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
66 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
68 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
69 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
71 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
72 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
73 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
74 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
75 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
76 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
77 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
78 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
79 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
80 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
81 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
82 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
83 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
84 3300016635 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 Metagenome Rhizosphere
85 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
86 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
119 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
122 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
123 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
124 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
125 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
126 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
127 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
128 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
129 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
130 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
131 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
132 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
133 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
134 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
135 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
136 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
137 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
138 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
139 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
140 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
141 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
142 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
143 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
144 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
145 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
146 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
147 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
148 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
149 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
150 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
151 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
152 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
153 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
154 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
155 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
156 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
157 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
158 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
159 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
160 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
161 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
162 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
163 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
164 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
165 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
166 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
167 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
168 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
169 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
170 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
171 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
172 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
173 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
174 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
175 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
176 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
177 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
178 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
179 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
180 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
181 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
182 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
183 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
184 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
185 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
186 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
187 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
188 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
189 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
190 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
191 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
192 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
193 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
194 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
195 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
196 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
197 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
198 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
199 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
200 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
201 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
202 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
203 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
204 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
205 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
206 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
207 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
208 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
209 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
210 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
211 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
212 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
213 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
214 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
215 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
216 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
217 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
218 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
219 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
220 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
221 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
222 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
223 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
224 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
225 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
226 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
227 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
228 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
229 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
230 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
231 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
232 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
233 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
234 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.05
Metatranscriptomes 0
Isolates 2.95

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.24
Nodule 0.29
Rhizoplane 5.9
Rhizosphere 87.02
Stem 0
Stem Tuber 0
Unclassified 3.54

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070690_100000321 3300005330 Bacteria 24690
2 Ga0068869_100000861 3300005334 Bacteria 17438
3 Ga0068869_100068592 3300005334 Bacteria 2620
4 Ga0070680_100000425 3300005336 Bacteria 28804
5 Ga0070682_100004549 3300005337 Bacteria 7709
6 Ga0068868_100000641 3300005338 Bacteria 23565
7 Ga0070689_100000304 3300005340 Bacteria 28624
8 Ga0070689_100024542 3300005340 Bacteria 4523
9 Ga0070689_100083403 3300005340 Bacteria 2512
10 Ga0070687_100000066 3300005343 Bacteria 34385
11 Ga0070671_100009995 3300005355 Bacteria 7619
12 Ga0070671_100076683 3300005355 Bacteria 2793
13 Ga0070673_100073225 3300005364 Bacteria 2757
14 Ga0070673_100141542 3300005364 Bacteria 2029
15 Ga0070688_100064932 3300005365 Bacteria 2318
16 Ga0070667_100188614 3300005367 Bacteria 1826
17 Ga0070714_100156312 3300005435 Bacteria 2059
18 Ga0070713_100021485 3300005436 Bacteria 4967
19 Ga0070705_100000090 3300005440 Bacteria 50516
20 Ga0070700_100000660 3300005441 Bacteria 17043
21 Ga0070694_100000122 3300005444 Bacteria 38260
22 Ga0070708_100000493 3300005445 Bacteria 29763
23 Ga0070681_10001817 3300005458 Bacteria 19214
24 Ga0070681_10057740 3300005458 Bacteria 3861
25 Ga0068867_100001566 3300005459 Bacteria 15884
26 Ga0070706_100020115 3300005467 Bacteria 6151
27 Ga0070707_100008783 3300005468 Bacteria 9373
28 Ga0070698_100010188 3300005471 Bacteria 10043
29 Ga0070679_100019308 3300005530 Bacteria 6624
30 Ga0070686_100000292 3300005544 Bacteria 33649
31 Ga0070686_100119027 3300005544 Bacteria 1811
32 Ga0070695_100000095 3300005545 Bacteria 37826
33 Ga0070695_100004831 3300005545 Bacteria 7933
34 Ga0070695_100015093 3300005545 Bacteria 4662
35 Ga0070695_100102721 3300005545 Bacteria 1928
36 Ga0070696_100000133 3300005546 Bacteria 40142
37 Ga0070693_100000075 3300005547 Bacteria 41068
38 Ga0070704_100000230 3300005549 Bacteria 23696
39 Ga0068855_100001022 3300005563 Bacteria 34876
40 Ga0068854_100002816 3300005578 Bacteria 10816
41 Ga0068856_100007808 3300005614 Bacteria 10446
42 Ga0068856_100434536 3300005614 Bacteria 1333
43 Ga0070702_100000043 3300005615 Bacteria 34094
44 Ga0068852_100078376 3300005616 Bacteria 2923
45 Ga0068859_100001771 3300005617 Bacteria 21966
46 Ga0068859_100056674 3300005617 Bacteria 3945
47 Ga0068864_100067934 3300005618 Bacteria 3096
48 Ga0068864_100397047 3300005618 Bacteria 1310
49 Ga0068866_10000104 3300005718 Bacteria 36131
50 Ga0068861_100000193 3300005719 Bacteria 32735
51 Ga0068863_100211433 3300005841 Bacteria 1868
52 Ga0068863_100250242 3300005841 Bacteria 1712
53 Ga0068858_100001082 3300005842 Bacteria 28191
54 Ga0068858_100090730 3300005842 Bacteria 2844
55 Ga0068858_100102756 3300005842 Bacteria 2666
56 Ga0068860_100002214 3300005843 Bacteria 20454
57 Ga0068862_100001697 3300005844 Bacteria 19969
58 Ga0075363_100018844 3300006048 Bacteria 3443
59 Ga0075364_10031765 3300006051 Bacteria 3392
60 Ga0075364_10089167 3300006051 Bacteria 2045
61 Ga0075362_10009342 3300006177 Bacteria 3789
62 Ga0075366_10004233 3300006195 Bacteria 7690
63 Ga0097621_100000248 3300006237 Bacteria 36293
64 Ga0097621_100168839 3300006237 Bacteria 1885
65 Ga0068871_100000205 3300006358 Bacteria 40986
66 Ga0075428_100001683 3300006844 Bacteria 23566
67 Ga0075428_100010161 3300006844 Bacteria 10453
68 Ga0075428_100209627 3300006844 Bacteria 2106
69 Ga0075430_100007707 3300006846 Bacteria 9094
70 Ga0075431_100000058 3300006847 Bacteria 61801
71 Ga0075431_100043426 3300006847 Bacteria 4639
72 Ga0075431_100084799 3300006847 Bacteria 3270
73 Ga0075434_100024236 3300006871 Bacteria 5931
74 Ga0075429_100001141 3300006880 Bacteria 21427
75 Ga0075429_100006604 3300006880 Bacteria 10047
76 Ga0075429_100034093 3300006880 Bacteria 4423
77 Ga0075429_100090897 3300006880 Bacteria 2663
