F413720

General Info

Members Datasets Scaffolds Average Seq Length
338 162 676 274

Family's Representative Sequence

Representative Sequence 3300050508|nmdc:mga09592_29757_c1|nmdc:mga09592_29757_c1_370_1287
Length 305
Sequence MRLPDYSKAPTEFCGKWDNFKMSVRSREMKALRYGIAYAAVLAFVYLVSVPADAQNKEPEYTIKVMPPGGPAPRLGDGHPDLSGLWLPNSAGQGVSGRYGVDPAARRQFDPKATPEEPPSFQPWAVAKIKSMTPTELELSKSSVNCMPRGVPAIWLQNPYGTMLVHKPGLLVQLFEVLNNFRVIPTDGHPHAKNPEPLFHGDSVGRWEGDTLVVDGISFDERTYIMPNGWFHSDELHVVERYSRPSMNYLIVQITVEDPKVLTKPWTSAPRRWTLANDNINEFYCTNNRELEELEKLKAVESQGK

Samples

Sample ID Description Type Environment
1 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
2 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
25 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
26 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
27 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
30 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
31 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
32 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
33 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
36 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
37 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
38 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
39 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
40 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
41 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
42 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
43 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
44 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
45 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
46 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
47 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
48 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
49 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
50 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
51 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
52 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
53 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
54 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
56 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
57 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
58 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
59 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
60 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
61 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
62 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
63 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
65 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
68 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
69 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
70 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
71 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
72 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
73 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
74 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
75 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
76 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
77 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
78 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
79 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
115 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
117 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
118 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
119 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
120 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
121 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
122 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
123 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
124 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
125 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
126 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
127 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
