F413723

General Info

Members Datasets Scaffolds Average Seq Length
338 229 676 178

Family's Representative Sequence

Representative Sequence 3300050512|nmdc:mga0n895_754961_c1|nmdc:mga0n895_754961_c1_132_740
Length 202
Sequence MPRLRARSRHLKNFPATLASVARKQGVDGGDIEIWFGDEARIGQKNKITRRWARRGTRPSAPQDLRTASAYIFGAICPAEGKAVGLILPWCNTEAMNLQLAAISAKVAPGRHAVLLLDQAGWHLTPQLDVPANISIVPLPAKCPELNPQENVWEFMRDNWLSNRIFTCYENLVDHCCHAWNKLVQQPWTVMSIGLRDWAHGF

Samples

Sample ID Description Type Environment
1 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
2 3300000532 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA_Illumina_Assembled Metagenome Rhizosphere
3 3300000545 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNX_Illumina_Assembled Metagenome Rhizosphere
4 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
5 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
6 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
7 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
8 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
9 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
10 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
11 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
19 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
26 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
27 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
28 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
29 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
30 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
36 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
37 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
38 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
39 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
40 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
41 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
42 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
43 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
44 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
45 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
46 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
47 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
48 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
49 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
50 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
51 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
52 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
53 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
54 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
55 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
56 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
57 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
58 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
59 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
60 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
61 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
62 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
63 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
65 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
66 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
68 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
69 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
70 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
71 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
72 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
73 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
74 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
75 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
76 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
77 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
78 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
79 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
80 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
81 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
82 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
83 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
84 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
85 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
86 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
87 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
88 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
89 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
90 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
91 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
92 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
93 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
94 3300025223 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
96 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
136 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300030879 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
139 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
140 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
141 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
142 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
143 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
144 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
145 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
146 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
147 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
148 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
149 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
150 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
151 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
152 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
153 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
154 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
155 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
156 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
157 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
158 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
159 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
160 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
161 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
162 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
163 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
164 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
165 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
166 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
167 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
168 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
169 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
170 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
171 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
172 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
173 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
174 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
175 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
176 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
177 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
178 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
179 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
180 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
181 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
182 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
183 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
184 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
185 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
186 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
187 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
188 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
189 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
190 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
191 3300049551 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
192 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
193 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
194 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
195 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
196 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
197 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
198 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
199 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
200 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
201 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
202 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
203 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
204 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
205 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
206 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
207 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
208 3300049684 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_B_3_control Metagenome Rhizosphere
209 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
210 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
211 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
212 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
213 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
214 3300049768 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought Metagenome Rhizosphere
215 3300049771 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_B_4_control Metagenome Rhizosphere
216 3300049773 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_B_4_control Metagenome Rhizosphere
217 3300049777 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control Metagenome Rhizosphere
218 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
219 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
220 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
221 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
222 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
223 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
224 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
225 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
226 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
227 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
228 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
229 643348564 Methylobacterium nodulans ORS 2060 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 98.52
Metatranscriptomes 0.89
Isolates 0.59

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.89
Nodule 0.3
Rhizoplane 1.48
Rhizosphere 88.76
Stem 0
Stem Tuber 0
Unclassified 0.3