78 Ga0068865_100000833 3300006881 Bacteria 17410
79 Ga0068865_100034510 3300006881 Bacteria 3395
80 Ga0097620_100001771 3300006931 Bacteria 21966
81 Ga0097620_100056673 3300006931 Bacteria 3945
82 Ga0075435_100041692 3300007076 Bacteria 3670
83 Ga0111539_10004981 3300009094 Bacteria 17278
84 Ga0111539_10008784 3300009094 Bacteria 12812
85 Ga0111539_10258460 3300009094 Bacteria 2027
86 Ga0105245_10000478 3300009098 Bacteria 36680
87 Ga0105245_10076726 3300009098 Bacteria 3045
88 Ga0105247_10041537 3300009101 Bacteria 2815
89 Ga0114129_10000046 3300009147 Bacteria 105492
90 Ga0114129_10054696 3300009147 Bacteria 5595
91 Ga0114129_10061963 3300009147 Bacteria 5227
92 Ga0105243_10000413 3300009148 Bacteria 44895
93 Ga0105241_10026014 3300009174 Bacteria 4353
94 Ga0105241_10068883 3300009174 Bacteria 2742
95 Ga0105242_10000394 3300009176 Bacteria 34588
96 Ga0105248_10065191 3300009177 Bacteria 4090
97 Ga0105249_10002974 3300009553 Bacteria 14613
98 Ga0105249_10250142 3300009553 Bacteria 1757
99 Ga0105239_10035354 3300010375 Bacteria 5487
100 Ga0105246_10023615 3300011119 Bacteria 3981
101 Ga0157371_10163720 3300013102 Bacteria 1588
102 Ga0157378_10000543 3300013297 Bacteria 35895
103 Ga0163162_10134687 3300013306 Bacteria 2581
104 Ga0163163_10226374 3300014325 Bacteria 1919
105 Ga0157380_10094858 3300014326 Bacteria 2470
106 Ga0157379_10051314 3300014968 Bacteria 3684
107 Ga0157379_10241760 3300014968 Bacteria 1637
108 Ga0157376_10019994 3300014969 Bacteria 5171
109 Ga0183361_10004 3300016635 Bacteria 484183
110 Ga0213875_10001724 3300021388 Bacteria 13716
111 Ga0207653_10031821 3300025885 Bacteria 1705
112 Ga0207642_10005973 3300025899 Bacteria 4016
113 Ga0207645_10041379 3300025907 Bacteria 2950
114 Ga0207643_10060397 3300025908 Bacteria 2164
115 Ga0207684_10019530 3300025910 Bacteria 5796
116 Ga0207654_10012917 3300025911 Bacteria 4284
117 Ga0207707_10012386 3300025912 Bacteria 7412
118 Ga0207660_10001853 3300025917 Bacteria 14083
119 Ga0207660_10182946 3300025917 Bacteria 1628
120 Ga0207662_10000113 3300025918 Bacteria 38841
121 Ga0207662_10050704 3300025918 Bacteria 2467
122 Ga0207652_10010553 3300025921 Bacteria 7435
123 Ga0207650_10008705 3300025925 Bacteria 6928
124 Ga0207687_10000273 3300025927 Bacteria 35393
125 Ga0207644_10001532 3300025931 Bacteria 14889
126 Ga0207644_10058032 3300025931 Bacteria 2796
127 Ga0207644_10129089 3300025931 Bacteria 1933
128 Ga0207686_10000675 3300025934 Bacteria 21125
129 Ga0207709_10001300 3300025935 Bacteria 17789
130 Ga0207670_10000407 3300025936 Bacteria 24598
131 Ga0207670_10105707 3300025936 Bacteria 2018
132 Ga0207704_10000625 3300025938 Bacteria 15619
133 Ga0207665_10115762 3300025939 Bacteria 1889
134 Ga0207691_10150710 3300025940 Bacteria 2045
135 Ga0207689_10000554 3300025942 Bacteria 35670
136 Ga0207689_10016206 3300025942 Bacteria 6312
137 Ga0207667_10005883 3300025949 Bacteria 14937
138 Ga0207651_10165245 3300025960 Bacteria 1739
139 Ga0207640_10001066 3300025981 Bacteria 15195
140 Ga0207677_10000391 3300026023 Bacteria 30176
141 Ga0207703_10008177 3300026035 Bacteria 8265
142 Ga0207703_10115990 3300026035 Bacteria 2292
143 Ga0207708_10000505 3300026075 Bacteria 30021
144 Ga0207702_10020045 3300026078 Bacteria 5542
145 Ga0207702_10230451 3300026078 Bacteria 1731
146 Ga0207641_10144898 3300026088 Bacteria 2147
147 Ga0207648_10000548 3300026089 Bacteria 42037
148 Ga0207674_10019697 3300026116 Bacteria 7304
149 Ga0207675_100000305 3300026118 Bacteria 47105
150 Ga0207675_100073307 3300026118 Bacteria 3203
151 Ga0207698_10057751 3300026142 Bacteria 3004
152 Ga0207428_10004515 3300027907 Bacteria 13203
153 Ga0268265_10001208 3300028380 Bacteria 22438
154 Ga0268264_10000882 3300028381 Bacteria 31650
155 Ga0316575_10008137 3300031665 Bacteria 3812
156 Ga0373938_0002276 3300034957 Bacteria 3085
157 Ga0373934_0011141 3300035086 Bacteria 3384
158 Ga0373939_0006145 3300035114 Bacteria 2887
159 Ga0373939_0020826 3300035114 Bacteria 1787
160 Ga0373954_0000012 3300035118 Bacteria 73616
161 Ga0373956_0009241 3300035119 Bacteria 4002
162 Ga0373955_0018676 3300035172 Bacteria 3453
163 Ga0373955_0067549 3300035172 Bacteria 1990
164 Ga0316574_0001852 3300035398 Bacteria 10312
165 Ga0373924_0039114 3300035410 Bacteria 1937
166 Ga0373931_0001976 3300035691 Bacteria 9024
167 Ga0373931_0007271 3300035691 Bacteria 5210
168 Ga0373931_0014631 3300035691 Bacteria 3838
169 Ga0373933_0001612 3300035724 Bacteria 13194
170 Ga0373937_0001052 3300036401 Bacteria 23314
171 Ga0373937_0001834 3300036401 Bacteria 17852
172 Ga0373925_0030008 3300037068 Bacteria 3989
173 Ga0373925_0172567 3300037068 Bacteria 1708
174 Ga0395900_0089010 3300037418 Bacteria 3174
175 Ga0395905_0020466 3300037471 Bacteria 6268
176 Ga0436364_1276734 3300037853 Bacteria 28890
177 Ga0395901_0306095 3300038443 Bacteria 1647
178 Ga0439441_000696 3300042001 Bacteria 3877
179 Ga0439435_0000065 3300042436 Bacteria 12662
180 Ga0439435_0004538 3300042436 Bacteria 3001
181 Ga0439444_0000652 3300042437 Bacteria 4025
182 Ga0451577_0044483 3300042876 Bacteria 3975
183 Ga0451576_0006531 3300045051 Bacteria 14270
184 Ga0466967_0049233 3300045976 Bacteria 3684
185 Ga0495592_0024367 3300046454 Bacteria 4601
186 Ga0495629_0004234 3300046459 Bacteria 10755
187 Ga0495629_0016192 3300046459 Bacteria 5352
188 Ga0495629_0062091 3300046459 Bacteria 2611
189 Ga0495651_0000606 3300046462 Bacteria 27884
190 Ga0495653_0002673 3300046463 Bacteria 14197
191 Ga0495650_0000785 3300046471 Bacteria 38956
192 Ga0495650_0024992 3300046471 Bacteria 2810
193 Ga0495580_0005139 3300046472 Bacteria 10884
194 Ga0495580_0008112 3300046472 Bacteria 8376
195 Ga0495582_0052881 3300046473 Bacteria 2240
196 Ga0495662_0004035 3300046476 Bacteria 7394
197 Ga0495607_0031295 3300046501 Bacteria 3258
198 Ga0495608_0000591 3300046511 Bacteria 24964
199 Ga0495610_0000131 3300046512 Bacteria 82558
