F413521

General Info

Members Datasets Scaffolds Average Seq Length
338 193 676 71

Family's Representative Sequence

Representative Sequence 3300021358|Ga0213873_10150209|Ga0213873_101502092
Length 73
Sequence MRFLLVALIRLYQLLISPLLPPACRFYPSCSQYALVAVREYGVLRGGWLALMRLARCHPWNPGGVDLVQDRRP

Samples

Sample ID Description Type Environment
1 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
9 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
10 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
11 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
12 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
13 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
14 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
15 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
16 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
17 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
18 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
19 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
20 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
21 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
22 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
23 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
24 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
25 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
26 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
27 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
28 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
29 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
30 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
31 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
32 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
33 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
34 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
35 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
36 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
37 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
38 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
39 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
40 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
41 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
42 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
43 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
44 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
45 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
46 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
47 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
48 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
49 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
50 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
51 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
52 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
53 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
54 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
55 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
56 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
57 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
58 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
59 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
88 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
89 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
90 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
91 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
92 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
93 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
94 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
95 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
96 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
97 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
98 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
99 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
100 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
101 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
102 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
103 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
104 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
105 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
106 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
107 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
108 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
109 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
110 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
111 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
112 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
113 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
114 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
115 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
116 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
117 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
118 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
119 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
120 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
121 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
122 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
123 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
124 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
125 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
126 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
127 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
128 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
129 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
130 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
131 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
132 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
133 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
134 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
135 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
136 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
137 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
138 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
139 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
140 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
141 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
142 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
143 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
144 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
145 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
146 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
147 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
148 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
149 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
150 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
151 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
152 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
153 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
154 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
155 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
156 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
157 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
158 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
159 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
160 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
161 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
162 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
163 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
164 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
165 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
166 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
167 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
168 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
169 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
170 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
171 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
172 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
173 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
174 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
175 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