128 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
129 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
130 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
131 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
132 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
133 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
134 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
135 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
136 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
137 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
138 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
139 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
140 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
141 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
142 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
143 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
144 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
145 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
146 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
147 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
148 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
149 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
150 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
151 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
152 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
153 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
154 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
155 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
156 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
157 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
158 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
159 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
160 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
161 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
162 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.18
Rhizosphere 98.82
Stem 0
Stem Tuber 0
Unclassified 26.63

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga09592_29757_c1 3300050508 Unclassified 4541
2 JGI24746J21847_1001245 3300001977 Bacteria 4052
3 JGI25406J46586_10000278 3300003203 Bacteria 22807
4 Ga0065704_10076318 3300005289 Bacteria 5167
5 Ga0065712_10067780 3300005290 Bacteria 37076
6 Ga0065715_10001630 3300005293 Bacteria 6225
7 Ga0065715_10119969 3300005293 Bacteria 2272
8 Ga0065707_10009778 3300005295 Bacteria 3036
9 Ga0065707_10090651 3300005295 Bacteria 4097
10 Ga0065707_10094663 3300005295 Unclassified 3469
11 Ga0065707_10314309 3300005295 Unclassified 951
12 Ga0070676_10005748 3300005328 Bacteria 6611
13 Ga0070690_100030702 3300005330 Bacteria 3342
14 Ga0070690_100069902 3300005330 Bacteria 2279
15 Ga0070677_10002756 3300005333 Bacteria 5623
16 Ga0068869_100008249 3300005334 Bacteria 6708
17 Ga0070666_10027721 3300005335 Bacteria 3712
18 Ga0070666_10173212 3300005335 Bacteria 1512
19 Ga0068868_100045296 3300005338 Unclassified 3441
20 Ga0068868_100250592 3300005338 Bacteria 1490
21 Ga0070689_100002135 3300005340 Bacteria 12841
22 Ga0070689_100076747 3300005340 Bacteria 2618
23 Ga0070691_10016102 3300005341 Bacteria 3437
24 Ga0070687_100008123 3300005343 Bacteria 4423
25 Ga0070668_100301539 3300005347 Unclassified 1344
26 Ga0070669_100035005 3300005353 Unclassified 3636
27 Ga0070675_100001978 3300005354 Bacteria 15182
28 Ga0070673_100037817 3300005364 Unclassified 3680
29 Ga0070673_100046376 3300005364 Bacteria 3375
30 Ga0070673_100105672 3300005364 Bacteria 2326
31 Ga0070673_100148502 3300005364 Unclassified 1983
32 Ga0070688_100007226 3300005365 Bacteria 5981
33 Ga0070688_100040175 3300005365 Unclassified 2865
34 Ga0070659_100116082 3300005366 Unclassified 2164
35 Ga0070667_100044936 3300005367 Bacteria 3712
36 Ga0070705_100008148 3300005440 Bacteria 5182
37 Ga0070705_100036736 3300005440 Bacteria 2757
38 Ga0070705_100041975 3300005440 Bacteria 2612
39 Ga0070705_100108470 3300005440 Bacteria 1768
40 Ga0070700_100014810 3300005441 Bacteria 4407