200 Ga0495618_0001466 3300046514 Bacteria 15809
201 Ga0495628_0006762 3300046516 Bacteria 9984
202 Ga0495628_0034908 3300046516 Bacteria 4043
203 Ga0495628_0091275 3300046516 Bacteria 2357
204 Ga0495630_0082783 3300046517 Bacteria 2422
205 Ga0495637_0021547 3300046520 Bacteria 2954
206 Ga0495643_0008467 3300046522 Bacteria 6508
207 Ga0495644_0054212 3300046523 Bacteria 1506
208 Ga0495652_0003497 3300046529 Bacteria 15467
209 Ga0495652_0074599 3300046529 Bacteria 2820
210 Ga0495665_0000077 3300046531 Bacteria 42404
211 Ga0495665_0048689 3300046531 Bacteria 2247
212 Ga0495640_0002454 3300046533 Bacteria 14898
213 Ga0495640_0014998 3300046533 Bacteria 5843
214 Ga0495645_0001808 3300046543 Bacteria 14530
215 Ga0495645_0052095 3300046543 Bacteria 2978
216 Ga0495667_0005199 3300046559 Bacteria 8796
217 Ga0495667_0055140 3300046559 Bacteria 2614
218 Ga0495656_0041167 3300046615 Bacteria 1929
219 Ga0495634_0002842 3300046642 Bacteria 14216
220 Ga0495635_0003751 3300046663 Bacteria 10547
221 Ga0495635_0007363 3300046663 Bacteria 7679
222 Ga0495588_0010874 3300046674 Bacteria 4253
223 Ga0495657_0003270 3300046675 Bacteria 13307
224 Ga0495599_0000564 3300046678 Bacteria 21162
225 Ga0495599_0040896 3300046678 Bacteria 2911
226 Ga0495623_0001431 3300046679 Bacteria 16178
227 Ga0495646_0004951 3300046680 Bacteria 8412
228 Ga0495658_0047841 3300046683 Bacteria 2410
229 Ga0495613_0024361 3300046689 Bacteria 4510
230 Ga0495613_0194635 3300046689 Bacteria 1432
231 Ga0495624_0012093 3300046690 Bacteria 5910
232 Ga0495670_0045100 3300046691 Bacteria 2201
233 Ga0495671_0014316 3300046692 Bacteria 4272
234 Ga0495649_0000551 3300046694 Bacteria 31839
235 Ga0495600_0004060 3300046809 Bacteria 8704
236 Ga0495600_0023305 3300046809 Bacteria 3982
237 Ga0495600_0161130 3300046809 Bacteria 1450
238 Ga0495581_0012527 3300047315 Bacteria 4913
239 Ga0495581_0025911 3300047315 Bacteria 3401
240 Ga0495604_0003818 3300047317 Bacteria 11995
241 Ga0495674_0024339 3300047319 Bacteria 5564
242 Ga0495674_0050144 3300047319 Bacteria 3684
243 Ga0495674_0054209 3300047319 Bacteria 3522
244 Ga0495674_0071071 3300047319 Bacteria 3006
245 Ga0495674_0095185 3300047319 Bacteria 2539
246 Ga0495676_0021794 3300047321 Bacteria 5588
247 Ga0495680_0001686 3300047322 Bacteria 23465
248 Ga0495680_0014417 3300047322 Bacteria 6843
249 Ga0495683_0000006 3300047323 Bacteria 272409
250 Ga0495683_0003703 3300047323 Bacteria 8851
251 Ga0495675_0043639 3300047444 Bacteria 2857
252 Ga0495675_0065342 3300047444 Bacteria 2301
253 Ga0495685_020159 3300047447 Bacteria 2291
254 Ga0495593_0004402 3300047673 Bacteria 8371
255 Ga0495593_0024841 3300047673 Bacteria 3317
256 Ga0495593_0053690 3300047673 Bacteria 2126
257 Ga0495593_0073890 3300047673 Bacteria 1768
258 Ga0495602_0010055 3300048088 Bacteria 9820
259 Ga0495602_0040592 3300048088 Bacteria 4263
260 Ga0495602_0097910 3300048088 Bacteria 2415
261 Ga0496100_0009694 3300048903 Bacteria 5418
262 Ga0496101_0002442 3300048904 Bacteria 11422
263 Ga0496102_0062873 3300048905 Bacteria 3399
264 Ga0496104_0008622 3300048907 Bacteria 9068
265 Ga0496104_0079951 3300048907 Bacteria 3116
266 Ga0496105_0044828 3300048908 Bacteria 3648
267 Ga0496105_0077166 3300048908 Bacteria 2751
268 Ga0496107_0047044 3300048910 Bacteria 3106
269 Ga0496108_0127260 3300048911 Bacteria 2188
270 Ga0496109_0139007 3300048912 Bacteria 2271
271 Ga0496109_0139796 3300048912 Bacteria 2264
272 Ga0496110_0044999 3300048913 Bacteria 3856
273 Ga0496110_0146253 3300048913 Bacteria 2138
274 Ga0496111_0163262 3300048914 Bacteria 1654
275 Ga0496112_0004419 3300048915 Bacteria 11904
276 Ga0496112_0206396 3300048915 Bacteria 1923
277 Ga0496113_0091255 3300048916 Bacteria 2348
278 Ga0496114_0022087 3300048917 Bacteria 5182
279 Ga0496115_0011356 3300048918 Bacteria 6677
280 Ga0496115_0034259 3300048918 Bacteria 4013
281 Ga0496122_0074114 3300048925 Bacteria 2410
282 Ga0496124_0000007 3300048927 Bacteria 883534
283 Ga0495682_0011313 3300049460 Bacteria 3435
284 Ga0501038_0095721 3300049574 Bacteria 2480
285 Ga0501040_0051481 3300049576 Bacteria 2817
286 Ga0501042_0123418 3300049578 Bacteria 1865
287 Ga0501048_0081507 3300049582 Bacteria 2283
288 Ga0501071_0081837 3300049587 Bacteria 2363
289 Ga0501071_0245451 3300049587 Bacteria 1351
290 Ga0501072_0042564 3300049588 Bacteria 3567
291 Ga0501072_0086110 3300049588 Bacteria 2493
292 Ga0501075_0096495 3300049591 Bacteria 2243
293 Ga0501076_0079935 3300049592 Bacteria 2624
294 Ga0501076_0114755 3300049592 Bacteria 2180
295 Ga0501083_0142388 3300049744 Bacteria 1570
296 nmdc:mga03683_18801_c1 3300050489 Bacteria 2632
297 nmdc:mga00v17_19188_c1 3300050491 Bacteria 3899
298 nmdc:mga00v17_33871_c1 3300050491 Bacteria 3030
299 nmdc:mga0yw44_12866_c1 3300050492 Bacteria 4380
300 nmdc:mga0k408_3477_c1 3300050493 Bacteria 8336
301 nmdc:mga05p37_11597_c1 3300050507 Bacteria 10502
302 nmdc:mga05p37_138_c1 3300050507 Bacteria 67838
303 nmdc:mga05p37_142285_c1 3300050507 Bacteria 2938
304 nmdc:mga05p37_52813_c1 3300050507 Bacteria 3681
305 nmdc:mga09592_1011_c1 3300050508 Bacteria 22343
306 nmdc:mga09592_20304_c1 3300050508 Bacteria 5461
307 nmdc:mga09592_36309_c1 3300050508 Bacteria 4127
308 nmdc:mga09592_62227_c1 3300050508 Bacteria 3157
309 nmdc:mga0qj67_2622_c1 3300050509 Bacteria 12887
310 nmdc:mga0qj67_376942_c1 3300050509 Bacteria 1146
311 nmdc:mga0qj67_40280_c1 3300050509 Bacteria 3672
312 nmdc:mga0qj67_49473_c1 3300050509 Bacteria 3323
313 nmdc:mga06r32_15_c1 3300050510 Bacteria 106010
314 nmdc:mga06r32_16443_c1 3300050510 Bacteria 6744
315 nmdc:mga06r32_187753_c1 3300050510 Bacteria 2054
316 nmdc:mga06r32_215214_c1 3300050510 Bacteria 1909
317 nmdc:mga06r32_51926_c1 3300050510 Bacteria 2557
318 nmdc:mga06r32_62949_c1 3300050510 Bacteria 3574
319 nmdc:mga06r32_94547_c1 3300050510 Bacteria 2924
320 nmdc:mga08y16_91_c2 3300050511 Bacteria 43815
321 nmdc:mga0n895_6010_c1 3300050512 Bacteria 10226