176 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
177 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
178 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
179 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
180 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
181 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
182 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
183 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
184 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
185 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
186 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
187 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
188 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
189 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
190 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
191 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
192 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
193 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.22
Metatranscriptomes 1.78
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 5.03
Rhizosphere 91.72
Stem 0
Stem Tuber 0
Unclassified 18.34

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0213873_10150209 3300021358 Unclassified 701
2 Ga0070658_10774113 3300005327 Bacteria 833
3 Ga0070683_101003119 3300005329 Bacteria 802
4 Ga0070670_101578261 3300005331 Unclassified 603
5 Ga0070680_100326604 3300005336 Unclassified 1303
6 Ga0070682_100096154 3300005337 Unclassified 1946
7 Ga0070660_100000574 3300005339 Bacteria 24697
8 Ga0070661_100317241 3300005344 Bacteria 1217
9 Ga0070661_100421187 3300005344 Unclassified 1058
10 Ga0070671_100275066 3300005355 Bacteria 1431
11 Ga0070674_101041482 3300005356 Bacteria 720
12 Ga0070709_10540860 3300005434 Unclassified 890
13 Ga0070709_10633910 3300005434 Unclassified 826
14 Ga0070714_101207454 3300005435 Bacteria 738
15 Ga0070714_101495659 3300005435 Unclassified 659
16 Ga0070713_100528055 3300005436 Bacteria 1116
17 Ga0070710_11353044 3300005437 Bacteria 531
18 Ga0070708_100039830 3300005445 Bacteria 4113
19 Ga0070678_100038563 3300005456 Bacteria 3365
20 Ga0070681_10008124 3300005458 Bacteria 10269
21 Ga0070681_10215854 3300005458 Bacteria 1834
22 Ga0070681_10290310 3300005458 Bacteria 1545
23 Ga0070679_100128611 3300005530 Bacteria 2514
24 Ga0070679_100305402 3300005530 Bacteria 1541
25 Ga0070679_100502237 3300005530 Bacteria 1157
26 Ga0070679_101901714 3300005530 Unclassified 544
27 Ga0070684_100427717 3300005535 Bacteria 1223
28 Ga0068853_100222482 3300005539 Bacteria 1724
29 Ga0068853_100368519 3300005539 Bacteria 1340
30 Ga0068853_101359680 3300005539 Bacteria 687
31 Ga0070693_100274466 3300005547 Bacteria 1127
32 Ga0070704_100181512 3300005549 Bacteria 1684
33 Ga0068855_100024591 3300005563 Bacteria 7206
34 Ga0068855_100320110 3300005563 Unclassified 1714
35 Ga0068855_100426712 3300005563 Bacteria 1449
36 Ga0068855_101165488 3300005563 Unclassified 803
37 Ga0068857_101143069 3300005577 Bacteria 753
38 Ga0068854_100559073 3300005578 Unclassified 971
39 Ga0068856_100269776 3300005614 Bacteria 1717
40 Ga0070702_100893333 3300005615 Bacteria 695
41 Ga0068852_102858924 3300005616 Unclassified 501
42 Ga0068870_11370993 3300005840 Bacteria 517
43 Ga0081539_10107690 3300005985 Unclassified 1409
44 Ga0070717_11027717 3300006028 Unclassified 751
45 Ga0070716_101241683 3300006173 Unclassified 600
46 Ga0070712_100496071 3300006175 Bacteria 1023
47 Ga0070712_101997581 3300006175 Unclassified 508
48 Ga0075428_101536802 3300006844 Bacteria 697
49 Ga0075429_101723762 3300006880 Bacteria 544
50 Ga0105240_10372349 3300009093 Bacteria 1615
51 Ga0111539_10606558 3300009094 Bacteria 1275
52 Ga0111539_13349846 3300009094 Bacteria 516
53 Ga0105245_10737393 3300009098 Bacteria 1020
54 Ga0105241_10398870 3300009174 Bacteria 1206
55 Ga0105241_11503524 3300009174 Bacteria 648
56 Ga0105241_11734248 3300009174 Unclassified 608
57 Ga0105242_10787752 3300009176 Bacteria 940
58 Ga0105242_13199375 3300009176 Bacteria 508
59 Ga0105237_10024968 3300009545 Bacteria 6113
60 Ga0105237_10336371 3300009545 Bacteria 1514
61 Ga0105238_10027260 3300009551 Bacteria 5821