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga0n895_754961_c1 3300050512 Bacteria 966
2 CNAas_1004885 3300000532 Bacteria 861
3 CNXas_1003372 3300000545 Bacteria 1127
4 LJQas_1015084 3300000549 Bacteria 906
5 JGI24752J21851_1010955 3300001976 Bacteria 1184
6 JGI24750J21931_1010446 3300002070 Bacteria 1210
7 JGI24745J21846_1008219 3300002073 Bacteria 1173
8 JGI24745J21846_1012969 3300002073 Bacteria 959
9 JGI24745J21846_1013293 3300002073 Bacteria 948
10 JGI24748J21848_1006077 3300002074 Bacteria 1406
11 JGI24738J21930_10004848 3300002075 Bacteria 3267
12 JGI24738J21930_10027172 3300002075 Bacteria 1173
13 JGI24035J26624_1005041 3300002126 Bacteria 1258
14 JGI24034J26672_10001983 3300002239 Bacteria 2773
15 JGI24034J26672_10004817 3300002239 Bacteria 1921
16 Ga0070683_100507290 3300005329 Bacteria 1152
17 Ga0070683_100693519 3300005329 Bacteria 975
18 Ga0070670_101154852 3300005331 Bacteria 707
19 Ga0070682_100295540 3300005337 Bacteria 1186
20 Ga0068868_100124667 3300005338 Bacteria 2103
21 Ga0068868_100260188 3300005338 Bacteria 1463
22 Ga0068868_100317485 3300005338 Bacteria 1326
23 Ga0068868_100366092 3300005338 Bacteria 1238
24 Ga0070660_100817563 3300005339 Bacteria 784
25 Ga0070689_100421786 3300005340 Bacteria 1131
26 Ga0070691_10279350 3300005341 Bacteria 905
27 Ga0070692_10200747 3300005345 Bacteria 1168
28 Ga0070668_100214599 3300005347 Bacteria 1584
29 Ga0070668_100580625 3300005347 Bacteria 978
30 Ga0070671_100332351 3300005355 Bacteria 1295
31 Ga0070671_100754320 3300005355 Bacteria 846
32 Ga0070688_100423279 3300005365 Bacteria 990
33 Ga0070659_100425204 3300005366 Bacteria 1124
34 Ga0070667_100234644 3300005367 Bacteria 1637
35 Ga0070709_10478138 3300005434 Bacteria 943
36 Ga0070714_100711060 3300005435 Bacteria 970
37 Ga0070710_10104016 3300005437 Bacteria 1695
38 Ga0070710_10180352 3300005437 Bacteria 1322
39 Ga0070711_100038043 3300005439 Bacteria 3232
40 Ga0070711_100075078 3300005439 Bacteria 2392
41 Ga0070700_100282578 3300005441 Bacteria 1204
42 Ga0070663_100223298 3300005455 Bacteria 1480
43 Ga0070678_100317742 3300005456 Bacteria 1329
44 Ga0070678_100351077 3300005456 Bacteria 1268
45 Ga0070662_100079608 3300005457 Bacteria 2437
46 Ga0070662_100120114 3300005457 Bacteria 2013
47 Ga0070662_100259584 3300005457 Bacteria 1399
48 Ga0070662_100371603 3300005457 Bacteria 1175
49 Ga0070662_100900013 3300005457 Bacteria 755
50 Ga0068867_101189092 3300005459 Bacteria 700
51 Ga0070679_100507368 3300005530 Bacteria 1150
52 Ga0070684_100347083 3300005535 Bacteria 1365
53 Ga0068853_100293318 3300005539 Bacteria 1502
54 Ga0070686_100243344 3300005544 Bacteria 1311
55 Ga0070686_100863953 3300005544 Bacteria 733
56 Ga0070693_100156951 3300005547 Bacteria 1446
57 Ga0070665_100125663 3300005548 Bacteria 2567
58 Ga0070665_100296814 3300005548 Bacteria 1618
59 Ga0070665_101061359 3300005548 Bacteria 822
60 Ga0068855_100567287 3300005563 Bacteria 1227
61 Ga0070664_100370304 3300005564 Bacteria 1306
62 Ga0068854_100141885 3300005578 Bacteria 1844
63 Ga0068856_100409809 3300005614 Bacteria 1375
64 Ga0068856_100421999 3300005614 Bacteria 1354
65 Ga0070702_100031266 3300005615 Bacteria 2910
66 Ga0070702_100298375 3300005615 Bacteria 1114
67 Ga0068852_100456961 3300005616 Bacteria 1265
68 Ga0068859_100393051 3300005617 Bacteria 1482
69 Ga0068864_100187689 3300005618 Bacteria 1893
70 Ga0068864_100331651 3300005618 Bacteria 1432