322 nmdc:mga0rr50_7181_c1 3300050513 Bacteria 6843
323 Ga0495601_0062379 3300053077 Bacteria 2367
324 Ga0495612_0005722 3300053078 Bacteria 5133
325 Ga0495595_0000552 3300053084 Bacteria 14281
326 Ga0495619_0002169 3300053085 Bacteria 13003
327 Ga0500618_001134 3300053125 Bacteria 12907
328 Ga0501084_0318694 3300054114 Bacteria 1313
329 Ga0530510_0063773 3300061734 Bacteria 2668

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009553 Ga0105249_10250142 Ga0105249_102501422 351
2 3300050509 nmdc:mga0qj67_376942_c1 nmdc:mga0qj67_376942_c1_66_1121 351
3 3300047315 Ga0495581_0025911 Ga0495581_0025911_1119_2255 369
4 3300006844 Ga0075428_100209627 Ga0075428_1002096272 376
5 3300042436 Ga0439435_0004538 Ga0439435_0004538_1258_2424 382
6 3300025908 Ga0207643_10060397 Ga0207643_100603972 383
7 3300049578 Ga0501042_0123418 Ga0501042_0123418_227_1420 383
8 3300049588 Ga0501072_0086110 Ga0501072_0086110_67_1260 383
9 3300005445 Ga0070708_100000493 Ga0070708_1000004939 384
10 3300005467 Ga0070706_100020115 Ga0070706_1000201152 384
11 3300005468 Ga0070707_100008783 Ga0070707_1000087835 384
12 3300005471 Ga0070698_100010188 Ga0070698_1000101882 384
13 3300025910 Ga0207684_10019530 Ga0207684_100195306 384
14 3300006048 Ga0075363_100018844 Ga0075363_1000188442 385
15 3300006051 Ga0075364_10089167 Ga0075364_100891672 385
16 3300006177 Ga0075362_10009342 Ga0075362_100093422 385
17 3300006195 Ga0075366_10004233 Ga0075366_100042334 385
18 3300049744 Ga0501083_0142388 Ga0501083_0142388_47_1219 385
19 3300050489 nmdc:mga03683_18801_c1 nmdc:mga03683_18801_c1_613_1785 385
20 3300050491 nmdc:mga00v17_33871_c1 nmdc:mga00v17_33871_c1_462_1634 385
21 3300050493 nmdc:mga0k408_3477_c1 nmdc:mga0k408_3477_c1_5771_6943 385
22 3300006844 Ga0075428_100001683 Ga0075428_10000168315 386
23 3300006847 Ga0075431_100000058 Ga0075431_10000005825 386
24 3300006880 Ga0075429_100001141 Ga0075429_1000011413 386
25 3300027907 Ga0207428_10004515 Ga0207428_1000451511 386
26 3300050507 nmdc:mga05p37_138_c1 nmdc:mga05p37_138_c1_63900_65075 386
27 3300050508 nmdc:mga09592_1011_c1 nmdc:mga09592_1011_c1_7519_8694 386
28 3300050509 nmdc:mga0qj67_40280_c1 nmdc:mga0qj67_40280_c1_19_1194 386
29 3300050510 nmdc:mga06r32_15_c1 nmdc:mga06r32_15_c1_40605_41780 386
30 3300050511 nmdc:mga08y16_91_c2 nmdc:mga08y16_91_c2_1208_2383 386
31 3300037853 Ga0436364_1276734 Ga0436364_1276734_25176_26339 387
32 iso_pu_bacteria 2879083081 2879086454 388
33 3300037418 Ga0395900_0089010 Ga0395900_0089010_634_1857 389
34 3300038443 Ga0395901_0306095 Ga0395901_0306095_352_1575 389
35 3300005545 Ga0070695_100004831 Ga0070695_1000048314 390
36 iso_pu_bacteria 2597490356 2599106671 391
37 iso_pu_bacteria 2846952575 2846958305 391
38 iso_pu_bacteria 2848858292 2848864782 391
39 3300046520 Ga0495637_0021547 Ga0495637_0021547_170_1348 392
40 3300046692 Ga0495671_0014316 Ga0495671_0014316_1511_2689 392
41 3300046694 Ga0495649_0000551 Ga0495649_0000551_5527_6705 392
42 3300047323 Ga0495683_0000006 Ga0495683_0000006_22556_23734 392
43 3300053125 Ga0500618_001134 Ga0500618_001134_2903_4081 392
44 iso_pu_bacteria 2721755763 2723878093 392
45 iso_pu_bacteria 2791355137 2792832534 392
46 iso_pu_bacteria 2883087390 2883088614 392
47 iso_pu_bacteria 2904615490 2904623121 392
48 3300009094 Ga0111539_10004981 Ga0111539_1000498115 393
49 3300009147 Ga0114129_10000046 Ga0114129_1000004654 393
50 3300005334 Ga0068869_100068592 Ga0068869_1000685922 394
51 3300005340 Ga0070689_100024542 Ga0070689_1000245424 394
52 3300005364 Ga0070673_100141542 Ga0070673_1001415422 394
53 3300005365 Ga0070688_100064932 Ga0070688_1000649322 394
54 3300005367 Ga0070667_100188614 Ga0070667_1001886142 394
55 3300005617 Ga0068859_100056674 Ga0068859_1000566742 394
56 3300005618 Ga0068864_100067934 Ga0068864_1000679342 394
57 3300005841 Ga0068863_100211433 Ga0068863_1002114331 394
58 3300005841 Ga0068863_100250242 Ga0068863_1002502422 394
59 3300005842 Ga0068858_100102756 Ga0068858_1001027562 394
60 3300006237 Ga0097621_100168839 Ga0097621_1001688392 394
61 3300006844 Ga0075428_100010161 Ga0075428_1000101618 394
62 3300006880 Ga0075429_100006604 Ga0075429_1000066049 394
63 3300006881 Ga0068865_100034510 Ga0068865_1000345102 394
64 3300006931 Ga0097620_100056673 Ga0097620_1000566734 394
65 3300009094 Ga0111539_10008784 Ga0111539_100087848 394
66 3300009101 Ga0105247_10041537 Ga0105247_100415372 394
67 3300009147 Ga0114129_10054696 Ga0114129_100546965 394
68 3300009147 Ga0114129_10061963 Ga0114129_100619632 394
69 3300009174 Ga0105241_10068883 Ga0105241_100688832 394
70 3300011119 Ga0105246_10023615 Ga0105246_100236153 394
71 3300014325 Ga0163163_10226374 Ga0163163_102263741 394
72 3300014326 Ga0157380_10094858 Ga0157380_100948583 394
73 3300025917 Ga0207660_10182946 Ga0207660_101829461 394
74 3300025918 Ga0207662_10050704 Ga0207662_100507043 394
75 3300025931 Ga0207644_10129089 Ga0207644_101290892 394
76 3300025936 Ga0207670_10105707 Ga0207670_101057072 394
77 3300025942 Ga0207689_10016206 Ga0207689_100162064 394
78 3300026035 Ga0207703_10115990 Ga0207703_101159902 394
79 3300026116 Ga0207674_10019697 Ga0207674_100196974 394
80 3300026118 Ga0207675_100073307 Ga0207675_1000733072 394
81 3300046615 Ga0495656_0041167 Ga0495656_0041167_201_1385 394
82 3300047447 Ga0495685_020159 Ga0495685_020159_1086_2270 394
83 3300048905 Ga0496102_0062873 Ga0496102_0062873_997_2181 394
84 3300048911 Ga0496108_0127260 Ga0496108_0127260_938_2122 394
85 3300048912 Ga0496109_0139007 Ga0496109_0139007_276_1460 394
86 3300048912 Ga0496109_0139796 Ga0496109_0139796_1012_2196 394
87 3300048913 Ga0496110_0044999 Ga0496110_0044999_194_1378 394
88 3300048914 Ga0496111_0163262 Ga0496111_0163262_156_1340 394
89 3300048915 Ga0496112_0206396 Ga0496112_0206396_555_1739 394
90 3300048918 Ga0496115_0034259 Ga0496115_0034259_1078_2262 394
91 3300050507 nmdc:mga05p37_11597_c1 nmdc:mga05p37_11597_c1_7326_8513 394