62 Ga0105238_10185288 3300009551 Bacteria 2058
63 Ga0105238_12018465 3300009551 Bacteria 610
64 Ga0105239_11064278 3300010375 Bacteria 931
65 Ga0105239_12029790 3300010375 Unclassified 668
66 Ga0157373_10081715 3300013100 Bacteria 2278
67 Ga0157373_10802199 3300013100 Bacteria 694
68 Ga0157370_10385289 3300013104 Bacteria 1291
69 Ga0157369_10037835 3300013105 Bacteria 5280
70 Ga0157369_10908504 3300013105 Bacteria 903
71 Ga0157374_10797969 3300013296 Bacteria 960
72 Ga0157374_12695625 3300013296 Unclassified 525
73 Ga0157378_10292694 3300013297 Bacteria 1573
74 Ga0157372_10118632 3300013307 Bacteria 3036
75 Ga0157372_10318945 3300013307 Unclassified 1809
76 Ga0157372_11269256 3300013307 Bacteria 850
77 Ga0163163_11692373 3300014325 Bacteria 693
78 Ga0182008_10241401 3300014497 Bacteria 930
79 Ga0197907_11039374 3300020069 Unclassified 1389
80 Ga0206356_11877758 3300020070 Bacteria 3622
81 Ga0206355_1245968 3300020076 Bacteria 1373
82 Ga0206352_10185973 3300020078 Bacteria 1047
83 Ga0206353_11940370 3300020082 Bacteria 945
84 Ga0213871_10244497 3300021441 Unclassified 569
85 Ga0224712_10054912 3300022467 Bacteria 1565
86 Ga0207692_10372466 3300025898 Bacteria 885
87 Ga0207647_10662376 3300025904 Bacteria 572
88 Ga0207699_10322414 3300025906 Unclassified 1084
89 Ga0207705_10050857 3300025909 Bacteria 2983
90 Ga0207705_11102014 3300025909 Bacteria 611
91 Ga0207707_10005737 3300025912 Bacteria 10854
92 Ga0207707_10411233 3300025912 Unclassified 1161
93 Ga0207707_10649206 3300025912 Bacteria 889
94 Ga0207695_10481065 3300025913 Bacteria 1124
95 Ga0207671_10207141 3300025914 Bacteria 1533
96 Ga0207671_10444335 3300025914 Unclassified 1033
97 Ga0207693_10332208 3300025915 Bacteria 1190
98 Ga0207693_11389710 3300025915 Unclassified 522
99 Ga0207663_10311318 3300025916 Bacteria 1180
100 Ga0207660_10080721 3300025917 Bacteria 2389
101 Ga0207660_10223252 3300025917 Bacteria 1479
102 Ga0207660_11629678 3300025917 Bacteria 520
103 Ga0207657_10003934 3300025919 Bacteria 15773
104 Ga0207657_10459689 3300025919 Bacteria 998
105 Ga0207657_11058854 3300025919 Archaea 621
106 Ga0207652_10028005 3300025921 Bacteria 4698
107 Ga0207652_10269427 3300025921 Bacteria 1536
108 Ga0207652_11089981 3300025921 Unclassified 699
109 Ga0207694_10349083 3300025924 Unclassified 1224
110 Ga0207694_10504664 3300025924 Bacteria 1013
111 Ga0207687_10651561 3300025927 Bacteria 891
112 Ga0207700_10455536 3300025928 Bacteria 1128
113 Ga0207664_10347864 3300025929 Unclassified 1312
114 Ga0207690_10050213 3300025932 Bacteria 2784
115 Ga0207706_11203222 3300025933 Bacteria 629
116 Ga0207686_10090577 3300025934 Bacteria 2018
117 Ga0207686_10400198 3300025934 Bacteria 1046
118 Ga0207686_11180741 3300025934 Bacteria 626
119 Ga0207665_10730048 3300025939 Unclassified 780
120 Ga0207661_11165706 3300025944 Bacteria 709
121 Ga0207679_10172492 3300025945 Bacteria 1782
122 Ga0207667_10103439 3300025949 Bacteria 2937
123 Ga0207667_10116063 3300025949 Bacteria 2759
124 Ga0207667_10668311 3300025949 Bacteria 1043
125 Ga0207639_11143657 3300026041 Bacteria 730
126 Ga0207639_11277320 3300026041 Bacteria 689
127 Ga0207702_10246705 3300026078 Bacteria 1675
128 Ga0207674_10028895 3300026116 Bacteria 5844
129 Ga0207674_10478188 3300026116 Bacteria 1204
130 Ga0207674_10994040 3300026116 Bacteria 808
131 Ga0207683_10237756 3300026121 Bacteria 1661
132 Ga0207698_11239193 3300026142 Bacteria 760
133 Ga0373944_0001722 3300035089 Bacteria 5530
134 Ga0373936_0101313 3300035113 Bacteria 1215
135 Ga0373945_0002038 3300035116 Bacteria 6281
136 Ga0373943_0002213 3300035170 Bacteria 8842
137 Ga0373946_0003652 3300035171 Bacteria 5449
138 Ga0373927_0073741 3300035695 Bacteria 2210
139 Ga0373947_0000635 3300035725 Bacteria 20773
140 Ga0373937_0610098 3300036401 Bacteria 1036
141 Ga0373925_0011883 3300037068 Bacteria 6301
142 Ga0395899_0040631 3300037312 Bacteria 3478
143 Ga0395899_0132227 3300037312 Bacteria 1781
144 Ga0395899_0438716 3300037312 Bacteria 857
145 Ga0395899_0718512 3300037312 Bacteria 625
146 Ga0395900_0060053 3300037418 Bacteria 3913
147 Ga0395900_0140428 3300037418 Bacteria 2474
148 Ga0395900_0179211 3300037418 Bacteria 2154
149 Ga0395900_0222631 3300037418 Bacteria 1901