71 Ga0068864_100474370 3300005618 Bacteria 1200
72 Ga0068866_10263261 3300005718 Bacteria 1061
73 Ga0068861_100221504 3300005719 Bacteria 1599
74 Ga0068861_100410100 3300005719 Bacteria 1205
75 Ga0068851_10448770 3300005834 Bacteria 766
76 Ga0068863_100694323 3300005841 Bacteria 1011
77 Ga0068858_100231631 3300005842 Bacteria 1751
78 Ga0068858_100261916 3300005842 Bacteria 1644
79 Ga0068858_100556340 3300005842 Bacteria 1111
80 Ga0068860_100938575 3300005843 Bacteria 882
81 Ga0068862_100550627 3300005844 Bacteria 1101
82 Ga0081540_1097130 3300005983 Bacteria 1279
83 Ga0075432_10074079 3300006058 Bacteria 1226
84 Ga0075432_10137891 3300006058 Bacteria 929
85 Ga0070715_10084009 3300006163 Bacteria 1451
86 Ga0070716_100202014 3300006173 Bacteria 1322
87 Ga0070712_100189514 3300006175 Bacteria 1608
88 Ga0075367_10472279 3300006178 Bacteria 795
89 Ga0075434_100384474 3300006871 Bacteria 1424
90 Ga0075436_100188854 3300006914 Bacteria 1457
91 Ga0097620_100393057 3300006931 Bacteria 1482
92 Ga0099795_10073511 3300007788 Bacteria 1294
93 Ga0105240_10150796 3300009093 Bacteria 2769
94 Ga0105240_10389871 3300009093 Bacteria 1571
95 Ga0105240_11049583 3300009093 Bacteria 869
96 Ga0111539_11269602 3300009094 Bacteria 855
97 Ga0105245_10400082 3300009098 Bacteria 1372
98 Ga0105245_10415368 3300009098 Bacteria 1347
99 Ga0105245_10429119 3300009098 Bacteria 1326
100 Ga0105245_10551128 3300009098 Bacteria 1175
101 Ga0105247_10197047 3300009101 Bacteria 1351
102 Ga0105241_10811461 3300009174 Bacteria 863
103 Ga0105242_10200597 3300009176 Bacteria 1772
104 Ga0105242_10685425 3300009176 Bacteria 1001
105 Ga0105248_10478606 3300009177 Bacteria 1403
106 Ga0105238_10441300 3300009551 Bacteria 1298
107 Ga0105238_10610493 3300009551 Bacteria 1099
108 Ga0105249_10252429 3300009553 Bacteria 1749
109 Ga0105249_10404685 3300009553 Bacteria 1396
110 Ga0099796_10079069 3300010159 Bacteria 1202
111 Ga0105239_10883466 3300010375 Bacteria 1026
112 Ga0105239_11030894 3300010375 Bacteria 946
113 Ga0105246_10262769 3300011119 Bacteria 1376
114 Ga0157374_10672470 3300013296 Bacteria 1048
115 Ga0157374_10748546 3300013296 Bacteria 992
116 Ga0157378_10417274 3300013297 Bacteria 1326
117 Ga0163162_10102210 3300013306 Bacteria 2959
118 Ga0163162_10207914 3300013306 Bacteria 2086
119 Ga0163162_10482129 3300013306 Bacteria 1372
120 Ga0163162_10563205 3300013306 Bacteria 1267
121 Ga0163162_10689347 3300013306 Bacteria 1144
122 Ga0163162_11532169 3300013306 Bacteria 760
123 Ga0157375_10549924 3300013308 Bacteria 1316
124 Ga0163163_10174703 3300014325 Bacteria 2195
125 Ga0163163_10444264 3300014325 Bacteria 1357
126 Ga0157380_10374710 3300014326 Bacteria 1341
127 Ga0182008_10123103 3300014497 Bacteria 1289
128 Ga0182008_10425920 3300014497 Bacteria 717
129 Ga0157377_10247821 3300014745 Bacteria 1153
130 Ga0157379_10847412 3300014968 Bacteria 865
131 Ga0157376_10356282 3300014969 Bacteria 1402
132 Ga0163161_10641406 3300017792 Bacteria 879
133 Ga0213873_10005715 3300021358 Bacteria 2403
134 Ga0213873_10031300 3300021358 Bacteria 1322
135 Ga0213874_10051202 3300021377 Bacteria 1267
136 Ga0213876_10093120 3300021384 Bacteria 1596
137 Ga0213876_10129005 3300021384 Bacteria 1343
138 Ga0213875_10105893 3300021388 Bacteria 1313
139 Ga0213871_10031331 3300021441 Unclassified 1388
140 Ga0213871_10037271 3300021441 Bacteria 1293
141 Ga0213871_10039169 3300021441 Bacteria 1268
142 Ga0213871_10054771 3300021441 Bacteria 1100