92 3300050507 nmdc:mga05p37_142285_c1 nmdc:mga05p37_142285_c1_1462_2646 394
93 3300050508 nmdc:mga09592_20304_c1 nmdc:mga09592_20304_c1_3605_4792 394
94 3300050509 nmdc:mga0qj67_2622_c1 nmdc:mga0qj67_2622_c1_7047_8234 394
95 3300050510 nmdc:mga06r32_16443_c1 nmdc:mga06r32_16443_c1_4302_5489 394
96 3300050510 nmdc:mga06r32_187753_c1 nmdc:mga06r32_187753_c1_489_1676 394
97 3300050510 nmdc:mga06r32_215214_c1 nmdc:mga06r32_215214_c1_200_1384 394
98 3300050510 nmdc:mga06r32_51926_c1 nmdc:mga06r32_51926_c1_587_1771 394
99 3300050510 nmdc:mga06r32_94547_c1 nmdc:mga06r32_94547_c1_88_1272 394
100 3300050512 nmdc:mga0n895_6010_c1 nmdc:mga0n895_6010_c1_3315_4499 394
101 3300005435 Ga0070714_100156312 Ga0070714_1001563121 395
102 3300005458 Ga0070681_10001817 Ga0070681_100018172 395
103 3300005545 Ga0070695_100015093 Ga0070695_1000150932 395
104 3300035119 Ga0373956_0009241 Ga0373956_0009241_877_2064 395
105 3300035172 Ga0373955_0067549 Ga0373955_0067549_731_1918 395
106 3300035410 Ga0373924_0039114 Ga0373924_0039114_472_1659 395
107 3300035724 Ga0373933_0001612 Ga0373933_0001612_1173_2360 395
108 3300036401 Ga0373937_0001052 Ga0373937_0001052_14121_15308 395
109 3300037068 Ga0373925_0030008 Ga0373925_0030008_287_1474 395
110 3300046454 Ga0495592_0024367 Ga0495592_0024367_844_2031 395
111 3300046459 Ga0495629_0004234 Ga0495629_0004234_8273_9460 395
112 3300046462 Ga0495651_0000606 Ga0495651_0000606_15139_16326 395
113 3300046463 Ga0495653_0002673 Ga0495653_0002673_11267_12454 395
114 3300046511 Ga0495608_0000591 Ga0495608_0000591_11267_12454 395
115 3300046514 Ga0495618_0001466 Ga0495618_0001466_5089_6276 395
116 3300046516 Ga0495628_0034908 Ga0495628_0034908_896_2083 395
117 3300046529 Ga0495652_0003497 Ga0495652_0003497_11704_12891 395
118 3300046533 Ga0495640_0002454 Ga0495640_0002454_10136_11323 395
119 3300046559 Ga0495667_0005199 Ga0495667_0005199_3582_4769 395
120 3300046642 Ga0495634_0002842 Ga0495634_0002842_11309_12496 395
121 3300046663 Ga0495635_0003751 Ga0495635_0003751_2780_3967 395
122 3300046675 Ga0495657_0003270 Ga0495657_0003270_9425_10612 395
123 3300046678 Ga0495599_0000564 Ga0495599_0000564_11127_12314 395
124 3300046679 Ga0495623_0001431 Ga0495623_0001431_13696_14883 395
125 3300046680 Ga0495646_0004951 Ga0495646_0004951_6825_8012 395
126 3300046683 Ga0495658_0047841 Ga0495658_0047841_1081_2268 395
127 3300046689 Ga0495613_0024361 Ga0495613_0024361_1040_2227 395
128 3300046809 Ga0495600_0004060 Ga0495600_0004060_5006_6193 395
129 3300047317 Ga0495604_0003818 Ga0495604_0003818_6483_7670 395
130 3300047319 Ga0495674_0024339 Ga0495674_0024339_2399_3586 395
131 3300047321 Ga0495676_0021794 Ga0495676_0021794_1550_2737 395
132 3300047322 Ga0495680_0001686 Ga0495680_0001686_14020_15207 395
133 3300047444 Ga0495675_0043639 Ga0495675_0043639_1086_2273 395
134 3300047673 Ga0495593_0024841 Ga0495593_0024841_615_1802 395
135 3300048918 Ga0496115_0011356 Ga0496115_0011356_11_1198 395
136 3300053077 Ga0495601_0062379 Ga0495601_0062379_1078_2265 395
137 3300053078 Ga0495612_0005722 Ga0495612_0005722_27_1214 395
138 3300053084 Ga0495595_0000552 Ga0495595_0000552_7830_9017 395
139 3300053085 Ga0495619_0002169 Ga0495619_0002169_8005_9192 395
140 3300054114 Ga0501084_0318694 Ga0501084_0318694_14_1201 395
141 iso_pu_bacteria 2857542790 2857543738 395
142 3300005618 Ga0068864_100397047 Ga0068864_1003970472 396
143 3300006880 Ga0075429_100090897 Ga0075429_1000908972 396
144 3300016635 Ga0183361_10004 Ga0183361_10004120 396
145 3300021388 Ga0213875_10001724 Ga0213875_1000172413 396
146 3300037471 Ga0395905_0020466 Ga0395905_0020466_510_1700 396
147 3300046459 Ga0495629_0016192 Ga0495629_0016192_411_1601 396
148 3300046471 Ga0495650_0000785 Ga0495650_0000785_23352_24542 396
149 3300046471 Ga0495650_0024992 Ga0495650_0024992_893_2083 396
150 3300046472 Ga0495580_0005139 Ga0495580_0005139_1800_2990 396
151 3300046472 Ga0495580_0008112 Ga0495580_0008112_4853_6043 396
152 3300046476 Ga0495662_0004035 Ga0495662_0004035_4152_5342 396
153 3300046516 Ga0495628_0006762 Ga0495628_0006762_1433_2623 396
154 3300046517 Ga0495630_0082783 Ga0495630_0082783_646_1836 396
155 3300046523 Ga0495644_0054212 Ga0495644_0054212_257_1447 396
156 3300046529 Ga0495652_0074599 Ga0495652_0074599_56_1246 396
157 3300046531 Ga0495665_0000077 Ga0495665_0000077_16130_17320 396
158 3300046531 Ga0495665_0048689 Ga0495665_0048689_219_1409 396
159 3300046533 Ga0495640_0014998 Ga0495640_0014998_124_1314 396
160 3300046543 Ga0495645_0001808 Ga0495645_0001808_11379_12569 396
161 3300046543 Ga0495645_0052095 Ga0495645_0052095_461_1651 396
162 3300046559 Ga0495667_0055140 Ga0495667_0055140_94_1284 396
163 3300046663 Ga0495635_0007363 Ga0495635_0007363_3843_5033 396
164 3300046674 Ga0495588_0010874 Ga0495588_0010874_1781_2971 396
165 3300046678 Ga0495599_0040896 Ga0495599_0040896_887_2077 396
166 3300046690 Ga0495624_0012093 Ga0495624_0012093_2689_3879 396
167 3300046691 Ga0495670_0045100 Ga0495670_0045100_276_1466 396
168 3300046809 Ga0495600_0023305 Ga0495600_0023305_720_1910 396
169 3300046809 Ga0495600_0161130 Ga0495600_0161130_37_1227 396
170 3300047315 Ga0495581_0012527 Ga0495581_0012527_53_1243 396
171 3300047319 Ga0495674_0050144 Ga0495674_0050144_1792_2982 396
172 3300047319 Ga0495674_0054209 Ga0495674_0054209_1377_2567 396
173 3300047319 Ga0495674_0071071 Ga0495674_0071071_777_1967 396
174 3300047319 Ga0495674_0095185 Ga0495674_0095185_1294_2484 396
175 3300047322 Ga0495680_0014417 Ga0495680_0014417_35_1225 396
176 3300047323 Ga0495683_0003703 Ga0495683_0003703_1963_3153 396
177 3300047673 Ga0495593_0004402 Ga0495593_0004402_4988_6178 396
178 3300047673 Ga0495593_0053690 Ga0495593_0053690_154_1344 396
179 3300047673 Ga0495593_0073890 Ga0495593_0073890_552_1742 396
180 3300048088 Ga0495602_0010055 Ga0495602_0010055_6917_8107 396
181 3300048088 Ga0495602_0040592 Ga0495602_0040592_1361_2551 396