150 Ga0395900_0451051 3300037418 Bacteria 1242
151 Ga0395898_0026819 3300037466 Bacteria 5790
152 Ga0395898_0113785 3300037466 Bacteria 2593
153 Ga0395898_0178181 3300037466 Bacteria 2031
154 Ga0395898_0555696 3300037466 Bacteria 1090
155 Ga0395898_0656200 3300037466 Bacteria 992
156 Ga0395898_0778333 3300037466 Bacteria 898
157 Ga0395898_0796461 3300037466 Bacteria 885
158 Ga0395898_0873571 3300037466 Unclassified 838
159 Ga0395898_1064928 3300037466 Bacteria 743
160 Ga0395905_0062267 3300037471 Bacteria 3490
161 Ga0395905_0074605 3300037471 Bacteria 3179
162 Ga0395905_0130635 3300037471 Unclassified 2362
163 Ga0395905_0365778 3300037471 Bacteria 1335
164 Ga0395905_0846639 3300037471 Unclassified 817
165 Ga0436364_0311421 3300037853 Bacteria 2088
166 Ga0395901_0016482 3300038443 Bacteria 7528
167 Ga0395901_0045736 3300038443 Bacteria 4544
168 Ga0395901_0105770 3300038443 Bacteria 2954
169 Ga0395901_0807848 3300038443 Bacteria 926
170 Ga0395901_1035700 3300038443 Bacteria 795
171 Ga0395901_1420541 3300038443 Unclassified 652
172 Ga0395901_1842372 3300038443 Bacteria 553
173 Ga0436365_0212146 3300039437 Unclassified 963
174 Ga0436365_0416452 3300039437 Bacteria 729
175 Ga0436365_1562726 3300039437 Bacteria 1046
176 Ga0436365_1639572 3300039437 Unclassified 523
177 Ga0436360_0038098 3300039438 Unclassified 556
178 Ga0436363_0346543 3300039450 Bacteria 676
179 Ga0436363_0484254 3300039450 Bacteria 804
180 Ga0436363_0660863 3300039450 Unclassified 598
181 Ga0436363_0783674 3300039450 Unclassified 999
182 Ga0436363_1258703 3300039450 Bacteria 603
183 Ga0436362_0922604 3300039453 Unclassified 1048
184 Ga0451839_1164765 3300041496 Bacteria 568
185 Ga0466969_0070048 3300044656 Bacteria 1687
186 Ga0466965_0581092 3300044683 Bacteria 635
187 Ga0466966_0014400 3300044684 Bacteria 5236
188 Ga0466966_0362912 3300044684 Unclassified 870
189 Ga0466961_0017833 3300044693 Bacteria 4562
190 Ga0466961_0025712 3300044693 Bacteria 3785
191 Ga0466961_0330277 3300044693 Bacteria 929
192 Ga0466963_0004531 3300044694 Bacteria 8089
193 Ga0466963_0007367 3300044694 Bacteria 6555
194 Ga0466963_0008784 3300044694 Bacteria 6068
195 Ga0466963_0024641 3300044694 Bacteria 3830
196 Ga0466963_0108815 3300044694 Bacteria 1901
197 Ga0466963_0183892 3300044694 Bacteria 1459
198 Ga0466963_0379545 3300044694 Bacteria 996
199 Ga0466963_0607490 3300044694 Bacteria 772
200 Ga0466963_0670638 3300044694 Bacteria 732
201 Ga0466964_0044359 3300044706 Unclassified 1806
202 Ga0466964_0172757 3300044706 Bacteria 1019
203 Ga0466971_0014575 3300044719 Bacteria 3460
204 Ga0466971_0247298 3300044719 Unclassified 849
205 Ga0466968_0010114 3300044735 Bacteria 3647
206 Ga0466970_0114458 3300044765 Unclassified 1474
207 Ga0466970_0493187 3300044765 Bacteria 705
208 Ga0466957_0015517 3300044842 Bacteria 4449
209 Ga0466957_0042823 3300044842 Bacteria 2740
210 Ga0466957_0092508 3300044842 Bacteria 1897
211 Ga0466957_0109307 3300044842 Bacteria 1752
212 Ga0466957_0656834 3300044842 Bacteria 738
213 Ga0466960_0267522 3300044901 Bacteria 954
214 Ga0466959_0007274 3300045049 Bacteria 7756
215 Ga0466959_0083317 3300045049 Unclassified 2303
216 Ga0466959_0218878 3300045049 Unclassified 1321
217 Ga0466959_0497083 3300045049 Bacteria 824
218 Ga0466958_0001369 3300045836 Bacteria 11532
219 Ga0466958_0150258 3300045836 Bacteria 1469
220 Ga0466958_0310332 3300045836 Unclassified 1013
221 Ga0466958_0662037 3300045836 Bacteria 680
222 Ga0466967_0002032 3300045976 Bacteria 12342
223 Ga0466967_0002987 3300045976 Bacteria 10829
224 Ga0466967_0018103 3300045976 Bacteria 5620
225 Ga0466967_0022818 3300045976 Bacteria 5116
226 Ga0466967_0040049 3300045976 Bacteria 4032
227 Ga0466967_0155178 3300045976 Bacteria 2143
228 Ga0466967_0290162 3300045976 Unclassified 1571
229 Ga0466967_0447226 3300045976 Unclassified 1262
230 Ga0466967_0529269 3300045976 Bacteria 1159
231 Ga0466967_0706153 3300045976 Bacteria 999
232 Ga0466967_2131575 3300045976 Bacteria 557
233 Ga0495603_0091143 3300046455 Bacteria 1782
234 Ga0495629_0002640 3300046459 Bacteria 13737
235 Ga0495629_0633222 3300046459 Bacteria 713
236 Ga0495641_0000447 3300046461 Bacteria 34465
237 Ga0495651_0295096 3300046462 Bacteria 1089
