F413514

General Info

Members Datasets Scaffolds Average Seq Length
338 226 676 167

Family's Representative Sequence

Representative Sequence 3300013308|Ga0157375_11198263|Ga0157375_111982632
Length 168
Sequence MATSPAQIYPVLSRLFSELVDGATSGAGAFVLNTGDAGLLGSLDKLSAADASRSVNDGATIAAHAQHLRYGLSLINPERWASEGGDPFADAKWDLAWKTSVVDADAWQEIRNGLRDEAHRWLRALDSPRDVSDIELTGVTASVAHLAYHLGAIPQIGKQSRGPTEGTF

Samples

Sample ID Description Type Environment
1 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
22 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
23 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
24 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
25 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
26 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
32 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
33 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
34 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
35 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
36 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
37 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
38 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
39 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
40 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
41 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
42 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
43 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
44 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
45 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
46 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
47 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
48 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
49 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
50 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
51 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
52 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
53 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
54 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
55 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
56 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
58 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
59 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
60 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
61 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
63 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
64 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
66 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
68 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
69 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
70 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
71 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
72 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
73 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
74 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
75 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
76 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
77 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
78 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
79 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
80 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
81 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
82 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
83 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
84 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
122 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
123 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
126 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
127 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
128 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
129 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
130 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
131 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
132 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
133 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
134 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
135 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
136 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
137 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
138 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
139 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