143 Ga0224572_1031888 3300024225 Bacteria 1004
144 Ga0207672_1001830 3300025223 Bacteria 1437
145 Ga0207673_1009013 3300025290 Bacteria 1270
146 Ga0207696_1046955 3300025711 Bacteria 1245
147 Ga0207692_10064341 3300025898 Bacteria 1909
148 Ga0207692_10334039 3300025898 Bacteria 930
149 Ga0207710_10128703 3300025900 Bacteria 1215
150 Ga0207688_10042437 3300025901 Bacteria 2532
151 Ga0207688_10161803 3300025901 Bacteria 1327
152 Ga0207685_10100296 3300025905 Bacteria 1237
153 Ga0207643_10027435 3300025908 Bacteria 3157
154 Ga0207695_10288966 3300025913 Bacteria 1532
155 Ga0207695_10349690 3300025913 Bacteria 1365
156 Ga0207693_10274541 3300025915 Bacteria 1321
157 Ga0207663_10859389 3300025916 Bacteria 724
158 Ga0207657_10106312 3300025919 Bacteria 2322
159 Ga0207652_10418625 3300025921 Bacteria 1208
160 Ga0207650_10362533 3300025925 Bacteria 1194
161 Ga0207650_10563707 3300025925 Bacteria 956
162 Ga0207659_10588086 3300025926 Bacteria 948
163 Ga0207687_10306349 3300025927 Bacteria 1281
164 Ga0207687_10362957 3300025927 Bacteria 1183
165 Ga0207687_10606311 3300025927 Bacteria 923
166 Ga0207687_11330160 3300025927 Bacteria 618
167 Ga0207700_10106331 3300025928 Bacteria 2249
168 Ga0207700_11401722 3300025928 Bacteria 621
169 Ga0207644_10267596 3300025931 Bacteria 1368
170 Ga0207690_10350077 3300025932 Bacteria 1168
171 Ga0207706_10126994 3300025933 Bacteria 2243
172 Ga0207706_10340654 3300025933 Bacteria 1304
173 Ga0207706_10549786 3300025933 Bacteria 994
174 Ga0207686_10517221 3300025934 Bacteria 928
175 Ga0207669_10249513 3300025937 Bacteria 1321
176 Ga0207665_10189115 3300025939 Bacteria 1495
177 Ga0207691_10253047 3300025940 Bacteria 1520
178 Ga0207711_10138032 3300025941 Bacteria 2191
179 Ga0207711_10415173 3300025941 Bacteria 1251
180 Ga0207661_10486791 3300025944 Bacteria 1126
181 Ga0207661_10764351 3300025944 Bacteria 889
182 Ga0207679_10323499 3300025945 Bacteria 1336
183 Ga0207712_10338658 3300025961 Bacteria 1247
184 Ga0207712_10437529 3300025961 Bacteria 1107
185 Ga0207668_10326241 3300025972 Bacteria 1275
186 Ga0207668_10465630 3300025972 Bacteria 1081
187 Ga0207640_10300109 3300025981 Bacteria 1270
188 Ga0207658_10330022 3300025986 Bacteria 1323
189 Ga0207658_10431692 3300025986 Bacteria 1163
190 Ga0207677_10326207 3300026023 Bacteria 1278
191 Ga0207677_10367509 3300026023 Bacteria 1210
192 Ga0207677_11542339 3300026023 Bacteria 614
193 Ga0207639_10386545 3300026041 Bacteria 1258
194 Ga0207678_10086454 3300026067 Bacteria 2680
195 Ga0207678_10272240 3300026067 Bacteria 1452
196 Ga0207708_10211977 3300026075 Bacteria 1549
197 Ga0207708_10231834 3300026075 Bacteria 1482
198 Ga0207708_10363948 3300026075 Bacteria 1189
199 Ga0207702_10540434 3300026078 Bacteria 1139
200 Ga0207641_10258091 3300026088 Bacteria 1631
201 Ga0207641_10665573 3300026088 Bacteria 1023
202 Ga0207648_10367841 3300026089 Bacteria 1298
203 Ga0207676_10377514 3300026095 Bacteria 1318
204 Ga0207676_10382801 3300026095 Bacteria 1310
205 Ga0207675_100375525 3300026118 Bacteria 1397
206 Ga0207675_100565885 3300026118 Bacteria 1137
207 Ga0207675_100777461 3300026118 Bacteria 970
208 Ga0207683_10351671 3300026121 Bacteria 1352
209 Ga0207683_10641405 3300026121 Bacteria 984
210 Ga0207428_10241977 3300027907 Bacteria 1348
211 Ga0207428_10584346 3300027907 Bacteria 806
212 Ga0268266_10343252 3300028379 Bacteria 1402
213 Ga0268266_10461471 3300028379 Bacteria 1208