238 Ga0495653_0125489 3300046463 Bacteria 1823
239 Ga0495653_0480389 3300046463 Bacteria 777
240 Ga0495653_0770717 3300046463 Unclassified 580
241 Ga0495580_0123512 3300046472 Bacteria 1797
242 Ga0495582_0001939 3300046473 Bacteria 11621
243 Ga0495605_0054560 3300046474 Unclassified 1935
244 Ga0495639_0001568 3300046475 Bacteria 10220
245 Ga0495662_0003214 3300046476 Bacteria 8251
246 Ga0495664_0118708 3300046477 Unclassified 1599
247 Ga0495664_0496207 3300046477 Bacteria 729
248 Ga0495594_0066348 3300046499 Bacteria 2002
249 Ga0495618_0394377 3300046514 Bacteria 847
250 Ga0495628_0014589 3300046516 Bacteria 6578
251 Ga0495630_0027160 3300046517 Bacteria 4242
252 Ga0495666_0012573 3300046526 Bacteria 4220
253 Ga0495652_0324729 3300046529 Bacteria 1110
254 Ga0495665_0000169 3300046531 Bacteria 33006
255 Ga0495640_0068182 3300046533 Bacteria 2394
256 Ga0495640_0454208 3300046533 Bacteria 782
257 Ga0495586_0104022 3300046535 Unclassified 1577
258 Ga0495587_0412256 3300046536 Bacteria 750
259 Ga0495645_0191077 3300046543 Bacteria 1395
260 Ga0495667_0132660 3300046559 Bacteria 1606
261 Ga0495634_0044364 3300046642 Bacteria 3009
262 Ga0495635_0106783 3300046663 Bacteria 1912
263 Ga0495635_0239827 3300046663 Bacteria 1223
264 Ga0495588_0125281 3300046674 Bacteria 1355
265 Ga0495657_0051817 3300046675 Bacteria 2755
266 Ga0495623_0196356 3300046679 Bacteria 1163
267 Ga0495646_0034215 3300046680 Bacteria 3157
268 Ga0495647_0010089 3300046681 Bacteria 3213
269 Ga0495658_0000913 3300046683 Bacteria 15801
270 Ga0495613_0001209 3300046689 Bacteria 19750
271 Ga0495624_0109455 3300046690 Bacteria 1699
272 Ga0495600_0156046 3300046809 Bacteria 1476
273 Ga0495600_0241256 3300046809 Bacteria 1151
274 Ga0495581_0000096 3300047315 Bacteria 36595
275 Ga0495604_0115150 3300047317 Bacteria 1954
276 Ga0495604_0453029 3300047317 Bacteria 838
277 Ga0495674_0482253 3300047319 Bacteria 993
278 Ga0495676_0022496 3300047321 Bacteria 5482
279 Ga0495676_0251969 3300047321 Unclassified 1204
280 Ga0495680_0016643 3300047322 Bacteria 6309
281 Ga0495680_0025080 3300047322 Bacteria 4939
282 Ga0495675_0302946 3300047444 Bacteria 949
283 Ga0495684_0010682 3300047471 Bacteria 7097
284 Ga0495684_0022942 3300047471 Bacteria 4801
285 Ga0495602_0331834 3300048088 Bacteria 1103
286 Ga0495602_0698905 3300048088 Bacteria 688
287 Ga0495614_0002237 3300048089 Bacteria 8582
288 Ga0496100_0015855 3300048903 Bacteria 4411
289 Ga0496100_0021872 3300048903 Bacteria 3860
290 Ga0496101_0005330 3300048904 Bacteria 8190
291 Ga0496101_0006226 3300048904 Bacteria 7672
292 Ga0496102_0634897 3300048905 Unclassified 991
293 Ga0496103_0317680 3300048906 Bacteria 1002
294 Ga0496104_0489328 3300048907 Unclassified 1141
295 Ga0496105_0026525 3300048908 Bacteria 4728
296 Ga0496105_0084811 3300048908 Bacteria 2617
297 Ga0496106_0016449 3300048909 Bacteria 5472
298 Ga0496107_0008558 3300048910 Bacteria 7081
299 Ga0496107_0397985 3300048910 Unclassified 1024
300 Ga0496112_0715184 3300048915 Bacteria 929
301 Ga0496114_0010510 3300048917 Bacteria 7366
302 Ga0496114_0346252 3300048917 Unclassified 1314
303 Ga0496114_0581710 3300048917 Bacteria 988
304 Ga0496115_0001215 3300048918 Bacteria 18483
305 Ga0501043_0272246 3300049579 Bacteria 1300
306 Ga0501047_0083639 3300049581 Bacteria 3067
307 Ga0501067_0015987 3300049583 Bacteria 4151
308 Ga0501067_0255109 3300049583 Bacteria 976
309 Ga0501069_0023583 3300049585 Bacteria 3356
310 Ga0501069_0108679 3300049585 Bacteria 1578
311 Ga0501069_0153910 3300049585 Bacteria 1322
312 Ga0501070_0000805 3300049586 Bacteria 28505
313 Ga0501070_0042989 3300049586 Bacteria 3761
314 Ga0501070_0273380 3300049586 Bacteria 1379
315 Ga0501070_1087375 3300049586 Unclassified 617
316 Ga0501071_0499734 3300049587 Bacteria 933
317 Ga0501074_0133940 3300049590 Bacteria 1772
318 Ga0501074_0344353 3300049590 Bacteria 1058
319 Ga0501079_0586901 3300049741 Bacteria 877
320 Ga0501080_0370437 3300049742 Bacteria 1291
321 Ga0501080_0743417 3300049742 Bacteria 863
322 Ga0501044_0184327 3300049823 Bacteria 2053
323 Ga0501044_0798871 3300049823 Bacteria 823
324 nmdc:mga08y16_630065_c1 3300050511 Unclassified 1078
325 Ga0495601_0242947 3300053077 Bacteria 1175