41 Ga0070708_100325590 3300005445 Bacteria 1448
42 Ga0070662_100026519 3300005457 Unclassified 4014
43 Ga0070662_100059698 3300005457 Bacteria 2779
44 Ga0070681_10017838 3300005458 Bacteria 7092
45 Ga0070685_10018916 3300005466 Bacteria 3711
46 Ga0070685_10075653 3300005466 Bacteria 2006
47 Ga0070706_100243785 3300005467 Bacteria 1678
48 Ga0070707_100157938 3300005468 Unclassified 2209
49 Ga0070698_100014410 3300005471 Bacteria 8353
50 Ga0070698_100042808 3300005471 Bacteria 4645
51 Ga0070698_100131032 3300005471 Unclassified 2463
52 Ga0070698_100196751 3300005471 Bacteria 1952
53 Ga0070699_100008293 3300005518 Bacteria 9009
54 Ga0070699_100023008 3300005518 Bacteria 5369
55 Ga0070679_100167533 3300005530 Unclassified 2170
56 Ga0070697_100018447 3300005536 Bacteria 5500
57 Ga0070672_100005529 3300005543 Bacteria 8389
58 Ga0070672_100033259 3300005543 Unclassified 3903
59 Ga0070672_100141667 3300005543 Unclassified 1983
60 Ga0070672_100206768 3300005543 Unclassified 1643
61 Ga0070686_100008398 3300005544 Bacteria 5780
62 Ga0070695_100000551 3300005545 Bacteria 19830
63 Ga0070695_100035468 3300005545 Unclassified 3134
64 Ga0070695_100110471 3300005545 Bacteria 1865
65 Ga0070695_100134629 3300005545 Bacteria 1707
66 Ga0070696_100012642 3300005546 Bacteria 5667
67 Ga0070696_100047073 3300005546 Unclassified 2992
68 Ga0070665_100162291 3300005548 Unclassified 2236
69 Ga0070704_100027930 3300005549 Bacteria 3748
70 Ga0070704_100029025 3300005549 Unclassified 3688
71 Ga0070704_100054765 3300005549 Unclassified 2824
72 Ga0070664_100149409 3300005564 Bacteria 2062
73 Ga0068857_100284713 3300005577 Bacteria 1521
74 Ga0070702_100090639 3300005615 Unclassified 1853
75 Ga0068859_100020451 3300005617 Bacteria 6643
76 Ga0068859_100032135 3300005617 Bacteria 5272
77 Ga0068859_100088302 3300005617 Bacteria 3150
78 Ga0068864_100024724 3300005618 Bacteria 5053
79 Ga0068864_100090966 3300005618 Bacteria 2691
80 Ga0068864_100631877 3300005618 Bacteria 1041
81 Ga0068861_100015808 3300005719 Bacteria 5328
82 Ga0068861_100138099 3300005719 Bacteria 1986
83 Ga0068870_10003526 3300005840 Bacteria 6638
84 Ga0068870_10196432 3300005840 Bacteria 1221
85 Ga0068863_100004805 3300005841 Bacteria 13307
86 Ga0068863_100151899 3300005841 Bacteria 2216
87 Ga0068863_100168464 3300005841 Bacteria 2100
88 Ga0068863_100467437 3300005841 Unclassified 1239
89 Ga0068858_100030817 3300005842 Bacteria 4981
90 Ga0068858_100053128 3300005842 Unclassified 3749
91 Ga0068860_100002584 3300005843 Bacteria 18948
92 Ga0068860_100004416 3300005843 Bacteria 14366
93 Ga0068862_100026127 3300005844 Bacteria 4908
94 Ga0081539_10000071 3300005985 Bacteria 233094
95 Ga0081539_10000184 3300005985 Bacteria 147966
96 Ga0081539_10024175 3300005985 Unclassified 3952
97 Ga0097621_100018723 3300006237 Bacteria 5298
98 Ga0097621_100186385 3300006237 Bacteria 1795
99 Ga0068871_100162183 3300006358 Bacteria 1912
100 Ga0075428_100008599 3300006844 Bacteria 11322
101 Ga0075428_100017723 3300006844 Bacteria 7869
102 Ga0075428_100112593 3300006844 Bacteria 2964
103 Ga0075428_100765471 3300006844 Unclassified 1027
104 Ga0075430_100002950 3300006846 Bacteria 14234
105 Ga0075430_100033868 3300006846 Bacteria 4335
106 Ga0075430_100147317 3300006846 Bacteria 1961
107 Ga0075430_100159317 3300006846 Bacteria 1879
108 Ga0075430_100165694 3300006846 Bacteria 1839
109 Ga0075431_100001203 3300006847 Bacteria 23373
110 Ga0075431_100026538 3300006847 Bacteria 5942
111 Ga0075431_100033284 3300006847 Bacteria 5312
112 Ga0075431_100039087 3300006847 Bacteria 4887
113 Ga0075433_10002442 3300006852 Bacteria 14147
114 Ga0075433_10025696 3300006852 Bacteria 4980
115 Ga0075433_10075536 3300006852 Bacteria 2966
116 Ga0075433_10285423 3300006852 Unclassified 1462
117 Ga0075434_100007286 3300006871 Bacteria 10236
118 Ga0075434_100017569 3300006871 Bacteria 6894
119 Ga0075434_100037875 3300006871 Bacteria 4775
120 Ga0075434_100204853 3300006871 Bacteria 1993
121 Ga0075429_100000982 3300006880 Bacteria 22672
122 Ga0075429_100031040 3300006880 Unclassified 4644
123 Ga0075429_100056505 3300006880 Unclassified 3416