214 Ga0268265_10143954 3300028380 Bacteria 1999
215 Ga0265765_1004681 3300030879 Bacteria 1414
216 Ga0265760_10050601 3300031090 Bacteria 1251
217 Ga0307409_100411208 3300031995 Bacteria 1295
218 Ga0316583_10055413 3300032133 Bacteria 1394
219 Ga0316580_10167772 3300032139 Bacteria 674
220 Ga0373940_0048265 3300035088 Bacteria 1189
221 Ga0373935_0702988 3300035692 Bacteria 743
222 Ga0373947_0179547 3300035725 Bacteria 1377
223 Ga0316584_0474134 3300036712 Bacteria 882
224 Ga0373925_0196382 3300037068 Bacteria 1603
225 Ga0373925_0336273 3300037068 Bacteria 1224
226 Ga0436364_0177775 3300037853 Bacteria 1373
227 Ga0436364_0260302 3300037853 Bacteria 1011
228 Ga0436364_0554934 3300037853 Bacteria 1518
229 Ga0436364_0723869 3300037853 Bacteria 1558
230 Ga0436364_1387370 3300037853 Bacteria 1626
231 Ga0400490_08964 3300038726 Bacteria 1396
232 Ga0400486_28385 3300038742 Bacteria 1240
233 Ga0400483_073388 3300039062 Bacteria 1606
234 Ga0400483_227953 3300039062 Bacteria 1874
235 Ga0400487_56125 3300039110 Bacteria 1316
236 Ga0436365_0388226 3300039437 Bacteria 1325
237 Ga0436365_0483598 3300039437 Bacteria 1783
238 Ga0436365_0691021 3300039437 Bacteria 2405
239 Ga0436365_0853038 3300039437 Bacteria 4246
240 Ga0436365_1340426 3300039437 Bacteria 1998
241 Ga0436365_1343754 3300039437 Bacteria 1462
242 Ga0436365_1678266 3300039437 Bacteria 1380
243 Ga0436360_0222875 3300039438 Bacteria 1519
244 Ga0436360_0282390 3300039438 Bacteria 1623
245 Ga0436360_0329531 3300039438 Bacteria 1954
246 Ga0436360_0383181 3300039438 Bacteria 832
247 Ga0436360_0850438 3300039438 Bacteria 1445
248 Ga0436360_0869707 3300039438 Bacteria 724
249 Ga0436360_1256657 3300039438 Bacteria 852
250 Ga0436361_0315912 3300039447 Bacteria 2555
251 Ga0436361_0571990 3300039447 Bacteria 2142
252 Ga0436361_0858689 3300039447 Bacteria 821
253 Ga0436363_0330532 3300039450 Bacteria 1417
254 Ga0436363_0472451 3300039450 Bacteria 870
255 Ga0436363_0807058 3300039450 Bacteria 1346
256 Ga0436363_1524747 3300039450 Bacteria 833
257 Ga0436363_1689538 3300039450 Bacteria 874
258 Ga0436362_0092909 3300039453 Bacteria 2280
259 Ga0436362_0186782 3300039453 Bacteria 1155
260 Ga0436362_0658709 3300039453 Bacteria 711
261 Ga0436362_0666194 3300039453 Bacteria 1555
262 Ga0436362_0814070 3300039453 Bacteria 1433
263 Ga0436362_1195581 3300039453 Bacteria 679
264 Ga0466971_0159085 3300044719 Bacteria 1057
265 Ga0466958_0035842 3300045836 Bacteria 2965
266 Ga0466958_0802262 3300045836 Bacteria 614
267 Ga0466967_0366288 3300045976 Bacteria 1397
268 Ga0466967_0486622 3300045976 Bacteria 1209
269 Ga0495591_032257 3300046458 Bacteria 1561
270 Ga0495605_0058304 3300046474 Bacteria 1856
271 Ga0495639_0353618 3300046475 Bacteria 738
272 Ga0495585_0218514 3300046492 Bacteria 962
273 Ga0495607_0278008 3300046501 Bacteria 795
274 Ga0495610_0203357 3300046512 Bacteria 809
275 Ga0495620_0226146 3300046515 Bacteria 715
276 Ga0495632_0107926 3300046519 Bacteria 1308
277 Ga0495598_0057374 3300046537 Bacteria 1191
278 Ga0495597_0107125 3300046542 Bacteria 1174
279 Ga0495611_0233014 3300046648 Bacteria 855
280 Ga0495623_0158743 3300046679 Bacteria 1331
281 Ga0495670_0432182 3300046691 Bacteria 712
282 Ga0495671_0308599 3300046692 Bacteria 760
283 Ga0495649_0172108 3300046694 Bacteria 1132
284 Ga0495660_0130431 3300046810 Bacteria 1261
285 Ga0495677_0061610 3300047445 Bacteria 1391
286 Ga0495679_052977 3300047446 Bacteria 1212