140 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
141 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
142 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
143 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
144 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
145 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
146 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
147 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
148 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
149 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
150 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
151 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
152 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
153 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
154 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
155 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
156 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
157 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
158 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
159 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
160 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
161 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
162 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
163 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
164 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
165 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
166 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
167 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
168 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
169 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
170 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
171 3300049518 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control Metagenome Rhizosphere
172 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
173 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
174 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
175 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
176 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
177 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
178 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
179 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
180 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
181 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
182 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
183 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
184 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
185 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
186 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
187 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
188 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
189 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
190 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
191 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
192 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
193 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
194 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
195 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
196 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
197 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
198 3300049687 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought Metagenome Rhizosphere
199 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
200 3300049689 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_A_4_drought Metagenome Rhizosphere
201 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
202 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
203 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
204 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
205 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
206 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
207 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
208 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
209 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
210 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
211 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
212 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
213 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
214 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
215 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
216 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
217 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
218 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
219 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
220 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
221 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
222 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
223 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
224 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
225 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
226 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.7
Metatranscriptomes 0.3
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.14
Nodule 0
Rhizoplane 3.25
Rhizosphere 92.01
Stem 0
Stem Tuber 0
Unclassified 25.74

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157375_11198263 3300013308 Unclassified 891
2 JGI24751J29686_10023651 3300002459 Unclassified 1274
3 Ga0065715_10105954 3300005293 Unclassified 2854
4 Ga0065715_10765356 3300005293 Unclassified 624
5 Ga0065707_10091294 3300005295 Bacteria 3972
6 Ga0070690_100166827 3300005330 Bacteria 1513
7 Ga0070670_100016272 3300005331 Bacteria 6387
8 Ga0070670_100096308 3300005331 Bacteria 2546
9 Ga0070677_10018950 3300005333 Bacteria 2486
10 Ga0070666_10040594 3300005335 Bacteria 3106
11 Ga0070666_10315784 3300005335 Bacteria 1114
12 Ga0070682_100139028 3300005337 Unclassified 1653
13 Ga0068868_100002345 3300005338 Bacteria 13103
14 Ga0070689_100251812 3300005340 Bacteria 1457
15 Ga0070691_10000205 3300005341 Bacteria 19816
16 Ga0070668_100699263 3300005347 Unclassified 894
17 Ga0070675_100288721 3300005354 Bacteria 1443
18 Ga0070675_100519821 3300005354 Bacteria 1074
19 Ga0070675_100608658 3300005354 Bacteria 991
20 Ga0070675_101117819 3300005354 Bacteria 725
21 Ga0070671_100110522 3300005355 Bacteria 2309
22 Ga0070674_100344313 3300005356 Bacteria 1202
23 Ga0070674_100580548 3300005356 Unclassified 944
24 Ga0070674_101086493 3300005356 Bacteria 706
25 Ga0070673_100048236 3300005364 Bacteria 3319
26 Ga0070673_100078927 3300005364 Bacteria 2664
27 Ga0070688_100024707 3300005365 Bacteria 3550
28 Ga0070688_100202007 3300005365 Bacteria 1391
29 Ga0070659_100173750 3300005366 Unclassified 1766
30 Ga0070667_100039952 3300005367 Bacteria 3933
31 Ga0070703_10056958 3300005406 Bacteria 1267
32 Ga0070713_100006819 3300005436 Bacteria 7957
33 Ga0070710_10260796 3300005437 Bacteria 1117
34 Ga0070705_100000588 3300005440 Bacteria 21155
35 Ga0070705_100001624 3300005440 Bacteria 11754
36 Ga0070700_100035970 3300005441 Bacteria 3000
37 Ga0070694_100058614 3300005444 Bacteria 2620
38 Ga0070694_100224463 3300005444 Bacteria 1410
39 Ga0070694_100305190 3300005444 Bacteria 1221
40 Ga0070694_100931258 3300005444 Bacteria 719
41 Ga0070678_100010086 3300005456 Bacteria 5751
42 Ga0070678_100518967 3300005456 Bacteria 1054
43 Ga0070678_101081897 3300005456 Bacteria 740
44 Ga0070662_100608728 3300005457 Bacteria 919
45 Ga0070662_100998712 3300005457 Bacteria 716
46 Ga0070681_10080059 3300005458 Unclassified 3223
47 Ga0070681_10143188 3300005458 Unclassified 2320
48 Ga0070681_10301058 3300005458 Bacteria 1513
49 Ga0068867_100009315 3300005459 Bacteria 6928
50 Ga0070706_100546435 3300005467 Bacteria 1077
51 Ga0070698_101377445 3300005471 Bacteria 656
52 Ga0070684_101362903 3300005535 Bacteria 668
53 Ga0070672_100078230 3300005543 Bacteria 2646
54 Ga0070695_100000246 3300005545 Bacteria 27003
55 Ga0070695_100002682 3300005545 Bacteria 10301
56 Ga0070696_100000481 3300005546 Bacteria 25041
57 Ga0070696_100014093 3300005546 Bacteria 5367
58 Ga0070696_100266723 3300005546 Bacteria 1300
59 Ga0070693_100358156 3300005547 Bacteria 1000
60 Ga0070665_100036489 3300005548 Bacteria 4944
61 Ga0070665_100062456 3300005548 Bacteria 3735
62 Ga0070704_100017104 3300005549 Bacteria 4602
63 Ga0070704_100086477 3300005549 Bacteria 2323
64 Ga0070704_100144532 3300005549 Bacteria 1862
65 Ga0070664_100286160 3300005564 Bacteria 1487
66 Ga0070664_100677853 3300005564 Unclassified 959
67 Ga0068854_100180364 3300005578 Bacteria 1649
68 Ga0070702_100148296 3300005615 Bacteria 1503
69 Ga0068859_101864427 3300005617 Bacteria 664
70 Ga0068864_100042674 3300005618 Bacteria 3881
71 Ga0068864_100185888 3300005618 Unclassified 1902
72 Ga0068866_10279691 3300005718 Bacteria 1033
73 Ga0068861_100004810 3300005719 Bacteria 9079