326 Ga0495601_0757986 3300053077 Bacteria 617
327 Ga0495655_0001763 3300053083 Bacteria 3361
328 Ga0495595_0088334 3300053084 Bacteria 1484
329 Ga0495595_0501525 3300053084 Bacteria 618
330 Ga0495619_0020647 3300053085 Bacteria 4198
331 Ga0495619_0038570 3300053085 Bacteria 3116
332 Ga0501084_0514614 3300054114 Bacteria 1012
333 Ga0501082_2027068 3300060353 Bacteria 502
334 Ga0466962_0000254 3300061719 Bacteria 22544
335 Ga0466962_0118283 3300061719 Bacteria 1278
336 Ga0466962_0139568 3300061719 Bacteria 1174
337 Ga0466962_0285655 3300061719 Unclassified 815
338 Ga0530510_0027851 3300061734 Bacteria 4049
339 Ga0213873_10150209
340 Ga0070658_10774113
341 Ga0070683_101003119
342 Ga0070670_101578261
343 Ga0070680_100326604
344 Ga0070682_100096154
345 Ga0070660_100000574
346 Ga0070661_100317241
347 Ga0070661_100421187
348 Ga0070671_100275066
349 Ga0070674_101041482
350 Ga0070709_10540860
351 Ga0070709_10633910
352 Ga0070714_101207454
353 Ga0070714_101495659
354 Ga0070713_100528055
355 Ga0070710_11353044
356 Ga0070708_100039830
357 Ga0070678_100038563
358 Ga0070681_10008124
359 Ga0070681_10215854
360 Ga0070681_10290310
361 Ga0070679_100128611
362 Ga0070679_100305402
363 Ga0070679_100502237
364 Ga0070679_101901714
365 Ga0070684_100427717
366 Ga0068853_100222482
367 Ga0068853_100368519
368 Ga0068853_101359680
369 Ga0070693_100274466
370 Ga0070704_100181512
371 Ga0068855_100024591
372 Ga0068855_100320110
373 Ga0068855_100426712
374 Ga0068855_101165488
375 Ga0068857_101143069
376 Ga0068854_100559073
377 Ga0068856_100269776
378 Ga0070702_100893333
379 Ga0068852_102858924
380 Ga0068870_11370993
381 Ga0081539_10107690
382 Ga0070717_11027717
383 Ga0070716_101241683
384 Ga0070712_100496071
385 Ga0070712_101997581
386 Ga0075428_101536802
387 Ga0075429_101723762
388 Ga0105240_10372349
389 Ga0111539_10606558
390 Ga0111539_13349846
391 Ga0105245_10737393
392 Ga0105241_10398870
393 Ga0105241_11503524
394 Ga0105241_11734248
395 Ga0105242_10787752
396 Ga0105242_13199375
397 Ga0105237_10024968
398 Ga0105237_10336371
399 Ga0105238_10027260
400 Ga0105238_10185288
401 Ga0105238_12018465
402 Ga0105239_11064278
403 Ga0105239_12029790
404 Ga0157373_10081715
405 Ga0157373_10802199
406 Ga0157370_10385289
407 Ga0157369_10037835
408 Ga0157369_10908504
409 Ga0157374_10797969
410 Ga0157374_12695625
411 Ga0157378_10292694
412 Ga0157372_10118632
413 Ga0157372_10318945
414 Ga0157372_11269256
415 Ga0163163_11692373
416 Ga0182008_10241401
417 Ga0197907_11039374
418 Ga0206356_11877758
419 Ga0206355_1245968
420 Ga0206352_10185973
421 Ga0206353_11940370
422 Ga0213871_10244497
423 Ga0224712_10054912
424 Ga0207692_10372466
425 Ga0207647_10662376
426 Ga0207699_10322414
427 Ga0207705_10050857
428 Ga0207705_11102014
429 Ga0207707_10005737
430 Ga0207707_10411233
431 Ga0207707_10649206
432 Ga0207695_10481065
433 Ga0207671_10207141
434 Ga0207671_10444335
435 Ga0207693_10332208
436 Ga0207693_11389710
437 Ga0207663_10311318
438 Ga0207660_10080721
439 Ga0207660_10223252
440 Ga0207660_11629678
441 Ga0207657_10003934
442 Ga0207657_10459689
443 Ga0207657_11058854
444 Ga0207652_10028005
445 Ga0207652_10269427
446 Ga0207652_11089981
447 Ga0207694_10349083
448 Ga0207694_10504664
449 Ga0207687_10651561
450 Ga0207700_10455536
451 Ga0207664_10347864
452 Ga0207690_10050213
453 Ga0207706_11203222
454 Ga0207686_10090577
455 Ga0207686_10400198
456 Ga0207686_11180741
457 Ga0207665_10730048
458 Ga0207661_11165706
459 Ga0207679_10172492
460 Ga0207667_10103439
461 Ga0207667_10116063
462 Ga0207667_10668311
463 Ga0207639_11143657
464 Ga0207639_11277320
465 Ga0207702_10246705
466 Ga0207674_10028895
467 Ga0207674_10478188
468 Ga0207674_10994040
469 Ga0207683_10237756
470 Ga0207698_11239193
471 Ga0373944_0001722
472 Ga0373936_0101313
473 Ga0373945_0002038
474 Ga0373943_0002213
475 Ga0373946_0003652
476 Ga0373927_0073741
477 Ga0373947_0000635
478 Ga0373937_0610098
479 Ga0373925_0011883
480 Ga0395899_0040631
481 Ga0395899_0132227
482 Ga0395899_0438716
483 Ga0395899_0718512
484 Ga0395900_0060053
485 Ga0395900_0140428
486 Ga0395900_0179211
487 Ga0395900_0222631
488 Ga0395900_0451051
489 Ga0395898_0026819
490 Ga0395898_0113785
491 Ga0395898_0178181
492 Ga0395898_0555696
