F413480

General Info

Members Datasets Scaffolds Average Seq Length
338 195 658 149

Family's Representative Sequence

Representative Sequence 3300009147|Ga0114129_10000023|Ga0114129_100000236
Length 163
Sequence VPTPHSHDGADRVVTVAPPRRSADLNVTPLIDVLLVLLIIFMAALPLTQRGLDVSLPDTVAPRDAPPDVSSHIVAEYGADRRLTINHQAVALPDAAARFREIYRERRDRTLYVIGDGSVPYGEILAVIDAARGAGVVKVGIVTEEMREEAANDRPRAIGRRPE

Samples

Sample ID Description Type Environment
1 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003544 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_33 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
4 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
24 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
25 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
26 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
27 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
31 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
32 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
33 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
34 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
35 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
36 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
37 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
38 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
39 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
40 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
41 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
42 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
43 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
44 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
45 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
46 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
47 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
48 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
49 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
50 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
51 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
52 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
53 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
54 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
55 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
56 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
57 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
59 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
60 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
61 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
62 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
63 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
64 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
65 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
67 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
69 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
70 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
71 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
72 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
73 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
74 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
75 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
76 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
77 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
78 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
79 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
80 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
81 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
108 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
112 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
113 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
114 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
115 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
116 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
117 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
118 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
119 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
120 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