74 Ga0068861_100067871 3300005719 Bacteria 2754
75 Ga0068858_100042003 3300005842 Unclassified 4240
76 Ga0068862_100954018 3300005844 Bacteria 846
77 Ga0075365_10232021 3300006038 Bacteria 1296
78 Ga0075368_10012170 3300006042 Bacteria 3142
79 Ga0075364_10215419 3300006051 Bacteria 1302
80 Ga0070716_100110831 3300006173 Bacteria 1700
81 Ga0070716_100910387 3300006173 Bacteria 689
82 Ga0075362_10000215 3300006177 Bacteria 16155
83 Ga0075367_10002620 3300006178 Bacteria 8266
84 Ga0075367_10117034 3300006178 Bacteria 1640
85 Ga0075366_10022579 3300006195 Bacteria 3661
86 Ga0097621_100041925 3300006237 Bacteria 3686
87 Ga0068871_100081205 3300006358 Bacteria 2686
88 Ga0075430_100015099 3300006846 Bacteria 6574
89 Ga0075430_100058662 3300006846 Bacteria 3236
90 Ga0075431_100065308 3300006847 Bacteria 3758
91 Ga0075431_100113740 3300006847 Unclassified 2794
92 Ga0075433_10159233 3300006852 Bacteria 2009
93 Ga0097620_101864367 3300006931 Bacteria 664
94 Ga0075435_100137115 3300007076 Bacteria 2050
95 Ga0105240_10069886 3300009093 Unclassified 4345
96 Ga0105240_10152392 3300009093 Bacteria 2752
97 Ga0105240_10264837 3300009093 Unclassified 1981
98 Ga0111539_10008786 3300009094 Bacteria 12812
99 Ga0111539_10023293 3300009094 Bacteria 7607
100 Ga0111539_10054121 3300009094 Bacteria 4776
101 Ga0111539_10075772 3300009094 Bacteria 3962
102 Ga0111539_10085346 3300009094 Unclassified 3711
103 Ga0111539_10102985 3300009094 Bacteria 3350
104 Ga0111539_10442327 3300009094 Bacteria 1514
105 Ga0111539_11043791 3300009094 Unclassified 950
106 Ga0105245_10052526 3300009098 Bacteria 3655
107 Ga0105245_11100238 3300009098 Bacteria 841
108 Ga0105245_11113921 3300009098 Unclassified 836
109 Ga0114129_10037790 3300009147 Bacteria 6814
110 Ga0114129_10081862 3300009147 Bacteria 4487
111 Ga0114129_10105183 3300009147 Bacteria 3901
112 Ga0105243_10028143 3300009148 Bacteria 4312
113 Ga0105243_10574123 3300009148 Bacteria 1081
114 Ga0105243_11629086 3300009148 Unclassified 673
115 Ga0105242_10010753 3300009176 Bacteria 7025
116 Ga0105248_10005817 3300009177 Bacteria 13556
117 Ga0105248_10086042 3300009177 Bacteria 3536
118 Ga0105237_10306119 3300009545 Unclassified 1592
119 Ga0105249_10775553 3300009553 Unclassified 1022
120 Ga0105249_11601358 3300009553 Bacteria 724
121 Ga0105239_10279511 3300010375 Unclassified 1879
122 Ga0157374_10021532 3300013296 Bacteria 5739
123 Ga0157378_10521190 3300013297 Unclassified 1190
124 Ga0163162_11280122 3300013306 Unclassified 833
125 Ga0157372_10603467 3300013307 Bacteria 1279
126 Ga0163163_10075744 3300014325 Bacteria 3358
127 Ga0163163_10117428 3300014325 Bacteria 2692
128 Ga0163163_11376057 3300014325 Bacteria 767
129 Ga0157380_10228230 3300014326 Bacteria 1670
130 Ga0157379_10044102 3300014968 Unclassified 3981
131 Ga0157379_10348891 3300014968 Unclassified 1355
132 Ga0157376_10213183 3300014969 Bacteria 1784
133 Ga0157376_10239327 3300014969 Bacteria 1690
134 Ga0163161_10321108 3300017792 Bacteria 1224
135 Ga0206353_10327929 3300020082 Unclassified 1343
136 Ga0213876_10063789 3300021384 Bacteria 1945
137 Ga0207653_10078059 3300025885 Bacteria 1142
138 Ga0207682_10055999 3300025893 Bacteria 1641
139 Ga0207680_10194249 3300025903 Bacteria 1380
140 Ga0207645_10007382 3300025907 Bacteria 7775
141 Ga0207643_10194180 3300025908 Bacteria 1233
142 Ga0207707_10335164 3300025912 Bacteria 1305
143 Ga0207695_10116374 3300025913 Unclassified 2647
144 Ga0207695_10190336 3300025913 Bacteria 1969
145 Ga0207663_11007340 3300025916 Unclassified 668
146 Ga0207660_10589305 3300025917 Unclassified 905
147 Ga0207681_11211608 3300025923 Bacteria 634
148 Ga0207650_10018758 3300025925 Bacteria 4859
149 Ga0207650_10057482 3300025925 Bacteria 2893
150 Ga0207650_10421362 3300025925 Bacteria 1108
151 Ga0207659_10269207 3300025926 Bacteria 1389
152 Ga0207659_10983999 3300025926 Bacteria 726
153 Ga0207687_10122601 3300025927 Bacteria 1946
154 Ga0207687_10128485 3300025927 Bacteria 1906
155 Ga0207700_10042193 3300025928 Bacteria 3343
156 Ga0207664_10146806 3300025929 Bacteria 2001
157 Ga0207664_10256494 3300025929 Unclassified 1528
158 Ga0207690_10142859 3300025932 Unclassified 1766
159 Ga0207706_10686646 3300025933 Unclassified 875
160 Ga0207706_10744490 3300025933 Unclassified 835
161 Ga0207686_10206259 3300025934 Bacteria 1410
162 Ga0207709_10032199 3300025935 Bacteria 3068
163 Ga0207670_11062496 3300025936 Unclassified 683
164 Ga0207704_10773000 3300025938 Bacteria 800
165 Ga0207665_10127434 3300025939 Bacteria 1804