287 Ga0495679_093005 3300047446 Bacteria 844
288 Ga0495673_0193757 3300047469 Bacteria 763
289 Ga0495615_0116633 3300048090 Bacteria 768
290 Ga0495626_0099987 3300048091 Bacteria 1265
291 Ga0496101_0785884 3300048904 Bacteria 751
292 Ga0496106_0491299 3300048909 Bacteria 986
293 Ga0496108_0683714 3300048911 Bacteria 890
294 Ga0496110_0635680 3300048913 Bacteria 966
295 Ga0496111_0710583 3300048914 Bacteria 730
296 Ga0496124_0051694 3300048927 Bacteria 3494
297 Ga0496126_0826674 3300048929 Bacteria 708
298 Ga0495678_029465 3300049459 Bacteria 2304
299 Ga0501290_003179 3300049513 Bacteria 2083
300 Ga0501335_003144 3300049551 Bacteria 1384
301 Ga0501031_0144139 3300049568 Bacteria 1556
302 Ga0501032_0203602 3300049569 Bacteria 1291
303 Ga0501033_0147972 3300049570 Bacteria 1695
304 Ga0501036_0511969 3300049572 Bacteria 998
305 Ga0501037_0410014 3300049573 Bacteria 928
306 Ga0501038_0752039 3300049574 Bacteria 727
307 Ga0501039_0990194 3300049575 Bacteria 653
308 Ga0501043_0212625 3300049579 Bacteria 1498
309 Ga0501046_0202834 3300049580 Bacteria 1475
310 Ga0501047_0140864 3300049581 Bacteria 2290
311 Ga0501073_0421983 3300049589 Bacteria 922
312 Ga0501206_001991 3300049653 Bacteria 2573
313 Ga0501223_054628 3300049663 Bacteria 776
314 Ga0501235_001060 3300049669 Bacteria 5732
315 Ga0501236_003705 3300049670 Bacteria 1791
316 Ga0501243_006902 3300049675 Bacteria 1728
317 Ga0501255_001451 3300049684 Bacteria 1915
318 Ga0501221_020742 3300049704 Bacteria 1287
319 Ga0501225_0031924 3300049705 Bacteria 1449
320 Ga0501245_002110 3300049708 Bacteria 2638
321 Ga0501080_0478431 3300049742 Bacteria 1114
322 Ga0501264_003397 3300049761 Bacteria 1451
323 Ga0501271_009257 3300049768 Bacteria 1023
324 Ga0501274_007690 3300049771 Bacteria 953
325 Ga0501276_005263 3300049773 Bacteria 991
326 Ga0501281_03114 3300049777 Bacteria 1189
327 Ga0501282_006584 3300049778 Bacteria 1241
328 Ga0501044_0074463 3300049823 Bacteria 3449
329 nmdc:mga06z11_568969_c1 3300050494 Bacteria 689
330 nmdc:mga08y16_917480_c1 3300050511 Bacteria 861
331 nmdc:mga08x19_95785_c1 3300050514 Bacteria 1964
332 Ga0495601_0202905 3300053077 Bacteria 1295
333 Ga0495655_0066775 3300053083 Bacteria 995
334 Ga0495595_0024704 3300053084 Bacteria 2655
335 Ga0500559_0006773 3300053136 Bacteria 5144
336 Ga0501082_0455559 3300060353 Bacteria 1118
337 2923561245 2923556063 Bacteria 6793593
338 643663224 643348564 Bacteria 8839022
339 nmdc:mga0n895_754961_c1
340 CNAas_1004885
341 CNXas_1003372
342 LJQas_1015084
343 JGI24752J21851_1010955
344 JGI24750J21931_1010446
345 JGI24745J21846_1008219
346 JGI24745J21846_1012969
347 JGI24745J21846_1013293
348 JGI24748J21848_1006077
349 JGI24738J21930_10004848
350 JGI24738J21930_10027172
351 JGI24035J26624_1005041
352 JGI24034J26672_10001983
353 JGI24034J26672_10004817
354 Ga0070683_100507290
355 Ga0070683_100693519
356 Ga0070670_101154852
357 Ga0070682_100295540
358 Ga0068868_100124667
359 Ga0068868_100260188
360 Ga0068868_100317485
361 Ga0068868_100366092
362 Ga0070660_100817563
363 Ga0070689_100421786
364 Ga0070691_10279350
365 Ga0070692_10200747
366 Ga0070668_100214599
367 Ga0070668_100580625
368 Ga0070671_100332351
369 Ga0070671_100754320
370 Ga0070688_100423279
371 Ga0070659_100425204
372 Ga0070667_100234644
373 Ga0070709_10478138
374 Ga0070714_100711060
375 Ga0070710_10104016
376 Ga0070710_10180352
377 Ga0070711_100038043
378 Ga0070711_100075078
379 Ga0070700_100282578
380 Ga0070663_100223298