121 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
122 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
123 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
124 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
125 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
126 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
127 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
128 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
129 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
130 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
131 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
132 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
133 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
134 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
135 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
136 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
137 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
138 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
139 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
140 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
141 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
142 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
143 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
144 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
145 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
146 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
147 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
148 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
149 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
150 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
151 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
152 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
153 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
154 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
155 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
156 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
157 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
158 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
159 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
160 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
161 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
162 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
163 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
164 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
165 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
166 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
167 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
168 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
169 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
170 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
171 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
172 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
173 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
174 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
175 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
176 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
177 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
178 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
179 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
180 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
181 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
182 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
183 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
184 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
185 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
186 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
187 3300059507 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
188 3300059512 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
189 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
190 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
191 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
192 3300059658 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 178R_AW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
193 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
194 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
195 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.27
Metatranscriptomes 4.73
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.59
Nodule 0
Rhizoplane 0.89
Rhizosphere 97.63
Stem 0
Stem Tuber 0
Unclassified 9.76

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0114129_10000023 3300009147 Bacteria 116820
2 JGI25406J46586_10031125 3300003203 Bacteria 2000
3 JGI25406J46586_10091458 3300003203 Bacteria 918
4 Ga0007417J51691_1016316 3300003544 Bacteria 948
5 Ga0058860_10039543 3300004801 Bacteria 1329
6 Ga0058860_12201309 3300004801 Bacteria 1190
7 Ga0065712_10026920 3300005290 Bacteria 1246
8 Ga0065712_10083644 3300005290 Bacteria 2821
9 Ga0065715_10172394 3300005293 Bacteria 1537
10 Ga0065715_10350374 3300005293 Bacteria 952
11 Ga0065707_10006308 3300005295 Bacteria 2602
12 Ga0070658_10246322 3300005327 Bacteria 1516
13 Ga0070690_100494934 3300005330 Bacteria 914
14 Ga0070670_100079212 3300005331 Bacteria 2823
15 Ga0070677_10185630 3300005333 Bacteria 994
16 Ga0070680_100751605 3300005336 Bacteria 840
17 Ga0070689_100032219 3300005340 Bacteria 3985
18 Ga0070691_10032529 3300005341 Bacteria 2451
19 Ga0070687_100022370 3300005343 Bacteria 2988
20 Ga0070661_100232365 3300005344 Bacteria 1418
21 Ga0070669_100188244 3300005353 Bacteria 1618
22 Ga0070669_100999543 3300005353 Unclassified 718
23 Ga0070669_101138817 3300005353 Bacteria 673
24 Ga0070675_100006815 3300005354 Bacteria 8773
25 Ga0070675_100010464 3300005354 Bacteria 7247
26 Ga0070675_100286291 3300005354 Bacteria 1449
27 Ga0070675_100909422 3300005354 Bacteria 807
28 Ga0070675_101769849 3300005354 Bacteria 570
29 Ga0070671_100281774 3300005355 Bacteria 1414
30 Ga0070674_100005123 3300005356 Bacteria 7535
31 Ga0070674_101148528 3300005356 Bacteria 688
32 Ga0070688_100063895 3300005365 Bacteria 2335
33 Ga0070659_100739123 3300005366 Bacteria 853
34 Ga0070713_100022141 3300005436 Bacteria 4906
35 Ga0070713_100466975 3300005436 Bacteria 1187
36 Ga0070701_10063537 3300005438 Bacteria 1954
37 Ga0070701_10124582 3300005438 Bacteria 1457
38 Ga0070701_10226832 3300005438 Bacteria 1117
39 Ga0070705_100000075 3300005440 Bacteria 54228
40 Ga0070705_100015477 3300005440 Bacteria 3945
41 Ga0070705_100373178 3300005440 Bacteria 1047
42 Ga0070700_100001638 3300005441 Bacteria 11194
43 Ga0070700_100071348 3300005441 Bacteria 2217
44 Ga0070700_100148920 3300005441 Bacteria 1599
45 Ga0070700_100284781 3300005441 Bacteria 1200
46 Ga0070700_100451152 3300005441 Bacteria 979
47 Ga0070700_100642496 3300005441 Bacteria 837
48 Ga0070700_101339180 3300005441 Bacteria 603
49 Ga0070694_100019973 3300005444 Bacteria 4267
50 Ga0070694_100216136 3300005444 Bacteria 1436
51 Ga0070694_100465146 3300005444 Bacteria 1001
52 Ga0070694_100472281 3300005444 Unclassified 994
53 Ga0070662_100905814 3300005457 Unclassified 752
54 Ga0068867_100297869 3300005459 Bacteria 1329
55 Ga0068867_100653873 3300005459 Bacteria 922
56 Ga0070685_10065055 3300005466 Bacteria 2146
57 Ga0070685_10512212 3300005466 Bacteria 851
58 Ga0070706_100418215 3300005467 Bacteria 1248
59 Ga0070707_100094327 3300005468 Bacteria 2898
60 Ga0070698_100002432 3300005471 Bacteria 20518
61 Ga0070699_100009002 3300005518 Bacteria 8649
62 Ga0070699_100012290 3300005518 Bacteria 7386
63 Ga0070699_100169070 3300005518 Bacteria 1937
64 Ga0070699_100380914 3300005518 Bacteria 1274
65 Ga0070699_101539157 3300005518 Bacteria 610
66 Ga0070697_100113667 3300005536 Bacteria 2259
67 Ga0070672_100038728 3300005543 Bacteria 3646
68 Ga0070686_100110928 3300005544 Bacteria 1869
69 Ga0070695_100002719 3300005545 Bacteria 10249
70 Ga0070695_100003606 3300005545 Bacteria 9034
71 Ga0070695_101080631 3300005545 Bacteria 656
72 Ga0070695_101706178 3300005545 Unclassified 527
73 Ga0070696_100007190 3300005546 Bacteria 7435
74 Ga0070696_100021157 3300005546 Bacteria 4410
75 Ga0070696_101289811 3300005546 Bacteria 620
76 Ga0070704_100007717 3300005549 Bacteria 6414
77 Ga0070704_100118493 3300005549 Bacteria 2028
78 Ga0070704_100128522 3300005549 Bacteria 1959
79 Ga0070664_100025141 3300005564 Bacteria 4934