166 Ga0207691_10148730 3300025940 Bacteria 2060
167 Ga0207691_10518554 3300025940 Unclassified 1011
168 Ga0207711_10216026 3300025941 Bacteria 1752
169 Ga0207679_10509315 3300025945 Bacteria 1075
170 Ga0207679_10596314 3300025945 Unclassified 995
171 Ga0207651_10017575 3300025960 Bacteria 4228
172 Ga0207651_10120877 3300025960 Bacteria 1986
173 Ga0207640_10434851 3300025981 Bacteria 1077
174 Ga0207658_10392950 3300025986 Bacteria 1217
175 Ga0207677_10011382 3300026023 Bacteria 5071
176 Ga0207703_10008919 3300026035 Bacteria 7900
177 Ga0207703_10130585 3300026035 Bacteria 2169
178 Ga0207703_10279662 3300026035 Bacteria 1515
179 Ga0207708_10002632 3300026075 Bacteria 13204
180 Ga0207641_10841687 3300026088 Bacteria 909
181 Ga0207648_10003352 3300026089 Bacteria 16838
182 Ga0207676_10049646 3300026095 Bacteria 3266
183 Ga0207675_100002221 3300026118 Bacteria 19290
184 Ga0207683_10006406 3300026121 Bacteria 10082
185 Ga0207698_10798117 3300026142 Bacteria 946
186 Ga0209813_10071959 3300027866 Bacteria 1126
187 Ga0207428_10011125 3300027907 Bacteria 7987
188 Ga0207428_10014166 3300027907 Bacteria 6941
189 Ga0207428_10351248 3300027907 Bacteria 1085
190 Ga0268266_10007922 3300028379 Bacteria 9505
191 Ga0268266_10391324 3300028379 Bacteria 1313
192 Ga0268266_10682892 3300028379 Unclassified 989
193 Ga0268265_10621828 3300028380 Unclassified 1035
194 Ga0268265_11256023 3300028380 Bacteria 740
195 Ga0268265_11427116 3300028380 Bacteria 695
196 Ga0307408_100177683 3300031548 Bacteria 1704
197 Ga0307408_100180094 3300031548 Bacteria 1694
198 Ga0307408_100252638 3300031548 Bacteria 1455
199 Ga0307405_10087040 3300031731 Bacteria 2058
200 Ga0307405_10144854 3300031731 Bacteria 1662
201 Ga0307413_10249949 3300031824 Unclassified 1315
202 Ga0307413_10413066 3300031824 Bacteria 1061
203 Ga0307410_10117014 3300031852 Bacteria 1937
204 Ga0307410_10159855 3300031852 Bacteria 1687
205 Ga0307410_10196131 3300031852 Bacteria 1539
206 Ga0307410_10207525 3300031852 Bacteria 1499
207 Ga0307406_10521045 3300031901 Bacteria 967
208 Ga0307407_10125812 3300031903 Bacteria 1632
209 Ga0307407_10147970 3300031903 Archaea 1523
210 Ga0307407_10834164 3300031903 Bacteria 703
211 Ga0307412_10282806 3300031911 Bacteria 1303
212 Ga0307409_100047439 3300031995 Bacteria 3260
213 Ga0307409_100088672 3300031995 Bacteria 2526
214 Ga0307409_100103402 3300031995 Bacteria 2369
215 Ga0307409_100185008 3300031995 Bacteria 1848
216 Ga0307416_100180464 3300032002 Bacteria 1978
217 Ga0307416_100269626 3300032002 Unclassified 1670
218 Ga0307416_100287449 3300032002 Bacteria 1625
219 Ga0307416_100423512 3300032002 Bacteria 1376
220 Ga0307416_100426518 3300032002 Bacteria 1372
221 Ga0307416_100643967 3300032002 Bacteria 1144
222 Ga0307411_10317005 3300032005 Bacteria 1257
223 Ga0307411_11158352 3300032005 Bacteria 699
224 Ga0307415_100052489 3300032126 Bacteria 2773
225 Ga0307415_100278017 3300032126 Bacteria 1375
226 Ga0373926_0053576 3300035083 Bacteria 1460
227 Ga0373923_0406555 3300035111 Unclassified 656
228 Ga0373956_0298810 3300035119 Unclassified 767
229 Ga0373935_0034405 3300035692 Bacteria 3158
230 Ga0373937_0450680 3300036401 Bacteria 1222
231 Ga0373937_1460988 3300036401 Bacteria 631
232 Ga0373925_0199470 3300037068 Bacteria 1591
233 Ga0395900_0713241 3300037418 Bacteria 936
234 Ga0436365_0584726 3300039437 Bacteria 3006
235 Ga0450902_041480 3300042137 Unclassified 784
236 Ga0439435_0093866 3300042436 Unclassified 914
237 Ga0439460_0115537 3300042461 Bacteria 874
238 Ga0466963_0706761 3300044694 Bacteria 711
239 Ga0451576_0234077 3300045051 Bacteria 1918
240 Ga0495586_0182668 3300046535 Unclassified 1187
241 Ga0495598_0066796 3300046537 Unclassified 1123
242 Ga0495633_0210548 3300046558 Unclassified 891
243 Ga0495656_0212243 3300046615 Unclassified 965
244 Ga0495634_0152119 3300046642 Unclassified 1463
245 Ga0495635_0327249 3300046663 Bacteria 1025
246 Ga0495659_0142155 3300046664 Bacteria 958
247 Ga0495658_0560726 3300046683 Unclassified 731
248 Ga0495669_0326590 3300046684 Unclassified 741
249 Ga0495670_0025114 3300046691 Unclassified 2947
250 Ga0495674_0410117 3300047319 Bacteria 1093
251 Ga0495684_0496144 3300047471 Unclassified 840
252 Ga0496100_0581669 3300048903 Bacteria 868
253 Ga0496101_0871898 3300048904 Unclassified 709
254 Ga0496104_0122730 3300048907 Bacteria 2494
255 Ga0496105_0835071 3300048908 Unclassified 698
256 Ga0496106_0383443 3300048909 Bacteria 1129
257 Ga0496107_0255379 3300048910 Bacteria 1304