493 Ga0395898_0656200
494 Ga0395898_0778333
495 Ga0395898_0796461
496 Ga0395898_0873571
497 Ga0395898_1064928
498 Ga0395905_0062267
499 Ga0395905_0074605
500 Ga0395905_0130635
501 Ga0395905_0365778
502 Ga0395905_0846639
503 Ga0436364_0311421
504 Ga0395901_0016482
505 Ga0395901_0045736
506 Ga0395901_0105770
507 Ga0395901_0807848
508 Ga0395901_1035700
509 Ga0395901_1420541
510 Ga0395901_1842372
511 Ga0436365_0212146
512 Ga0436365_0416452
513 Ga0436365_1562726
514 Ga0436365_1639572
515 Ga0436360_0038098
516 Ga0436363_0346543
517 Ga0436363_0484254
518 Ga0436363_0660863
519 Ga0436363_0783674
520 Ga0436363_1258703
521 Ga0436362_0922604
522 Ga0451839_1164765
523 Ga0466969_0070048
524 Ga0466965_0581092
525 Ga0466966_0014400
526 Ga0466966_0362912
527 Ga0466961_0017833
528 Ga0466961_0025712
529 Ga0466961_0330277
530 Ga0466963_0004531
531 Ga0466963_0007367
532 Ga0466963_0008784
533 Ga0466963_0024641
534 Ga0466963_0108815
535 Ga0466963_0183892
536 Ga0466963_0379545
537 Ga0466963_0607490
538 Ga0466963_0670638
539 Ga0466964_0044359
540 Ga0466964_0172757
541 Ga0466971_0014575
542 Ga0466971_0247298
543 Ga0466968_0010114
544 Ga0466970_0114458
545 Ga0466970_0493187
546 Ga0466957_0015517
547 Ga0466957_0042823
548 Ga0466957_0092508
549 Ga0466957_0109307
550 Ga0466957_0656834
551 Ga0466960_0267522
552 Ga0466959_0007274
553 Ga0466959_0083317
554 Ga0466959_0218878
555 Ga0466959_0497083
556 Ga0466958_0001369
557 Ga0466958_0150258
558 Ga0466958_0310332
559 Ga0466958_0662037
560 Ga0466967_0002032
561 Ga0466967_0002987
562 Ga0466967_0018103
563 Ga0466967_0022818
564 Ga0466967_0040049
565 Ga0466967_0155178
566 Ga0466967_0290162
567 Ga0466967_0447226
568 Ga0466967_0529269
569 Ga0466967_0706153
570 Ga0466967_2131575
571 Ga0495603_0091143
572 Ga0495629_0002640
573 Ga0495629_0633222
574 Ga0495641_0000447
575 Ga0495651_0295096
576 Ga0495653_0125489
577 Ga0495653_0480389
578 Ga0495653_0770717
579 Ga0495580_0123512
580 Ga0495582_0001939
581 Ga0495605_0054560
582 Ga0495639_0001568
583 Ga0495662_0003214
584 Ga0495664_0118708
585 Ga0495664_0496207
586 Ga0495594_0066348
587 Ga0495618_0394377
588 Ga0495628_0014589
589 Ga0495630_0027160
590 Ga0495666_0012573
591 Ga0495652_0324729
592 Ga0495665_0000169
593 Ga0495640_0068182
594 Ga0495640_0454208
595 Ga0495586_0104022
596 Ga0495587_0412256
597 Ga0495645_0191077
598 Ga0495667_0132660
599 Ga0495634_0044364
600 Ga0495635_0106783
601 Ga0495635_0239827
602 Ga0495588_0125281
603 Ga0495657_0051817
604 Ga0495623_0196356
605 Ga0495646_0034215
606 Ga0495647_0010089
607 Ga0495658_0000913
608 Ga0495613_0001209
609 Ga0495624_0109455
610 Ga0495600_0156046
611 Ga0495600_0241256
612 Ga0495581_0000096
613 Ga0495604_0115150
614 Ga0495604_0453029
615 Ga0495674_0482253
616 Ga0495676_0022496
617 Ga0495676_0251969
618 Ga0495680_0016643
619 Ga0495680_0025080
620 Ga0495675_0302946
621 Ga0495684_0010682
622 Ga0495684_0022942
623 Ga0495602_0331834
624 Ga0495602_0698905
625 Ga0495614_0002237
626 Ga0496100_0015855
627 Ga0496100_0021872
628 Ga0496101_0005330
629 Ga0496101_0006226
630 Ga0496102_0634897
631 Ga0496103_0317680
632 Ga0496104_0489328
633 Ga0496105_0026525
634 Ga0496105_0084811
635 Ga0496106_0016449
636 Ga0496107_0008558
637 Ga0496107_0397985
638 Ga0496112_0715184
639 Ga0496114_0010510
640 Ga0496114_0346252
641 Ga0496114_0581710
642 Ga0496115_0001215
643 Ga0501043_0272246
644 Ga0501047_0083639
645 Ga0501067_0015987
646 Ga0501067_0255109
647 Ga0501069_0023583
648 Ga0501069_0108679
649 Ga0501069_0153910
650 Ga0501070_0000805
651 Ga0501070_0042989
652 Ga0501070_0273380
653 Ga0501070_1087375
654 Ga0501071_0499734
655 Ga0501074_0133940
656 Ga0501074_0344353
657 Ga0501079_0586901
658 Ga0501080_0370437
659 Ga0501080_0743417
660 Ga0501044_0184327
661 Ga0501044_0798871
662 nmdc:mga08y16_630065_c1
663 Ga0495601_0242947
664 Ga0495601_0757986
665 Ga0495655_0001763
666 Ga0495595_0088334
667 Ga0495595_0501525
668 Ga0495619_0020647
669 Ga0495619_0038570
670 Ga0501084_0514614
671 Ga0501082_2027068
672 Ga0466962_0000254
673 Ga0466962_0118283
674 Ga0466962_0139568
675 Ga0466962_0285655
676 Ga0530510_0027851

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01809

YidD

Putative membrane protein insertion efficiency factor

2

68

0.97

Map