80 Ga0070664_100288658 3300005564 Bacteria 1481
81 Ga0070664_100893597 3300005564 Bacteria 833
82 Ga0068857_101162112 3300005577 Bacteria 747
83 Ga0070702_100587298 3300005615 Bacteria 833
84 Ga0070702_101212049 3300005615 Unclassified 609
85 Ga0068852_100870476 3300005616 Bacteria 917
86 Ga0068859_100051771 3300005617 Bacteria 4128
87 Ga0068864_100012348 3300005618 Bacteria 7059
88 Ga0068861_100036988 3300005719 Bacteria 3627
89 Ga0068863_100408621 3300005841 Bacteria 1329
90 Ga0068858_100545966 3300005842 Unclassified 1122
91 Ga0068860_100374397 3300005843 Bacteria 1405
92 Ga0081455_10380025 3300005937 Unclassified 987
93 Ga0081539_10005027 3300005985 Bacteria 13921
94 Ga0081539_10010688 3300005985 Bacteria 7400
95 Ga0070717_10060920 3300006028 Bacteria 3126
96 Ga0075368_10052652 3300006042 Bacteria 1620
97 Ga0070712_100337729 3300006175 Bacteria 1229
98 Ga0075367_10360185 3300006178 Bacteria 918
99 Ga0097621_100212644 3300006237 Bacteria 1682
100 Ga0068871_101153438 3300006358 Unclassified 726
101 Ga0068871_101167008 3300006358 Bacteria 722
102 Ga0075428_100331424 3300006844 Bacteria 1635
103 Ga0075431_100609945 3300006847 Bacteria 1075
104 Ga0075433_10021058 3300006852 Bacteria 5462
105 Ga0075433_10089405 3300006852 Bacteria 2722
106 Ga0075433_10167672 3300006852 Unclassified 1954
107 Ga0075433_10446264 3300006852 Bacteria 1140
108 Ga0075433_10968087 3300006852 Bacteria 742
109 Ga0075434_100009496 3300006871 Bacteria 9074
110 Ga0075434_100070007 3300006871 Bacteria 3498
111 Ga0075434_100260902 3300006871 Bacteria 1752
112 Ga0075434_100621220 3300006871 Bacteria 1099
113 Ga0075434_100698542 3300006871 Bacteria 1032
114 Ga0075429_100751472 3300006880 Unclassified 854
115 Ga0068865_101007207 3300006881 Bacteria 730
116 Ga0097620_100051773 3300006931 Bacteria 4128
117 Ga0075435_100045867 3300007076 Bacteria 3505
118 Ga0111539_10017277 3300009094 Bacteria 8928
119 Ga0111539_10027989 3300009094 Bacteria 6884
120 Ga0111539_10371954 3300009094 Bacteria 1663
121 Ga0111539_10909960 3300009094 Bacteria 1023
122 Ga0111539_11277303 3300009094 Bacteria 852
123 Ga0111539_12265104 3300009094 Unclassified 630
124 Ga0114129_10004994 3300009147 Bacteria 18697
125 Ga0114129_10021972 3300009147 Bacteria 9055
126 Ga0114129_11125011 3300009147 Bacteria 982
127 Ga0114129_11188512 3300009147 Unclassified 950
128 Ga0114129_11546368 3300009147 Bacteria 814
129 Ga0105243_10420182 3300009148 Unclassified 1247
130 Ga0105241_10533208 3300009174 Bacteria 1051
131 Ga0105242_10071036 3300009176 Bacteria 2888
132 Ga0105248_11188305 3300009177 Unclassified 862
133 Ga0105249_10055754 3300009553 Bacteria 3617
134 Ga0105249_10601606 3300009553 Unclassified 1154
135 Ga0105246_10469356 3300011119 Bacteria 1062
136 Ga0157378_11806481 3300013297 Bacteria 659
137 Ga0163162_11517535 3300013306 Bacteria 763
138 Ga0157375_10377543 3300013308 Bacteria 1584
139 Ga0163163_10035654 3300014325 Bacteria 4827
140 Ga0157380_10051890 3300014326 Bacteria 3246
141 Ga0157380_10411216 3300014326 Unclassified 1287
142 Ga0157377_11446633 3300014745 Bacteria 544
143 Ga0157379_11034340 3300014968 Unclassified 784
144 Ga0207653_10042542 3300025885 Bacteria 1494
145 Ga0207682_10054586 3300025893 Bacteria 1660
146 Ga0207705_10229407 3300025909 Bacteria 1412
147 Ga0207705_10269875 3300025909 Bacteria 1301
148 Ga0207684_10898996 3300025910 Bacteria 744
149 Ga0207646_10372297 3300025922 Bacteria 1290
150 Ga0207646_10613251 3300025922 Bacteria 976
151 Ga0207681_10709060 3300025923 Unclassified 837
152 Ga0207650_10006718 3300025925 Bacteria 7844
153 Ga0207650_10360337 3300025925 Bacteria 1198
154 Ga0207650_11869492 3300025925 Bacteria 507
155 Ga0207700_10015466 3300025928 Bacteria 5034
156 Ga0207700_10303482 3300025928 Bacteria 1379
157 Ga0207644_10288990 3300025931 Bacteria 1318
158 Ga0207706_10128278 3300025933 Bacteria 2231
159 Ga0207706_10135059 3300025933 Bacteria 2170
160 Ga0207686_10049480 3300025934 Bacteria 2609
161 Ga0207709_10037446 3300025935 Bacteria 2883
162 Ga0207670_10313545 3300025936 Bacteria 1232
163 Ga0207669_10591440 3300025937 Bacteria 901
164 Ga0207704_10149813 3300025938 Bacteria 1644
165 Ga0207691_10054165 3300025940 Bacteria 3660
166 Ga0207679_10376168 3300025945 Bacteria 1244
167 Ga0207679_11529090 3300025945 Bacteria 612