381 Ga0070678_100317742
382 Ga0070678_100351077
383 Ga0070662_100079608
384 Ga0070662_100120114
385 Ga0070662_100259584
386 Ga0070662_100371603
387 Ga0070662_100900013
388 Ga0068867_101189092
389 Ga0070679_100507368
390 Ga0070684_100347083
391 Ga0068853_100293318
392 Ga0070686_100243344
393 Ga0070686_100863953
394 Ga0070693_100156951
395 Ga0070665_100125663
396 Ga0070665_100296814
397 Ga0070665_101061359
398 Ga0068855_100567287
399 Ga0070664_100370304
400 Ga0068854_100141885
401 Ga0068856_100409809
402 Ga0068856_100421999
403 Ga0070702_100031266
404 Ga0070702_100298375
405 Ga0068852_100456961
406 Ga0068859_100393051
407 Ga0068864_100187689
408 Ga0068864_100331651
409 Ga0068864_100474370
410 Ga0068866_10263261
411 Ga0068861_100221504
412 Ga0068861_100410100
413 Ga0068851_10448770
414 Ga0068863_100694323
415 Ga0068858_100231631
416 Ga0068858_100261916
417 Ga0068858_100556340
418 Ga0068860_100938575
419 Ga0068862_100550627
420 Ga0081540_1097130
421 Ga0075432_10074079
422 Ga0075432_10137891
423 Ga0070715_10084009
424 Ga0070716_100202014
425 Ga0070712_100189514
426 Ga0075367_10472279
427 Ga0075434_100384474
428 Ga0075436_100188854
429 Ga0097620_100393057
430 Ga0099795_10073511
431 Ga0105240_10150796
432 Ga0105240_10389871
433 Ga0105240_11049583
434 Ga0111539_11269602
435 Ga0105245_10400082
436 Ga0105245_10415368
437 Ga0105245_10429119
438 Ga0105245_10551128
439 Ga0105247_10197047
440 Ga0105241_10811461
441 Ga0105242_10200597
442 Ga0105242_10685425
443 Ga0105248_10478606
444 Ga0105238_10441300
445 Ga0105238_10610493
446 Ga0105249_10252429
447 Ga0105249_10404685
448 Ga0099796_10079069
449 Ga0105239_10883466
450 Ga0105239_11030894
451 Ga0105246_10262769
452 Ga0157374_10672470
453 Ga0157374_10748546
454 Ga0157378_10417274
455 Ga0163162_10102210
456 Ga0163162_10207914
457 Ga0163162_10482129
458 Ga0163162_10563205
459 Ga0163162_10689347
460 Ga0163162_11532169
461 Ga0157375_10549924
462 Ga0163163_10174703
463 Ga0163163_10444264
464 Ga0157380_10374710
465 Ga0182008_10123103
466 Ga0182008_10425920
467 Ga0157377_10247821
468 Ga0157379_10847412
469 Ga0157376_10356282
470 Ga0163161_10641406
471 Ga0213873_10005715
472 Ga0213873_10031300
473 Ga0213874_10051202
474 Ga0213876_10093120
475 Ga0213876_10129005
476 Ga0213875_10105893
477 Ga0213871_10031331
478 Ga0213871_10037271
479 Ga0213871_10039169
480 Ga0213871_10054771
481 Ga0224572_1031888
482 Ga0207672_1001830
483 Ga0207673_1009013
484 Ga0207696_1046955
485 Ga0207692_10064341
486 Ga0207692_10334039
487 Ga0207710_10128703
488 Ga0207688_10042437
489 Ga0207688_10161803
490 Ga0207685_10100296
491 Ga0207643_10027435
492 Ga0207695_10288966
493 Ga0207695_10349690
494 Ga0207693_10274541
495 Ga0207663_10859389
496 Ga0207657_10106312
497 Ga0207652_10418625
498 Ga0207650_10362533
499 Ga0207650_10563707
500 Ga0207659_10588086
501 Ga0207687_10306349
502 Ga0207687_10362957
503 Ga0207687_10606311
504 Ga0207687_11330160
505 Ga0207700_10106331
506 Ga0207700_11401722
507 Ga0207644_10267596
508 Ga0207690_10350077
509 Ga0207706_10126994
510 Ga0207706_10340654
511 Ga0207706_10549786
512 Ga0207686_10517221
513 Ga0207669_10249513
514 Ga0207665_10189115
515 Ga0207691_10253047
516 Ga0207711_10138032
517 Ga0207711_10415173
518 Ga0207661_10486791
519 Ga0207661_10764351
520 Ga0207679_10323499
521 Ga0207712_10338658
522 Ga0207712_10437529
523 Ga0207668_10326241
524 Ga0207668_10465630
525 Ga0207640_10300109
526 Ga0207658_10330022