258 Ga0496112_0069720 3300048915 Unclassified 3473
259 Ga0496112_0773240 3300048915 Unclassified 886
260 Ga0496112_1000363 3300048915 Unclassified 756
261 Ga0496113_0690013 3300048916 Unclassified 815
262 Ga0496114_0055680 3300048917 Bacteria 3299
263 Ga0501292_003079 3300049515 Bacteria 2201
264 Ga0501295_112043 3300049518 Unclassified 649
265 Ga0501036_0122966 3300049572 Unclassified 2192
266 Ga0501039_0215248 3300049575 Unclassified 1511
267 Ga0501041_0013573 3300049577 Bacteria 4832
268 Ga0501041_0270416 3300049577 Bacteria 1069
269 Ga0501042_0043112 3300049578 Bacteria 3212
270 Ga0501043_0822938 3300049579 Bacteria 670
271 Ga0501048_0084870 3300049582 Bacteria 2233
272 Ga0501069_0268273 3300049585 Bacteria 997
273 Ga0501071_0057033 3300049587 Unclassified 2822
274 Ga0501072_0029139 3300049588 Unclassified 4310
275 Ga0501072_0193378 3300049588 Bacteria 1622
276 Ga0501074_0097157 3300049590 Bacteria 2109
277 Ga0501075_0017275 3300049591 Bacteria 5210
278 Ga0501076_0092852 3300049592 Bacteria 2428
279 Ga0501077_0075673 3300049593 Bacteria 2132
280 Ga0501077_0907361 3300049593 Unclassified 567
281 Ga0501202_001672 3300049652 Bacteria 3591
282 Ga0501209_150403 3300049656 Unclassified 701
283 Ga0501216_020329 3300049660 Bacteria 1159
284 Ga0501217_001756 3300049661 Bacteria 4142
285 Ga0501224_011105 3300049664 Bacteria 1324
286 Ga0501230_003797 3300049667 Bacteria 2035
287 Ga0501230_085526 3300049667 Unclassified 665
288 Ga0501233_003621 3300049668 Unclassified 2786
289 Ga0501235_007643 3300049669 Bacteria 2356
290 Ga0501242_035530 3300049674 Bacteria 689
291 Ga0501243_007985 3300049675 Bacteria 1626
292 Ga0501247_058133 3300049677 Unclassified 588
293 Ga0501249_010573 3300049679 Bacteria 1933
294 Ga0501249_032803 3300049679 Bacteria 1162
295 Ga0501257_003595 3300049686 Unclassified 3341
296 Ga0501258_036801 3300049687 Bacteria 639
297 Ga0501259_007710 3300049688 Bacteria 1725
298 Ga0501260_025639 3300049689 Unclassified 658
299 Ga0501234_007373 3300049707 Bacteria 1723
300 Ga0501079_0143866 3300049741 Bacteria 1858
301 Ga0501080_0134361 3300049742 Unclassified 2290
302 Ga0501081_0305990 3300049743 Bacteria 1166
303 Ga0501262_067206 3300049759 Unclassified 581
304 Ga0501268_001007 3300049765 Unclassified 3351
305 Ga0501279_082843 3300049775 Unclassified 556
306 Ga0501035_0493359 3300049822 Bacteria 1009
307 Ga0501035_0802510 3300049822 Unclassified 752
308 Ga0501044_0721460 3300049823 Bacteria 881
309 Ga0501045_0817959 3300049824 Unclassified 686
310 Ga0501212_031202 3300049851 Bacteria 860
311 nmdc:mga00v17_15572_c1 3300050491 Bacteria 3199
312 nmdc:mga0yw44_62064_c1 3300050492 Bacteria 2294
313 nmdc:mga0k408_1613_c1 3300050493 Bacteria 12204
314 nmdc:mga06z11_1755_c1 3300050494 Bacteria 8152
315 nmdc:mga04h51_48483_c1 3300050495 Unclassified 1416
316 nmdc:mga05p37_88611_c1 3300050507 Bacteria 3814
317 nmdc:mga09592_1109726_c1 3300050508 Unclassified 657
318 nmdc:mga09592_11334_c1 3300050508 Bacteria 7249
319 nmdc:mga09592_1249121_c1 3300050508 Unclassified 612
320 nmdc:mga0qj67_128487_c1 3300050509 Unclassified 2051
321 nmdc:mga0qj67_289856_c1 3300050509 Bacteria 1327
322 nmdc:mga0qj67_8282_c1 3300050509 Bacteria 7709
323 nmdc:mga06r32_106950_c1 3300050510 Bacteria 2749
324 nmdc:mga06r32_522707_c1 3300050510 Bacteria 1162
325 nmdc:mga08y16_13347_c1 3300050511 Bacteria 8642
326 nmdc:mga08y16_1471_c1 3300050511 Bacteria 23637
327 nmdc:mga08y16_1685200_c1 3300050511 Bacteria 590
328 nmdc:mga08y16_659441_c1 3300050511 Unclassified 1050
329 nmdc:mga08y16_760691_c1 3300050511 Bacteria 964
330 nmdc:mga08y16_888443_c1 3300050511 Bacteria 878
331 nmdc:mga08y16_97780_c1 3300050511 Unclassified 3057
332 nmdc:mga0a205_319004_c1 3300050515 Bacteria 1078
333 nmdc:mga0sz30_325054_c1 3300050516 Unclassified 687
334 Ga0501084_0023874 3300054114 Bacteria 5101
335 Ga0501084_0608950 3300054114 Unclassified 923
336 Ga0501082_0228671 3300060353 Bacteria 1619
337 Ga0530510_0004555 3300061734 Bacteria 9590
338 Ga0530510_0353010 3300061734 Bacteria 1105
339 Ga0157375_11198263
340 JGI24751J29686_10023651
341 Ga0065715_10105954
342 Ga0065715_10765356
343 Ga0065707_10091294
344 Ga0070690_100166827
345 Ga0070670_100016272
346 Ga0070670_100096308
347 Ga0070677_10018950
348 Ga0070666_10040594
349 Ga0070666_10315784
350 Ga0070682_100139028
351 Ga0068868_100002345
352 Ga0070689_100251812
353 Ga0070691_10000205
354 Ga0070668_100699263
355 Ga0070675_100288721
356 Ga0070675_100519821
357 Ga0070675_100608658
358 Ga0070675_101117819
359 Ga0070671_100110522