168 Ga0207651_10042733 3300025960 Bacteria 3019
169 Ga0207712_10839155 3300025961 Bacteria 809
170 Ga0207708_10017894 3300026075 Bacteria 5333
171 Ga0207708_10046992 3300026075 Bacteria 3288
172 Ga0207708_10047709 3300026075 Bacteria 3260
173 Ga0207708_10173130 3300026075 Bacteria 1711
174 Ga0207708_10228994 3300026075 Bacteria 1492
175 Ga0207708_10828787 3300026075 Bacteria 798
176 Ga0207641_10323477 3300026088 Bacteria 1463
177 Ga0207648_10146742 3300026089 Bacteria 2081
178 Ga0207648_10320982 3300026089 Bacteria 1392
179 Ga0207676_10554257 3300026095 Bacteria 1098
180 Ga0207676_11526647 3300026095 Bacteria 665
181 Ga0207674_10331474 3300026116 Bacteria 1472
182 Ga0207674_10474979 3300026116 Bacteria 1208
183 Ga0207675_100009516 3300026118 Bacteria 9091
184 Ga0207683_11213012 3300026121 Bacteria 699
185 Ga0207428_10006834 3300027907 Bacteria 10462
186 Ga0207428_10073472 3300027907 Bacteria 2683
187 Ga0268266_11568905 3300028379 Bacteria 634
188 Ga0268265_10349938 3300028380 Unclassified 1349
189 Ga0268264_10114784 3300028381 Bacteria 2365
190 Ga0307511_10391499 3300030521 Unclassified 576
191 Ga0307408_100167117 3300031548 Bacteria 1753
192 Ga0307408_100767891 3300031548 Bacteria 872
193 Ga0307405_10513210 3300031731 Bacteria 963
194 Ga0307405_11439720 3300031731 Unclassified 604
195 Ga0307413_10544439 3300031824 Bacteria 940
196 Ga0307413_10635675 3300031824 Bacteria 878
197 Ga0307410_10050740 3300031852 Bacteria 2792
198 Ga0307410_10206162 3300031852 Bacteria 1504
199 Ga0307410_10554077 3300031852 Bacteria 953
200 Ga0307407_10011246 3300031903 Bacteria 4252
201 Ga0307409_100061897 3300031995 Bacteria 2927
202 Ga0307409_100071731 3300031995 Bacteria 2755
203 Ga0307409_100254214 3300031995 Bacteria 1608
204 Ga0307409_100673184 3300031995 Bacteria 1031
205 Ga0307409_100982398 3300031995 Bacteria 862
206 Ga0307416_100911619 3300032002 Bacteria 979
207 Ga0307416_101198614 3300032002 Bacteria 865
208 Ga0307416_101979187 3300032002 Bacteria 685
209 Ga0307411_10025018 3300032005 Bacteria 3569
210 Ga0307411_10683062 3300032005 Bacteria 892
211 Ga0373959_0197367 3300034820 Bacteria 530
212 Ga0373934_0011980 3300035086 Bacteria 3271
213 Ga0373923_0180564 3300035111 Bacteria 970
214 Ga0373936_0467699 3300035113 Bacteria 584
215 Ga0373954_0365052 3300035118 Bacteria 713
216 Ga0373956_0013635 3300035119 Bacteria 3383
217 Ga0373943_0493345 3300035170 Unclassified 715
218 Ga0373955_0003212 3300035172 Bacteria 7163
219 Ga0373924_0193947 3300035410 Bacteria 895
220 Ga0373933_0052117 3300035724 Bacteria 2447
221 Ga0373933_0063669 3300035724 Bacteria 2230
222 Ga0373933_0210901 3300035724 Bacteria 1244
223 Ga0373937_0001942 3300036401 Bacteria 17300
224 Ga0373937_0025235 3300036401 Bacteria 5367
225 Ga0373937_0470636 3300036401 Bacteria 1193
226 Ga0373925_0002869 3300037068 Bacteria 13611
227 Ga0373925_0081927 3300037068 Bacteria 2455
228 Ga0450923_015066 3300042125 Bacteria 1441
229 Ga0439435_0077603 3300042436 Bacteria 992
230 Ga0439444_0004293 3300042437 Bacteria 2065
231 Ga0450916_033168 3300042530 Bacteria 759
232 Ga0453684_0016537 3300044712 Bacteria 11519
233 Ga0495629_0083885 3300046459 Bacteria 2224
234 Ga0495653_0427670 3300046463 Bacteria 837
235 Ga0495582_0384778 3300046473 Bacteria 809
236 Ga0495663_0316379 3300046525 Bacteria 564
237 Ga0495665_0400286 3300046531 Bacteria 696
238 Ga0495598_0064125 3300046537 Bacteria 1141
239 Ga0495598_0155697 3300046537 Bacteria 801
240 Ga0495645_0082480 3300046543 Bacteria 2306
241 Ga0495633_0125439 3300046558 Bacteria 1188
242 Ga0495667_0840062 3300046559 Bacteria 565
243 Ga0495659_0088302 3300046664 Bacteria 1187
244 Ga0495659_0163460 3300046664 Bacteria 900
245 Ga0495680_0252788 3300047322 Bacteria 1249
246 Ga0495680_1021012 3300047322 Bacteria 527
247 Ga0495685_197044 3300047447 Bacteria 646
248 Ga0495602_0602995 3300048088 Bacteria 755
249 Ga0496109_1060073 3300048912 Bacteria 748
250 Ga0496109_1456311 3300048912 Bacteria 620
251 Ga0496111_0951457 3300048914 Bacteria 617
252 Ga0501305_037181 3300049161 Bacteria 781
253 Ga0501031_0351795 3300049568 Unclassified 954
254 Ga0501033_0180765 3300049570 Unclassified 1512
255 Ga0501036_0053961 3300049572 Bacteria 3403
256 Ga0501036_0217127 3300049572 Bacteria 1606