527 Ga0207658_10431692
528 Ga0207677_10326207
529 Ga0207677_10367509
530 Ga0207677_11542339
531 Ga0207639_10386545
532 Ga0207678_10086454
533 Ga0207678_10272240
534 Ga0207708_10211977
535 Ga0207708_10231834
536 Ga0207708_10363948
537 Ga0207702_10540434
538 Ga0207641_10258091
539 Ga0207641_10665573
540 Ga0207648_10367841
541 Ga0207676_10377514
542 Ga0207676_10382801
543 Ga0207675_100375525
544 Ga0207675_100565885
545 Ga0207675_100777461
546 Ga0207683_10351671
547 Ga0207683_10641405
548 Ga0207428_10241977
549 Ga0207428_10584346
550 Ga0268266_10343252
551 Ga0268266_10461471
552 Ga0268265_10143954
553 Ga0265765_1004681
554 Ga0265760_10050601
555 Ga0307409_100411208
556 Ga0316583_10055413
557 Ga0316580_10167772
558 Ga0373940_0048265
559 Ga0373935_0702988
560 Ga0373947_0179547
561 Ga0316584_0474134
562 Ga0373925_0196382
563 Ga0373925_0336273
564 Ga0436364_0177775
565 Ga0436364_0260302
566 Ga0436364_0554934
567 Ga0436364_0723869
568 Ga0436364_1387370
569 Ga0400490_08964
570 Ga0400486_28385
571 Ga0400483_073388
572 Ga0400483_227953
573 Ga0400487_56125
574 Ga0436365_0388226
575 Ga0436365_0483598
576 Ga0436365_0691021
577 Ga0436365_0853038
578 Ga0436365_1340426
579 Ga0436365_1343754
580 Ga0436365_1678266
581 Ga0436360_0222875
582 Ga0436360_0282390
583 Ga0436360_0329531
584 Ga0436360_0383181
585 Ga0436360_0850438
586 Ga0436360_0869707
587 Ga0436360_1256657
588 Ga0436361_0315912
589 Ga0436361_0571990
590 Ga0436361_0858689
591 Ga0436363_0330532
592 Ga0436363_0472451
593 Ga0436363_0807058
594 Ga0436363_1524747
595 Ga0436363_1689538
596 Ga0436362_0092909
597 Ga0436362_0186782
598 Ga0436362_0658709
599 Ga0436362_0666194
600 Ga0436362_0814070
601 Ga0436362_1195581
602 Ga0466971_0159085
603 Ga0466958_0035842
604 Ga0466958_0802262
605 Ga0466967_0366288
606 Ga0466967_0486622
607 Ga0495591_032257
608 Ga0495605_0058304
609 Ga0495639_0353618
610 Ga0495585_0218514
611 Ga0495607_0278008
612 Ga0495610_0203357
613 Ga0495620_0226146
614 Ga0495632_0107926
615 Ga0495598_0057374
616 Ga0495597_0107125
617 Ga0495611_0233014
618 Ga0495623_0158743
619 Ga0495670_0432182
620 Ga0495671_0308599
621 Ga0495649_0172108
622 Ga0495660_0130431
623 Ga0495677_0061610
624 Ga0495679_052977
625 Ga0495679_093005
626 Ga0495673_0193757
627 Ga0495615_0116633
628 Ga0495626_0099987
629 Ga0496101_0785884
630 Ga0496106_0491299
631 Ga0496108_0683714
632 Ga0496110_0635680
633 Ga0496111_0710583
634 Ga0496124_0051694
635 Ga0496126_0826674
636 Ga0495678_029465
637 Ga0501290_003179
638 Ga0501335_003144
639 Ga0501031_0144139
640 Ga0501032_0203602
641 Ga0501033_0147972
642 Ga0501036_0511969
643 Ga0501037_0410014
644 Ga0501038_0752039
645 Ga0501039_0990194
646 Ga0501043_0212625
647 Ga0501046_0202834
648 Ga0501047_0140864
649 Ga0501073_0421983
650 Ga0501206_001991
651 Ga0501223_054628
652 Ga0501235_001060
653 Ga0501236_003705
654 Ga0501243_006902
655 Ga0501255_001451
656 Ga0501221_020742
657 Ga0501225_0031924
658 Ga0501245_002110
659 Ga0501080_0478431
660 Ga0501264_003397
661 Ga0501271_009257
662 Ga0501274_007690
663 Ga0501276_005263
664 Ga0501281_03114
665 Ga0501282_006584
666 Ga0501044_0074463
667 nmdc:mga06z11_568969_c1
668 nmdc:mga08y16_917480_c1
669 nmdc:mga08x19_95785_c1
670 Ga0495601_0202905
671 Ga0495655_0066775
672 Ga0495595_0024704
673 Ga0500559_0006773
674 Ga0501082_0455559
675 2923561245
676 643663224

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13358

DDE_3

DDE superfamily endonuclease

33

173

0.97

Map