360 Ga0070674_100344313
361 Ga0070674_100580548
362 Ga0070674_101086493
363 Ga0070673_100048236
364 Ga0070673_100078927
365 Ga0070688_100024707
366 Ga0070688_100202007
367 Ga0070659_100173750
368 Ga0070667_100039952
369 Ga0070703_10056958
370 Ga0070713_100006819
371 Ga0070710_10260796
372 Ga0070705_100000588
373 Ga0070705_100001624
374 Ga0070700_100035970
375 Ga0070694_100058614
376 Ga0070694_100224463
377 Ga0070694_100305190
378 Ga0070694_100931258
379 Ga0070678_100010086
380 Ga0070678_100518967
381 Ga0070678_101081897
382 Ga0070662_100608728
383 Ga0070662_100998712
384 Ga0070681_10080059
385 Ga0070681_10143188
386 Ga0070681_10301058
387 Ga0068867_100009315
388 Ga0070706_100546435
389 Ga0070698_101377445
390 Ga0070684_101362903
391 Ga0070672_100078230
392 Ga0070695_100000246
393 Ga0070695_100002682
394 Ga0070696_100000481
395 Ga0070696_100014093
396 Ga0070696_100266723
397 Ga0070693_100358156
398 Ga0070665_100036489
399 Ga0070665_100062456
400 Ga0070704_100017104
401 Ga0070704_100086477
402 Ga0070704_100144532
403 Ga0070664_100286160
404 Ga0070664_100677853
405 Ga0068854_100180364
406 Ga0070702_100148296
407 Ga0068859_101864427
408 Ga0068864_100042674
409 Ga0068864_100185888
410 Ga0068866_10279691
411 Ga0068861_100004810
412 Ga0068861_100067871
413 Ga0068858_100042003
414 Ga0068862_100954018
415 Ga0075365_10232021
416 Ga0075368_10012170
417 Ga0075364_10215419
418 Ga0070716_100110831
419 Ga0070716_100910387
420 Ga0075362_10000215
421 Ga0075367_10002620
422 Ga0075367_10117034
423 Ga0075366_10022579
424 Ga0097621_100041925
425 Ga0068871_100081205
426 Ga0075430_100015099
427 Ga0075430_100058662
428 Ga0075431_100065308
429 Ga0075431_100113740
430 Ga0075433_10159233
431 Ga0097620_101864367
432 Ga0075435_100137115
433 Ga0105240_10069886
434 Ga0105240_10152392
435 Ga0105240_10264837
436 Ga0111539_10008786
437 Ga0111539_10023293
438 Ga0111539_10054121
439 Ga0111539_10075772
440 Ga0111539_10085346
441 Ga0111539_10102985
442 Ga0111539_10442327
443 Ga0111539_11043791
444 Ga0105245_10052526
445 Ga0105245_11100238
446 Ga0105245_11113921
447 Ga0114129_10037790
448 Ga0114129_10081862
449 Ga0114129_10105183
450 Ga0105243_10028143
451 Ga0105243_10574123
452 Ga0105243_11629086
453 Ga0105242_10010753
454 Ga0105248_10005817
455 Ga0105248_10086042
456 Ga0105237_10306119
457 Ga0105249_10775553
458 Ga0105249_11601358
459 Ga0105239_10279511
460 Ga0157374_10021532
461 Ga0157378_10521190
462 Ga0163162_11280122
463 Ga0157372_10603467
464 Ga0163163_10075744
465 Ga0163163_10117428
466 Ga0163163_11376057
467 Ga0157380_10228230
468 Ga0157379_10044102
469 Ga0157379_10348891
470 Ga0157376_10213183
471 Ga0157376_10239327
472 Ga0163161_10321108
473 Ga0206353_10327929
474 Ga0213876_10063789
475 Ga0207653_10078059
476 Ga0207682_10055999
477 Ga0207680_10194249
478 Ga0207645_10007382
479 Ga0207643_10194180
480 Ga0207707_10335164
481 Ga0207695_10116374
482 Ga0207695_10190336
483 Ga0207663_11007340
484 Ga0207660_10589305
485 Ga0207681_11211608
486 Ga0207650_10018758
487 Ga0207650_10057482
488 Ga0207650_10421362
489 Ga0207659_10269207
490 Ga0207659_10983999
491 Ga0207687_10122601
492 Ga0207687_10128485
493 Ga0207700_10042193
494 Ga0207664_10146806
495 Ga0207664_10256494
496 Ga0207690_10142859
497 Ga0207706_10686646
498 Ga0207706_10744490
499 Ga0207686_10206259
500 Ga0207709_10032199
501 Ga0207670_11062496
502 Ga0207704_10773000
503 Ga0207665_10127434
504 Ga0207691_10148730
505 Ga0207691_10518554
506 Ga0207711_10216026
507 Ga0207679_10509315
508 Ga0207679_10596314
509 Ga0207651_10017575
510 Ga0207651_10120877
511 Ga0207640_10434851
512 Ga0207658_10392950
513 Ga0207677_10011382
514 Ga0207703_10008919
515 Ga0207703_10130585
516 Ga0207703_10279662
517 Ga0207708_10002632
518 Ga0207641_10841687
519 Ga0207648_10003352
520 Ga0207676_10049646
521 Ga0207675_100002221
522 Ga0207683_10006406
523 Ga0207698_10798117
524 Ga0209813_10071959
525 Ga0207428_10011125
526 Ga0207428_10014166
527 Ga0207428_10351248
528 Ga0268266_10007922
529 Ga0268266_10391324
530 Ga0268266_10682892
531 Ga0268265_10621828
532 Ga0268265_11256023
533 Ga0268265_11427116
534 Ga0307408_100177683
535 Ga0307408_100180094
536 Ga0307408_100252638
537 Ga0307405_10087040
538 Ga0307405_10144854
539 Ga0307413_10249949
540 Ga0307413_10413066
541 Ga0307410_10117014
542 Ga0307410_10159855
543 Ga0307410_10196131
544 Ga0307410_10207525
545 Ga0307406_10521045
546 Ga0307407_10125812
547 Ga0307407_10147970
548 Ga0307407_10834164
549 Ga0307412_10282806
550 Ga0307409_100047439