124 Ga0075429_100116135 3300006880 Bacteria 2340
125 Ga0075429_100116594 3300006880 Bacteria 2334
126 Ga0075429_100145574 3300006880 Bacteria 2074
127 Ga0068865_100249351 3300006881 Unclassified 1401
128 Ga0097620_100020450 3300006931 Bacteria 6643
129 Ga0097620_100032135 3300006931 Bacteria 5272
130 Ga0097620_100088302 3300006931 Bacteria 3150
131 Ga0075435_100101042 3300007076 Bacteria 2389
132 Ga0075435_100301294 3300007076 Bacteria 1371
133 Ga0111539_10000226 3300009094 Bacteria 67584
134 Ga0111539_10002892 3300009094 Bacteria 22800
135 Ga0111539_10014615 3300009094 Bacteria 9797
136 Ga0111539_10015310 3300009094 Bacteria 9551
137 Ga0111539_10041737 3300009094 Bacteria 5514
138 Ga0111539_10054181 3300009094 Bacteria 4773
139 Ga0111539_10100280 3300009094 Bacteria 3400
140 Ga0111539_10206900 3300009094 Bacteria 2287
141 Ga0111539_10230497 3300009094 Bacteria 2156
142 Ga0114129_10001413 3300009147 Bacteria 32335
143 Ga0114129_10007756 3300009147 Bacteria 15268
144 Ga0114129_10023256 3300009147 Bacteria 8790
145 Ga0114129_10077251 3300009147 Bacteria 4632
146 Ga0114129_10105560 3300009147 Bacteria 3893
147 Ga0114129_10164019 3300009147 Bacteria 3034
148 Ga0114129_10208406 3300009147 Unclassified 2644
149 Ga0114129_10288549 3300009147 Unclassified 2190
150 Ga0114129_10337254 3300009147 Unclassified 2000
151 Ga0114129_10447691 3300009147 Bacteria 1694
152 Ga0114129_10860960 3300009147 Bacteria 1151
153 Ga0105243_10062437 3300009148 Bacteria 2983
154 Ga0105242_10052471 3300009176 Unclassified 3327
155 Ga0105248_10264444 3300009177 Bacteria 1936
156 Ga0105248_10483295 3300009177 Unclassified 1396
157 Ga0105248_10801264 3300009177 Unclassified 1063
158 Ga0105248_10834054 3300009177 Unclassified 1041
159 Ga0105238_10802656 3300009551 Unclassified 957
160 Ga0105246_10182438 3300011119 Bacteria 1617
161 Ga0157374_10225517 3300013296 Bacteria 1840
162 Ga0157374_10380584 3300013296 Unclassified 1406
163 Ga0163162_10062389 3300013306 Unclassified 3767
164 Ga0157375_10048543 3300013308 Bacteria 4153
165 Ga0157380_10019053 3300014326 Bacteria 5109
166 Ga0157380_10224366 3300014326 Bacteria 1683
167 Ga0157380_10404412 3300014326 Bacteria 1296
168 Ga0157377_10010900 3300014745 Bacteria 4516
169 Ga0157379_10043902 3300014968 Unclassified 3991
170 Ga0157379_10056676 3300014968 Bacteria 3501
171 Ga0157379_10288926 3300014968 Bacteria 1493
172 Ga0163161_10003161 3300017792 Bacteria 11615
173 Ga0163161_10086974 3300017792 Bacteria 2308
174 Ga0207697_10001758 3300025315 Bacteria 11648
175 Ga0207682_10012095 3300025893 Unclassified 3370
176 Ga0207682_10017400 3300025893 Bacteria 2807
177 Ga0207688_10006082 3300025901 Bacteria 6566
178 Ga0207688_10028936 3300025901 Unclassified 3048
179 Ga0207680_10057304 3300025903 Bacteria 2357
180 Ga0207645_10000280 3300025907 Bacteria 42395
181 Ga0207645_10163772 3300025907 Unclassified 1455
182 Ga0207643_10010081 3300025908 Bacteria 5080
183 Ga0207643_10045077 3300025908 Bacteria 2490
184 Ga0207643_10050681 3300025908 Unclassified 2354
185 Ga0207684_10169257 3300025910 Bacteria 1883
186 Ga0207707_10019982 3300025912 Bacteria 5845
187 Ga0207662_10015581 3300025918 Unclassified 4279
188 Ga0207662_10047259 3300025918 Unclassified 2549
189 Ga0207649_10033346 3300025920 Unclassified 3076
190 Ga0207646_10024827 3300025922 Bacteria 5486
191 Ga0207681_10013651 3300025923 Bacteria 5029
192 Ga0207681_10142700 3300025923 Unclassified 1785
193 Ga0207650_10272601 3300025925 Unclassified 1375
194 Ga0207659_10000604 3300025926 Bacteria 21481
195 Ga0207659_10046865 3300025926 Unclassified 3055
196 Ga0207659_10048196 3300025926 Bacteria 3017
197 Ga0207659_10095624 3300025926 Bacteria 2228
198 Ga0207644_10021498 3300025931 Bacteria 4396
199 Ga0207644_10445989 3300025931 Unclassified 1063
200 Ga0207690_10175226 3300025932 Unclassified 1610
201 Ga0207706_10025638 3300025933 Bacteria 5281
202 Ga0207706_10049060 3300025933 Bacteria 3732
203 Ga0207686_10023687 3300025934 Unclassified 3548
204 Ga0207686_10071325 3300025934 Bacteria 2235
205 Ga0207709_10046058 3300025935 Bacteria 2644
206 Ga0207670_10015811 3300025936 Unclassified 4518