182 3300048903 Ga0496100_0009694 Ga0496100_0009694_1898_3088 396
183 3300048904 Ga0496101_0002442 Ga0496101_0002442_8416_9606 396
184 3300048907 Ga0496104_0008622 Ga0496104_0008622_507_1697 396
185 3300048907 Ga0496104_0079951 Ga0496104_0079951_357_1547 396
186 3300048908 Ga0496105_0044828 Ga0496105_0044828_1831_3021 396
187 3300048908 Ga0496105_0077166 Ga0496105_0077166_118_1308 396
188 3300048910 Ga0496107_0047044 Ga0496107_0047044_498_1688 396
189 3300048913 Ga0496110_0146253 Ga0496110_0146253_708_1898 396
190 3300048916 Ga0496113_0091255 Ga0496113_0091255_1112_2302 396
191 3300048917 Ga0496114_0022087 Ga0496114_0022087_1841_3031 396
192 3300049460 Ga0495682_0011313 Ga0495682_0011313_1908_3098 396
193 3300050508 nmdc:mga09592_62227_c1 nmdc:mga09592_62227_c1_524_1714 396
194 3300005340 Ga0070689_100083403 Ga0070689_1000834032 397
195 3300005355 Ga0070671_100009995 Ga0070671_1000099955 397
196 3300005436 Ga0070713_100021485 Ga0070713_1000214852 397
197 3300005544 Ga0070686_100119027 Ga0070686_1001190272 397
198 3300005614 Ga0068856_100434536 Ga0068856_1004345361 397
199 3300005842 Ga0068858_100090730 Ga0068858_1000907302 397
200 3300006847 Ga0075431_100084799 Ga0075431_1000847992 397
201 3300006880 Ga0075429_100034093 Ga0075429_1000340932 397
202 3300009094 Ga0111539_10258460 Ga0111539_102584602 397
203 3300009098 Ga0105245_10076726 Ga0105245_100767261 397
204 3300013306 Ga0163162_10134687 Ga0163162_101346872 397
205 3300014968 Ga0157379_10241760 Ga0157379_102417602 397
206 3300025907 Ga0207645_10041379 Ga0207645_100413791 397
207 3300025925 Ga0207650_10008705 Ga0207650_100087053 397
208 3300025931 Ga0207644_10001532 Ga0207644_1000153212 397
209 3300025939 Ga0207665_10115762 Ga0207665_101157622 397
210 3300025940 Ga0207691_10150710 Ga0207691_101507101 397
211 3300026078 Ga0207702_10230451 Ga0207702_102304511 397
212 3300034957 Ga0373938_0002276 Ga0373938_0002276_829_2025 397
213 3300035114 Ga0373939_0006145 Ga0373939_0006145_1342_2538 397
214 3300035691 Ga0373931_0001976 Ga0373931_0001976_4199_5395 397
215 3300037068 Ga0373925_0172567 Ga0373925_0172567_75_1268 397
216 3300042001 Ga0439441_000696 Ga0439441_000696_2137_3330 397
217 3300042436 Ga0439435_0000065 Ga0439435_0000065_8481_9674 397
218 3300042437 Ga0439444_0000652 Ga0439444_0000652_1407_2600 397
219 3300046459 Ga0495629_0062091 Ga0495629_0062091_1181_2377 397
220 3300046473 Ga0495582_0052881 Ga0495582_0052881_68_1264 397
221 3300046516 Ga0495628_0091275 Ga0495628_0091275_1062_2258 397
222 3300046689 Ga0495613_0194635 Ga0495613_0194635_102_1298 397
223 3300047444 Ga0495675_0065342 Ga0495675_0065342_1034_2230 397
224 3300048088 Ga0495602_0097910 Ga0495602_0097910_872_2068 397
225 3300048915 Ga0496112_0004419 Ga0496112_0004419_2210_3406 397
226 3300050492 nmdc:mga0yw44_12866_c1 nmdc:mga0yw44_12866_c1_1762_2955 397
227 3300050507 nmdc:mga05p37_52813_c1 nmdc:mga05p37_52813_c1_2083_3276 397
228 3300050508 nmdc:mga09592_36309_c1 nmdc:mga09592_36309_c1_2525_3718 397
229 3300005545 Ga0070695_100102721 Ga0070695_1001027212 398
230 3300049582 Ga0501048_0081507 Ga0501048_0081507_222_1418 398
231 3300049587 Ga0501071_0081837 Ga0501071_0081837_823_2019 398
232 3300049588 Ga0501072_0042564 Ga0501072_0042564_1432_2628 398
233 3300049591 Ga0501075_0096495 Ga0501075_0096495_250_1446 398
234 3300049592 Ga0501076_0079935 Ga0501076_0079935_449_1645 398
235 3300061734 Ga0530510_0063773 Ga0530510_0063773_910_2106 398
236 3300005458 Ga0070681_10057740 Ga0070681_100577402 399
237 3300025912 Ga0207707_10012386 Ga0207707_100123863 399
238 3300035114 Ga0373939_0020826 Ga0373939_0020826_132_1331 399
239 3300048925 Ga0496122_0074114 Ga0496122_0074114_274_1485 399
240 3300048927 Ga0496124_0000007 Ga0496124_0000007_43378_44589 399
241 3300006846 Ga0075430_100007707 Ga0075430_1000077074 400
242 3300006847 Ga0075431_100043426 Ga0075431_1000434262 400
243 3300035086 Ga0373934_0011141 Ga0373934_0011141_1089_2291 400
244 3300035118 Ga0373954_0000012 Ga0373954_0000012_14617_15819 400
245 3300035172 Ga0373955_0018676 Ga0373955_0018676_1534_2736 400
246 3300036401 Ga0373937_0001834 Ga0373937_0001834_13590_14792 400
247 3300042876 Ga0451577_0044483 Ga0451577_0044483_187_1389 400
248 3300045051 Ga0451576_0006531 Ga0451576_0006531_11297_12499 400
249 3300049574 Ga0501038_0095721 Ga0501038_0095721_672_1874 400
250 3300049576 Ga0501040_0051481 Ga0501040_0051481_527_1729 400
251 3300049587 Ga0501071_0245451 Ga0501071_0245451_34_1236 400
252 3300049592 Ga0501076_0114755 Ga0501076_0114755_840_2042 400
253 3300050509 nmdc:mga0qj67_49473_c1 nmdc:mga0qj67_49473_c1_1085_2287 400
254 3300050510 nmdc:mga06r32_62949_c1 nmdc:mga06r32_62949_c1_871_2073 400
255 3300006871 Ga0075434_100024236 Ga0075434_1000242362 401
256 3300007076 Ga0075435_100041692 Ga0075435_1000416922 401
257 3300046501 Ga0495607_0031295 Ga0495607_0031295_1799_3004 401
258 3300050513 nmdc:mga0rr50_7181_c1 nmdc:mga0rr50_7181_c1_1191_2438 401
259 iso_pu_bacteria 2842333319 2842334120 402
260 3300031665 Ga0316575_10008137 Ga0316575_100081372 403
261 3300035398 Ga0316574_0001852 Ga0316574_0001852_2657_3871 403
262 3300045976 Ga0466967_0049233 Ga0466967_0049233_485_1720 403
263 3300046512 Ga0495610_0000131 Ga0495610_0000131_66323_67561 403
264 3300046522 Ga0495643_0008467 Ga0495643_0008467_2896_4134 403
265 3300006051 Ga0075364_10031765 Ga0075364_100317652 410
266 3300050491 nmdc:mga00v17_19188_c1 nmdc:mga00v17_19188_c1_1083_2333 410
267 3300005330 Ga0070690_100000321 Ga0070690_10000032122 422
268 3300005334 Ga0068869_100000861 Ga0068869_10000086117 422
269 3300005336 Ga0070680_100000425 Ga0070680_10000042515 422
270 3300005337 Ga0070682_100004549 Ga0070682_1000045493 422
271 3300005338 Ga0068868_100000641 Ga0068868_10000064117 422
272 3300005340 Ga0070689_100000304 Ga0070689_10000030422 422
273 3300005343 Ga0070687_100000066 Ga0070687_10000006620 422