551 Ga0307409_100088672
552 Ga0307409_100103402
553 Ga0307409_100185008
554 Ga0307416_100180464
555 Ga0307416_100269626
556 Ga0307416_100287449
557 Ga0307416_100423512
558 Ga0307416_100426518
559 Ga0307416_100643967
560 Ga0307411_10317005
561 Ga0307411_11158352
562 Ga0307415_100052489
563 Ga0307415_100278017
564 Ga0373926_0053576
565 Ga0373923_0406555
566 Ga0373956_0298810
567 Ga0373935_0034405
568 Ga0373937_0450680
569 Ga0373937_1460988
570 Ga0373925_0199470
571 Ga0395900_0713241
572 Ga0436365_0584726
573 Ga0450902_041480
574 Ga0439435_0093866
575 Ga0439460_0115537
576 Ga0466963_0706761
577 Ga0451576_0234077
578 Ga0495586_0182668
579 Ga0495598_0066796
580 Ga0495633_0210548
581 Ga0495656_0212243
582 Ga0495634_0152119
583 Ga0495635_0327249
584 Ga0495659_0142155
585 Ga0495658_0560726
586 Ga0495669_0326590
587 Ga0495670_0025114
588 Ga0495674_0410117
589 Ga0495684_0496144
590 Ga0496100_0581669
591 Ga0496101_0871898
592 Ga0496104_0122730
593 Ga0496105_0835071
594 Ga0496106_0383443
595 Ga0496107_0255379
596 Ga0496112_0069720
597 Ga0496112_0773240
598 Ga0496112_1000363
599 Ga0496113_0690013
600 Ga0496114_0055680
601 Ga0501292_003079
602 Ga0501295_112043
603 Ga0501036_0122966
604 Ga0501039_0215248
605 Ga0501041_0013573
606 Ga0501041_0270416
607 Ga0501042_0043112
608 Ga0501043_0822938
609 Ga0501048_0084870
610 Ga0501069_0268273
611 Ga0501071_0057033
612 Ga0501072_0029139
613 Ga0501072_0193378
614 Ga0501074_0097157
615 Ga0501075_0017275
616 Ga0501076_0092852
617 Ga0501077_0075673
618 Ga0501077_0907361
619 Ga0501202_001672
620 Ga0501209_150403
621 Ga0501216_020329
622 Ga0501217_001756
623 Ga0501224_011105
624 Ga0501230_003797
625 Ga0501230_085526
626 Ga0501233_003621
627 Ga0501235_007643
628 Ga0501242_035530
629 Ga0501243_007985
630 Ga0501247_058133
631 Ga0501249_010573
632 Ga0501249_032803
633 Ga0501257_003595
634 Ga0501258_036801
635 Ga0501259_007710
636 Ga0501260_025639
637 Ga0501234_007373
638 Ga0501079_0143866
639 Ga0501080_0134361
640 Ga0501081_0305990
641 Ga0501262_067206
642 Ga0501268_001007
643 Ga0501279_082843
644 Ga0501035_0493359
645 Ga0501035_0802510
646 Ga0501044_0721460
647 Ga0501045_0817959
648 Ga0501212_031202
649 nmdc:mga00v17_15572_c1
650 nmdc:mga0yw44_62064_c1
651 nmdc:mga0k408_1613_c1
652 nmdc:mga06z11_1755_c1
653 nmdc:mga04h51_48483_c1
654 nmdc:mga05p37_88611_c1
655 nmdc:mga09592_1109726_c1
656 nmdc:mga09592_11334_c1
657 nmdc:mga09592_1249121_c1
658 nmdc:mga0qj67_128487_c1
659 nmdc:mga0qj67_289856_c1
660 nmdc:mga0qj67_8282_c1
661 nmdc:mga06r32_106950_c1
662 nmdc:mga06r32_522707_c1
663 nmdc:mga08y16_13347_c1
664 nmdc:mga08y16_1471_c1
665 nmdc:mga08y16_1685200_c1
666 nmdc:mga08y16_659441_c1
667 nmdc:mga08y16_760691_c1
668 nmdc:mga08y16_888443_c1
669 nmdc:mga08y16_97780_c1
670 nmdc:mga0a205_319004_c1
671 nmdc:mga0sz30_325054_c1
672 Ga0501084_0023874
673 Ga0501084_0608950
674 Ga0501082_0228671
675 Ga0530510_0004555
676 Ga0530510_0353010

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
2p1a-assembly1.cif.gz_A crystal structure of a putative metal-binding protein (bce_2162) from bacillus cereus atcc 10987 at 2.10 a resolution 0.6625 8 150
4x8e-assembly2.cif.gz_B ergothioneine-biosynthetic sulfoxide synthase egtb in complex with n,n,n-trimethyl-histidine 0.6375 7 150
2p1a-assembly1.cif.gz_A crystal structure of a putative metal-binding protein (bce_2162) from bacillus cereus atcc 10987 at 2.10 a resolution 0.6309 8 150
5civ-assembly1.cif.gz_A sibling lethal factor precursor - dfsb 0.6057 1 157
3gor-assembly2.cif.gz_D crystal structure of putative metal-dependent hydrolase apc36150 0.6047 37 162
ID Description Score Start End Superfamily
af_P71985_5_134_1.20.120.450 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.6794 10 150 1.20.120.450
af_P71985_5_134_1.20.120.450 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.657 10 150 1.20.120.450
2nsgA01 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.6214 5 147 1.20.120.450
3dkaA01 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.6029 37 147 1.20.120.450
af_P9WM91_7_150_1.20.120.450 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.5952 36 146 1.20.120.450
ID Description Score Start End GO Terms
AF-A0A7X7PEV9-F1-model_v4 DinB family protein 0.9603 1 162
AF-A0A7X7PEV9-F1-model_v4 DinB family protein 0.9545 1 162
AF-A0A843TD62-F1-model_v4 DinB-like domain-containing protein 0.9459 29 159
AF-A0A838QYC2-F1-model_v4 DinB family protein 0.945 3 153
AF-A0A7V0UE95-F1-model_v4 DinB-like domain-containing protein 0.9443 7 153

Map