207 Ga0207670_10081117 3300025936 Unclassified 2269
208 Ga0207670_10134892 3300025936 Bacteria 1813
209 Ga0207669_10000745 3300025937 Bacteria 14109
210 Ga0207669_10063705 3300025937 Bacteria 2277
211 Ga0207704_10061899 3300025938 Unclassified 2324
212 Ga0207691_10016512 3300025940 Bacteria 7010
213 Ga0207691_10071289 3300025940 Unclassified 3136
214 Ga0207691_10235804 3300025940 Bacteria 1583
215 Ga0207711_10265666 3300025941 Bacteria 1578
216 Ga0207689_10003723 3300025942 Bacteria 13899
217 Ga0207689_10404333 3300025942 Bacteria 1138
218 Ga0207679_10069976 3300025945 Bacteria 2643
219 Ga0207679_10151538 3300025945 Bacteria 1888
220 Ga0207651_10071681 3300025960 Bacteria 2457
221 Ga0207703_10036177 3300026035 Unclassified 3928
222 Ga0207708_10006160 3300026075 Bacteria 8889
223 Ga0207708_10064823 3300026075 Unclassified 2792
224 Ga0207641_10199774 3300026088 Bacteria 1843
225 Ga0207648_10016149 3300026089 Bacteria 6836
226 Ga0207648_10039294 3300026089 Bacteria 4161
227 Ga0207648_10137356 3300026089 Unclassified 2154
228 Ga0207648_10224737 3300026089 Bacteria 1669
229 Ga0207676_10047270 3300026095 Unclassified 3334
230 Ga0207676_10613283 3300026095 Bacteria 1046
231 Ga0207674_10179790 3300026116 Bacteria 2067
232 Ga0207674_10465502 3300026116 Bacteria 1222
233 Ga0207675_100015515 3300026118 Bacteria 7105
234 Ga0207675_100165495 3300026118 Bacteria 2112
235 Ga0207683_10051964 3300026121 Bacteria 3591
236 Ga0207683_10074137 3300026121 Unclassified 3011
237 Ga0207683_10256957 3300026121 Bacteria 1595
238 Ga0207428_10000555 3300027907 Bacteria 44135
239 Ga0207428_10001959 3300027907 Bacteria 20897
240 Ga0207428_10003899 3300027907 Bacteria 14306
241 Ga0207428_10032625 3300027907 Bacteria 4281
242 Ga0207428_10068495 3300027907 Bacteria 2791
243 Ga0268264_10051321 3300028381 Unclassified 3436
244 Ga0268264_10170419 3300028381 Unclassified 1968
245 Ga0307407_10017448 3300031903 Bacteria 3602
246 Ga0307414_10150066 3300032004 Bacteria 1838
247 Ga0307415_100124167 3300032126 Bacteria 1942
248 Ga0373940_0079856 3300035088 Unclassified 965
249 Ga0373932_0048652 3300035112 Bacteria 1250
250 Ga0373939_0063155 3300035114 Bacteria 1186
251 Ga0373941_0056546 3300035115 Unclassified 1264
252 Ga0373931_0077574 3300035691 Unclassified 1826
253 Ga0436362_0883311 3300039453 Unclassified 1099
254 Ga0439453_0006427 3300041408 Bacteria 1830
255 Ga0450923_039994 3300042125 Bacteria 983
256 Ga0439434_0028621 3300042435 Bacteria 1688
257 Ga0439435_0033587 3300042436 Unclassified 1406
258 Ga0439435_0048510 3300042436 Bacteria 1209
259 Ga0451577_0150625 3300042876 Bacteria 2093
260 Ga0439440_0020355 3300042993 Bacteria 1487
261 Ga0451576_0023782 3300045051 Bacteria 6629
262 Ga0451576_0073507 3300045051 Unclassified 3557
263 Ga0451576_0343037 3300045051 Bacteria 1564
264 Ga0495584_0041384 3300046491 Unclassified 2326
265 Ga0495630_0336619 3300046517 Bacteria 1154
266 Ga0495643_0021543 3300046522 Bacteria 3696
267 Ga0495644_0060891 3300046523 Unclassified 1419
268 Ga0495663_0047992 3300046525 Bacteria 1316
269 Ga0495642_0054927 3300046528 Bacteria 1643
270 Ga0495598_0006708 3300046537 Bacteria 2611
271 Ga0495598_0031711 3300046537 Bacteria 1489
272 Ga0495656_0009692 3300046615 Bacteria 3474
273 Ga0495656_0056611 3300046615 Unclassified 1695
274 Ga0495659_0003538 3300046664 Bacteria 4974
275 Ga0495659_0011567 3300046664 Bacteria 2843
276 Ga0495659_0012178 3300046664 Unclassified 2781
277 Ga0495659_0013877 3300046664 Bacteria 2629
278 Ga0495659_0032144 3300046664 Bacteria 1835
279 Ga0495659_0075409 3300046664 Unclassified 1270
280 Ga0495659_0076064 3300046664 Bacteria 1266
281 Ga0495658_0029023 3300046683 Unclassified 2990
282 Ga0495658_0285101 3300046683 Archaea 1043
283 Ga0495669_0109915 3300046684 Bacteria 1286
284 Ga0495636_0024522 3300047318 Unclassified 2446
285 Ga0495636_0162635 3300047318 Unclassified 1006
286 Ga0496109_0104916 3300048912 Bacteria 2624
287 Ga0496109_0260360 3300048912 Unclassified 1634
288 Ga0496113_0029646 3300048916 Bacteria 3955
289 Ga0496113_0207461 3300048916 Bacteria 1559