274 3300005355 Ga0070671_100076683 Ga0070671_1000766833 422
275 3300005364 Ga0070673_100073225 Ga0070673_1000732252 422
276 3300005440 Ga0070705_100000090 Ga0070705_10000009025 422
277 3300005441 Ga0070700_100000660 Ga0070700_1000006603 422
278 3300005444 Ga0070694_100000122 Ga0070694_10000012224 422
279 3300005459 Ga0068867_100001566 Ga0068867_10000156613 422
280 3300005530 Ga0070679_100019308 Ga0070679_1000193083 422
281 3300005544 Ga0070686_100000292 Ga0070686_10000029221 422
282 3300005545 Ga0070695_100000095 Ga0070695_10000009515 422
283 3300005546 Ga0070696_100000133 Ga0070696_10000013319 422
284 3300005547 Ga0070693_100000075 Ga0070693_10000007523 422
285 3300005549 Ga0070704_100000230 Ga0070704_10000023021 422
286 3300005563 Ga0068855_100001022 Ga0068855_10000102227 422
287 3300005578 Ga0068854_100002816 Ga0068854_1000028167 422
288 3300005614 Ga0068856_100007808 Ga0068856_1000078088 422
289 3300005615 Ga0070702_100000043 Ga0070702_10000004317 422
290 3300005616 Ga0068852_100078376 Ga0068852_1000783762 422
291 3300005617 Ga0068859_100001771 Ga0068859_10000177114 422
292 3300005718 Ga0068866_10000104 Ga0068866_100001043 422
293 3300005719 Ga0068861_100000193 Ga0068861_10000019320 422
294 3300005842 Ga0068858_100001082 Ga0068858_1000010826 422
295 3300005843 Ga0068860_100002214 Ga0068860_1000022144 422
296 3300005844 Ga0068862_100001697 Ga0068862_1000016974 422
297 3300006237 Ga0097621_100000248 Ga0097621_1000002485 422
298 3300006358 Ga0068871_100000205 Ga0068871_10000020521 422
299 3300006881 Ga0068865_100000833 Ga0068865_1000008334 422
300 3300006931 Ga0097620_100001771 Ga0097620_10000177114 422
301 3300009098 Ga0105245_10000478 Ga0105245_1000047823 422
302 3300009148 Ga0105243_10000413 Ga0105243_1000041327 422
303 3300009174 Ga0105241_10026014 Ga0105241_100260142 422
304 3300009176 Ga0105242_10000394 Ga0105242_1000039416 422
305 3300009177 Ga0105248_10065191 Ga0105248_100651913 422
306 3300009553 Ga0105249_10002974 Ga0105249_1000297417 422
307 3300010375 Ga0105239_10035354 Ga0105239_100353542 422
308 3300013102 Ga0157371_10163720 Ga0157371_101637202 422
309 3300013297 Ga0157378_10000543 Ga0157378_1000054322 422
310 3300014968 Ga0157379_10051314 Ga0157379_100513142 422
311 3300014969 Ga0157376_10019994 Ga0157376_100199944 422
312 3300025885 Ga0207653_10031821 Ga0207653_100318212 422
313 3300025899 Ga0207642_10005973 Ga0207642_100059733 422
314 3300025911 Ga0207654_10012917 Ga0207654_100129172 422
315 3300025917 Ga0207660_10001853 Ga0207660_100018532 422
316 3300025918 Ga0207662_10000113 Ga0207662_1000011321 422
317 3300025921 Ga0207652_10010553 Ga0207652_100105535 422
318 3300025927 Ga0207687_10000273 Ga0207687_1000027315 422
319 3300025931 Ga0207644_10058032 Ga0207644_100580323 422
320 3300025934 Ga0207686_10000675 Ga0207686_1000067510 422
321 3300025935 Ga0207709_10001300 Ga0207709_1000130013 422
322 3300025936 Ga0207670_10000407 Ga0207670_1000040710 422
323 3300025938 Ga0207704_10000625 Ga0207704_100006253 422
324 3300025942 Ga0207689_10000554 Ga0207689_1000055422 422
325 3300025949 Ga0207667_10005883 Ga0207667_1000588316 422
326 3300025960 Ga0207651_10165245 Ga0207651_101652452 422
327 3300025981 Ga0207640_10001066 Ga0207640_100010663 422
328 3300026023 Ga0207677_10000391 Ga0207677_1000039114 422
329 3300026035 Ga0207703_10008177 Ga0207703_100081778 422
330 3300026075 Ga0207708_10000505 Ga0207708_100005053 422
331 3300026078 Ga0207702_10020045 Ga0207702_100200453 422
332 3300026088 Ga0207641_10144898 Ga0207641_101448982 422
333 3300026089 Ga0207648_10000548 Ga0207648_1000054818 422
334 3300026118 Ga0207675_100000305 Ga0207675_10000030526 422
335 3300026142 Ga0207698_10057751 Ga0207698_100577512 422
336 3300028380 Ga0268265_10001208 Ga0268265_100012086 422
337 3300028381 Ga0268264_10000882 Ga0268264_1000088216 422
338 3300035691 Ga0373931_0007271 Ga0373931_0007271_2016_3284 422
339 3300035691 Ga0373931_0014631 Ga0373931_0014631_1332_2600 422

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02515

CoA_transf_3

CoA-transferase family III

11

379

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
6j39-assembly1.cif.gz_A crystal structure of cmis2 with inhibitor 0.7668 14 43
6j38-assembly1.cif.gz_B-2 crystal structure of cmis2 0.7634 14 43
3nrn-assembly1.cif.gz_A crystal structure of pf1083 protein from pyrococcus furiosus, northeast structural genomics consortium target pfr223 0.7177 14 44
2q7x-assembly1.cif.gz_B crystal structure of a putative phospho transferase (sp_1565) from streptococcus pneumoniae tigr4 at 2.00 a resolution 0.6994 14 44
1ijh-assembly1.cif.gz_A cholesterol oxidase from streptomyces asn485leu mutant 0.6843 14 43
ID Description Score Start End Superfamily
4ed9A01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Crotonobetainyl-coa:carnitine coa-transferase; domain 1 0.9217 8 234 3.40.50.10540
af_Q4V9F2_1_227_3.40.50.10540 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Crotonobetainyl-coa:carnitine coa-transferase; domain 1 0.9098 31 245 3.40.50.10540
af_Q68FU4_261_348_3.30.1540.10 Alpha Beta;2-Layer Sandwich;formyl-coa transferase, domain 3;formyl-coa transferase, domain 3 0.8879 238 322 3.30.1540.10
1x74D01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Crotonobetainyl-coa:carnitine coa-transferase; domain 1 0.8835 14 203 3.40.50.10540
4hl6E02 Alpha Beta;2-Layer Sandwich;formyl-coa transferase, domain 3;formyl-coa transferase, domain 3 0.8807 238 325 3.30.1540.10
ID Description Score Start End GO Terms
AF-A0A355S0Y2-F1-model_v4 CoA transferase 0.9476 6 196 GO:0008410
AF-A0A382RFY1-F1-model_v4 Carnitine dehydratase 0.9459 11 228 GO:0008410
AF-A0A316PNQ3-F1-model_v4 CoA transferase 0.9456 8 148 GO:0008410
AF-W7WZJ6-F1-model_v4 deleted 0.9447 11 183
AF-A0A355S0Y2-F1-model_v4 CoA transferase 0.9428 6 196 GO:0008410

Feature Viewer

pLDDT pTM Quality
86.48 0.83 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map