290 Ga0501038_0182245 3300049574 Bacteria 1694
291 Ga0501040_0010409 3300049576 Bacteria 6081
292 Ga0501041_0361188 3300049577 Unclassified 918
293 Ga0501071_0107416 3300049587 Unclassified 2061
294 Ga0501076_0052185 3300049592 Bacteria 3239
295 Ga0501234_016513 3300049707 Bacteria 1165
296 Ga0501081_0004956 3300049743 Bacteria 8565
297 Ga0501045_0054089 3300049824 Bacteria 2935
298 nmdc:mga05p37_10338_c1 3300050507 Bacteria 11081
299 nmdc:mga05p37_11361_c1 3300050507 Bacteria 10596
300 nmdc:mga05p37_124018_c1 3300050507 Bacteria 3173
301 nmdc:mga05p37_165215_c1 3300050507 Bacteria 2702
302 nmdc:mga05p37_24545_c1 3300050507 Bacteria 7328
303 nmdc:mga05p37_303179_c1 3300050507 Unclassified 1897
304 nmdc:mga05p37_380109_c1 3300050507 Unclassified 1655
305 nmdc:mga05p37_409493_c1 3300050507 Bacteria 1581
306 nmdc:mga05p37_53500_c1 3300050507 Bacteria 4964
307 nmdc:mga05p37_8863_c1 3300050507 Bacteria 11885
308 nmdc:mga09592_110368_c1 3300050508 Bacteria 2360
309 nmdc:mga09592_126524_c1 3300050508 Bacteria 2197
310 nmdc:mga09592_149707_c1 3300050508 Bacteria 2013
311 nmdc:mga09592_18847_c1 3300050508 Bacteria 5662
312 nmdc:mga09592_87428_c1 3300050508 Unclassified 2661
313 nmdc:mga0qj67_138152_c1 3300050509 Bacteria 1975
314 nmdc:mga0qj67_149736_c1 3300050509 Bacteria 1893
315 nmdc:mga0qj67_27262_c1 3300050509 Bacteria 4426
316 nmdc:mga0qj67_34991_c1 3300050509 Bacteria 3926
317 nmdc:mga0qj67_37308_c1 3300050509 Bacteria 3806
318 nmdc:mga06r32_13456_c1 3300050510 Bacteria 7411
319 nmdc:mga06r32_242968_c1 3300050510 Bacteria 1788
320 nmdc:mga08y16_33371_c1 3300050511 Bacteria 5406
321 nmdc:mga08y16_561970_c1 3300050511 Bacteria 1154
322 nmdc:mga08y16_56247_c1 3300050511 Unclassified 4112
323 nmdc:mga08y16_600_c1 3300050511 Bacteria 33622
324 nmdc:mga08y16_73_c1 3300050511 Bacteria 84090
325 nmdc:mga08y16_812436_c1 3300050511 Bacteria 927
326 nmdc:mga08y16_9195_c1 3300050511 Bacteria 10369
327 nmdc:mga0n895_124134_c1 3300050512 Bacteria 2604
328 nmdc:mga0n895_5531_c1 3300050512 Bacteria 10579
329 nmdc:mga0n895_77997_c1 3300050512 Bacteria 3296
330 nmdc:mga0n895_941883_c1 3300050512 Unclassified 847
331 nmdc:mga0rr50_19120_c1 3300050513 Bacteria 4616
332 nmdc:mga0a205_16289_c1 3300050515 Bacteria 6960
333 nmdc:mga0a205_300171_c1 3300050515 Unclassified 1479
334 nmdc:mga0a205_34723_c1 3300050515 Unclassified 4839
335 nmdc:mga0a205_35054_c1 3300050515 Bacteria 4818
336 nmdc:mga0a205_89991_c1 3300050515 Bacteria 2966
337 Ga0501084_0150059 3300054114 Bacteria 1964
338 Ga0501082_0228455 3300060353 Bacteria 1620
339 nmdc:mga09592_29757_c1
340 JGI24746J21847_1001245
341 JGI25406J46586_10000278
342 Ga0065704_10076318
343 Ga0065712_10067780
344 Ga0065715_10001630
345 Ga0065715_10119969
346 Ga0065707_10009778
347 Ga0065707_10090651
348 Ga0065707_10094663
349 Ga0065707_10314309
350 Ga0070676_10005748
351 Ga0070690_100030702
352 Ga0070690_100069902
353 Ga0070677_10002756
354 Ga0068869_100008249
355 Ga0070666_10027721
356 Ga0070666_10173212
357 Ga0068868_100045296
358 Ga0068868_100250592
359 Ga0070689_100002135
360 Ga0070689_100076747
361 Ga0070691_10016102
362 Ga0070687_100008123
363 Ga0070668_100301539
364 Ga0070669_100035005
365 Ga0070675_100001978
366 Ga0070673_100037817
367 Ga0070673_100046376
368 Ga0070673_100105672
369 Ga0070673_100148502
370 Ga0070688_100007226
371 Ga0070688_100040175
372 Ga0070659_100116082
373 Ga0070667_100044936
374 Ga0070705_100008148
375 Ga0070705_100036736
376 Ga0070705_100041975
377 Ga0070705_100108470
378 Ga0070700_100014810
379 Ga0070708_100325590
380 Ga0070662_100026519
381 Ga0070662_100059698
382 Ga0070681_10017838
383 Ga0070685_10018916
384 Ga0070685_10075653
385 Ga0070706_100243785
386 Ga0070707_100157938
387 Ga0070698_100014410
388 Ga0070698_100042808
389 Ga0070698_100131032
390 Ga0070698_100196751
391 Ga0070699_100008293
392 Ga0070699_100023008
393 Ga0070679_100167533
394 Ga0070697_100018447
395 Ga0070672_100005529
396 Ga0070672_100033259
397 Ga0070672_100141667
398 Ga0070672_100206768
399 Ga0070686_100008398
400 Ga0070695_100000551
401 Ga0070695_100035468
402 Ga0070695_100110471
403 Ga0070695_100134629
404 Ga0070696_100012642
405 Ga0070696_100047073
406 Ga0070665_100162291
407 Ga0070704_100027930
408 Ga0070704_100029025
409 Ga0070704_100054765
410 Ga0070664_100149409
411 Ga0068857_100284713
412 Ga0070702_100090639
413 Ga0068859_100020451
414 Ga0068859_100032135
415 Ga0068859_100088302
416 Ga0068864_100024724
417 Ga0068864_100090966
418 Ga0068864_100631877
419 Ga0068861_100015808
420 Ga0068861_100138099
421 Ga0068870_10003526
422 Ga0068870_10196432
423 Ga0068863_100004805
424 Ga0068863_100151899
425 Ga0068863_100168464
426 Ga0068863_100467437
427 Ga0068858_100030817
428 Ga0068858_100053128
429 Ga0068860_100002584
430 Ga0068860_100004416
431 Ga0068862_100026127
432 Ga0081539_10000071
433 Ga0081539_10000184
434 Ga0081539_10024175
435 Ga0097621_100018723
436 Ga0097621_100186385
437 Ga0068871_100162183
438 Ga0075428_100008599
439 Ga0075428_100017723
440 Ga0075428_100112593
441 Ga0075428_100765471
442 Ga0075430_100002950
443 Ga0075430_100033868
444 Ga0075430_100147317
445 Ga0075430_100159317
446 Ga0075430_100165694
447 Ga0075431_100001203
448 Ga0075431_100026538
449 Ga0075431_100033284
450 Ga0075431_100039087
451 Ga0075433_10002442
452 Ga0075433_10025696
453 Ga0075433_10075536
454 Ga0075433_10285423
455 Ga0075434_100007286
456 Ga0075434_100017569
457 Ga0075434_100037875
458 Ga0075434_100204853
459 Ga0075429_100000982
460 Ga0075429_100031040
461 Ga0075429_100056505
462 Ga0075429_100116135
463 Ga0075429_100116594
464 Ga0075429_100145574
465 Ga0068865_100249351
466 Ga0097620_100020450
467 Ga0097620_100032135
468 Ga0097620_100088302
469 Ga0075435_100101042
470 Ga0075435_100301294
471 Ga0111539_10000226
472 Ga0111539_10002892
473 Ga0111539_10014615
474 Ga0111539_10015310
475 Ga0111539_10041737
476 Ga0111539_10054181
477 Ga0111539_10100280
478 Ga0111539_10206900
479 Ga0111539_10230497
480 Ga0114129_10001413
481 Ga0114129_10007756
482 Ga0114129_10023256
483 Ga0114129_10077251
484 Ga0114129_10105560
485 Ga0114129_10164019
486 Ga0114129_10208406
487 Ga0114129_10288549
488 Ga0114129_10337254
489 Ga0114129_10447691
490 Ga0114129_10860960
491 Ga0105243_10062437
492 Ga0105242_10052471
493 Ga0105248_10264444
494 Ga0105248_10483295
495 Ga0105248_10801264
496 Ga0105248_10834054
497 Ga0105238_10802656
498 Ga0105246_10182438
499 Ga0157374_10225517
500 Ga0157374_10380584
501 Ga0163162_10062389
502 Ga0157375_10048543
503 Ga0157380_10019053
504 Ga0157380_10224366
505 Ga0157380_10404412
506 Ga0157377_10010900
507 Ga0157379_10043902
508 Ga0157379_10056676
509 Ga0157379_10288926
510 Ga0163161_10003161
511 Ga0163161_10086974
512 Ga0207697_10001758
513 Ga0207682_10012095
514 Ga0207682_10017400
515 Ga0207688_10006082
516 Ga0207688_10028936
517 Ga0207680_10057304
518 Ga0207645_10000280
519 Ga0207645_10163772
520 Ga0207643_10010081
521 Ga0207643_10045077
522 Ga0207643_10050681
523 Ga0207684_10169257
524 Ga0207707_10019982
525 Ga0207662_10015581
526 Ga0207662_10047259
527 Ga0207649_10033346
528 Ga0207646_10024827
529 Ga0207681_10013651
530 Ga0207681_10142700
531 Ga0207650_10272601
532 Ga0207659_10000604
533 Ga0207659_10046865
534 Ga0207659_10048196
535 Ga0207659_10095624
536 Ga0207644_10021498
537 Ga0207644_10445989
538 Ga0207690_10175226
539 Ga0207706_10025638
540 Ga0207706_10049060
541 Ga0207686_10023687
542 Ga0207686_10071325
543 Ga0207709_10046058
544 Ga0207670_10015811
545 Ga0207670_10081117
546 Ga0207670_10134892
547 Ga0207669_10000745
548 Ga0207669_10063705
549 Ga0207704_10061899
550 Ga0207691_10016512
551 Ga0207691_10071289
552 Ga0207691_10235804
553 Ga0207711_10265666
554 Ga0207689_10003723
555 Ga0207689_10404333
556 Ga0207679_10069976
557 Ga0207679_10151538
558 Ga0207651_10071681
559 Ga0207703_10036177
560 Ga0207708_10006160
561 Ga0207708_10064823
562 Ga0207641_10199774
563 Ga0207648_10016149
564 Ga0207648_10039294
565 Ga0207648_10137356
566 Ga0207648_10224737
567 Ga0207676_10047270
568 Ga0207676_10613283
569 Ga0207674_10179790
570 Ga0207674_10465502
571 Ga0207675_100015515
572 Ga0207675_100165495
573 Ga0207683_10051964
574 Ga0207683_10074137
575 Ga0207683_10256957
576 Ga0207428_10000555
577 Ga0207428_10001959
578 Ga0207428_10003899
579 Ga0207428_10032625
580 Ga0207428_10068495
581 Ga0268264_10051321
582 Ga0268264_10170419
583 Ga0307407_10017448
584 Ga0307414_10150066
585 Ga0307415_100124167
586 Ga0373940_0079856
587 Ga0373932_0048652
588 Ga0373939_0063155
589 Ga0373941_0056546
590 Ga0373931_0077574
591 Ga0436362_0883311
592 Ga0439453_0006427
593 Ga0450923_039994
594 Ga0439434_0028621
595 Ga0439435_0033587
596 Ga0439435_0048510
597 Ga0451577_0150625
598 Ga0439440_0020355
599 Ga0451576_0023782
600 Ga0451576_0073507
601 Ga0451576_0343037
602 Ga0495584_0041384
603 Ga0495630_0336619
604 Ga0495643_0021543
605 Ga0495644_0060891
606 Ga0495663_0047992
607 Ga0495642_0054927
608 Ga0495598_0006708
609 Ga0495598_0031711
610 Ga0495656_0009692
611 Ga0495656_0056611
612 Ga0495659_0003538
613 Ga0495659_0011567
614 Ga0495659_0012178
615 Ga0495659_0013877
616 Ga0495659_0032144
617 Ga0495659_0075409
618 Ga0495659_0076064
619 Ga0495658_0029023
620 Ga0495658_0285101
621 Ga0495669_0109915
622 Ga0495636_0024522
623 Ga0495636_0162635
624 Ga0496109_0104916
625 Ga0496109_0260360
626 Ga0496113_0029646
627 Ga0496113_0207461
628 Ga0501038_0182245
629 Ga0501040_0010409
630 Ga0501041_0361188
631 Ga0501071_0107416
632 Ga0501076_0052185
633 Ga0501234_016513
634 Ga0501081_0004956
635 Ga0501045_0054089
636 nmdc:mga05p37_10338_c1
637 nmdc:mga05p37_11361_c1
638 nmdc:mga05p37_124018_c1
639 nmdc:mga05p37_165215_c1
640 nmdc:mga05p37_24545_c1
641 nmdc:mga05p37_303179_c1
642 nmdc:mga05p37_380109_c1
643 nmdc:mga05p37_409493_c1
644 nmdc:mga05p37_53500_c1
645 nmdc:mga05p37_8863_c1
646 nmdc:mga09592_110368_c1
647 nmdc:mga09592_126524_c1
648 nmdc:mga09592_149707_c1
649 nmdc:mga09592_18847_c1
650 nmdc:mga09592_87428_c1
651 nmdc:mga0qj67_138152_c1
652 nmdc:mga0qj67_149736_c1
653 nmdc:mga0qj67_27262_c1
654 nmdc:mga0qj67_34991_c1
655 nmdc:mga0qj67_37308_c1
656 nmdc:mga06r32_13456_c1
657 nmdc:mga06r32_242968_c1
658 nmdc:mga08y16_33371_c1
659 nmdc:mga08y16_561970_c1
660 nmdc:mga08y16_56247_c1
661 nmdc:mga08y16_600_c1
662 nmdc:mga08y16_73_c1
663 nmdc:mga08y16_812436_c1
664 nmdc:mga08y16_9195_c1
665 nmdc:mga0n895_124134_c1
666 nmdc:mga0n895_5531_c1
667 nmdc:mga0n895_77997_c1
668 nmdc:mga0n895_941883_c1
669 nmdc:mga0rr50_19120_c1
670 nmdc:mga0a205_16289_c1
671 nmdc:mga0a205_300171_c1
672 nmdc:mga0a205_34723_c1
673 nmdc:mga0a205_35054_c1
674 nmdc:mga0a205_89991_c1
675 Ga0501084_0150059
676 Ga0501082_0228455

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
4zrb-assembly2.cif.gz_G crystal structure of hypothetical thioesterase protein sp_1851 with coenzyme a from streptococcus pneumoniae tigr4 0.7256 207 247
1tbu-assembly1.cif.gz_D crystal structure of n-terminal domain of yeast peroxisomal thioesterase-1 0.7224 207 248
2oiw-assembly1.cif.gz_C the structure of a predicted thioesterase from bacillus stearothermophilus 0.7165 207 249
3ck1-assembly1.cif.gz_A crystal structure of a putative thioesterase (reut_a2179) from ralstonia eutropha jmp134 at 1.74 a resolution 0.7152 207 245
2cye-assembly3.cif.gz_B crystal structure of thioesterase complexed with coenzyme a and zn from thermus thermophilus hb8 0.7118 206 249
ID Description Score Start End Superfamily
af_Q7XTY9_163_289_2.60.40.200 Mainly Beta;Sandwich;Immunoglobulin-like;Superoxide dismutase, copper/zinc binding domain 0.821 207 229 2.60.40.200
af_Q556W3_248_405_3.10.129.10 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.7335 207 247 3.10.129.10
af_B0G100_946_1201_3.10.129.110 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Polyketide synthase dehydratase 0.7235 206 249 3.10.129.110
2oiwC00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.7165 207 249 3.10.129.10
af_Q2FZ56_72_189_3.10.129.10 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.7115 207 247 3.10.129.10
ID Description Score Start End GO Terms
AF-A0A2V8Y1Z9-F1-model_v4 Uncharacterized protein 0.9359 131 250
AF-A0A2V8ID39-F1-model_v4 Uncharacterized protein 0.9301 130 264
AF-A0A2D8P1M8-F1-model_v4 deleted 0.9126 89 239
AF-A0A354GUV5-F1-model_v4 Uncharacterized protein 0.9077 130 259
AF-A0A2V8I9H5-F1-model_v4 Uncharacterized protein 0.9073 133 260

Map