257 Ga0501037_0705353 3300049573 Archaea 671
258 Ga0501038_1131621 3300049574 Bacteria 571
259 Ga0501039_0736643 3300049575 Bacteria 770
260 Ga0501039_0994600 3300049575 Bacteria 652
261 Ga0501041_0022680 3300049577 Unclassified 3760
262 Ga0501042_0190828 3300049578 Bacteria 1478
263 Ga0501042_0224761 3300049578 Archaea 1354
264 Ga0501048_0115216 3300049582 Bacteria 1899
265 Ga0501048_0135047 3300049582 Archaea 1743
266 Ga0501072_0568642 3300049588 Bacteria 895
267 Ga0501072_0586025 3300049588 Bacteria 880
268 Ga0501072_1026964 3300049588 Archaea 642
269 Ga0501073_0005046 3300049589 Bacteria 9896
270 Ga0501074_0054774 3300049590 Bacteria 2876
271 Ga0501075_0100694 3300049591 Unclassified 2194
272 Ga0501075_0292473 3300049591 Bacteria 1241
273 Ga0501076_0022170 3300049592 Bacteria 4880
274 Ga0501076_0074532 3300049592 Unclassified 2719
275 Ga0501076_0228284 3300049592 Bacteria 1522
276 Ga0501227_090623 3300049665 Bacteria 807
277 Ga0501079_0337188 3300049741 Bacteria 1181
278 Ga0501079_0637783 3300049741 Archaea 839
279 Ga0501079_1322307 3300049741 Unclassified 567
280 Ga0501080_0088394 3300049742 Bacteria 2879
281 Ga0501081_0005355 3300049743 Bacteria 8280
282 Ga0501279_064505 3300049775 Bacteria 605
283 Ga0501045_0051792 3300049824 Unclassified 2996
284 Ga0501045_0118326 3300049824 Bacteria 1966
285 nmdc:mga05p37_161_c1 3300050507 Bacteria 64458
286 nmdc:mga05p37_23171_c1 3300050507 Bacteria 7533
287 nmdc:mga05p37_31436_c1 3300050507 Bacteria 4281
288 nmdc:mga05p37_599117_c1 3300050507 Bacteria 1244
289 nmdc:mga05p37_906494_c1 3300050507 Unclassified 950
290 nmdc:mga09592_281650_c1 3300050508 Bacteria 1442
291 nmdc:mga09592_59123_c1 3300050508 Bacteria 3240
292 nmdc:mga09592_753606_c1 3300050508 Bacteria 826
293 nmdc:mga0qj67_224858_c1 3300050509 Bacteria 1523
294 nmdc:mga0qj67_255223_c1 3300050509 Bacteria 1422
295 nmdc:mga0qj67_298431_c1 3300050509 Bacteria 1305
296 nmdc:mga0qj67_379595_c1 3300050509 Bacteria 1141
297 nmdc:mga06r32_1416145_c1 3300050510 Bacteria 637
298 nmdc:mga08y16_1429038_c1 3300050511 Unclassified 654
299 nmdc:mga08y16_20269_c1 3300050511 Bacteria 7018
300 nmdc:mga08y16_554188_c1 3300050511 Bacteria 1163
301 nmdc:mga08y16_6527_c1 3300050511 Bacteria 12231
302 nmdc:mga08y16_707528_c1 3300050511 Bacteria 1007
303 nmdc:mga0n895_209305_c1 3300050512 Bacteria 1981
304 nmdc:mga0n895_96669_c1 3300050512 Bacteria 2958
305 nmdc:mga0rr50_264541_c1 3300050513 Bacteria 1432
306 nmdc:mga0a205_113882_c1 3300050515 Bacteria 2603
307 nmdc:mga0a205_1482056_c1 3300050515 Bacteria 527
308 nmdc:mga0a205_189613_c1 3300050515 Bacteria 1949
309 nmdc:mga0a205_29043_c1 3300050515 Bacteria 5291
310 nmdc:mga0a205_304973_c2 3300050515 Bacteria 1012
311 Ga0495601_0243848 3300053077 Bacteria 1173
312 Ga0501084_0141630 3300054114 Bacteria 2025
313 Ga0587066_145023 3300059490 Bacteria 583
314 Ga0587073_0177373 3300059492 Unclassified 623
315 Ga0587077_001774 3300059493 Bacteria 2406
316 Ga0587077_042074 3300059493 Bacteria 921
317 Ga0587082_002464 3300059504 Bacteria 2090
318 Ga0587086_094062 3300059507 Bacteria 545
319 Ga0587092_120542 3300059512 Bacteria 560
320 Ga0587101_001894 3300059623 Bacteria 1898
321 Ga0587076_012657 3300059645 Bacteria 1265
322 Ga0587107_002338 3300059652 Bacteria 1700
323 Ga0587119_006025 3300059658 Bacteria 1262
324 Ga0587111_0075960 3300060346 Bacteria 794
325 Ga0501082_0036176 3300060353 Bacteria 4254
326 Ga0501082_0387771 3300060353 Bacteria 1219
327 Ga0501082_0399044 3300060353 Bacteria 1200
328 Ga0530510_0133303 3300061734 Unclassified 1828
329 Ga0530510_0212105 3300061734 Bacteria 1439
330 Ga0114129_10000023
331 JGI25406J46586_10031125
332 JGI25406J46586_10091458
333 Ga0007417J51691_1016316
334 Ga0058860_10039543
335 Ga0058860_12201309
336 Ga0065712_10026920
337 Ga0065712_10083644
338 Ga0065715_10172394
339 Ga0065715_10350374
340 Ga0065707_10006308
341 Ga0070658_10246322
342 Ga0070690_100494934
343 Ga0070670_100079212
344 Ga0070677_10185630
345 Ga0070680_100751605
346 Ga0070689_100032219
347 Ga0070691_10032529
348 Ga0070687_100022370
349 Ga0070661_100232365
350 Ga0070669_100188244
351 Ga0070669_100999543
352 Ga0070669_101138817
353 Ga0070675_100006815
354 Ga0070675_100010464
355 Ga0070675_100286291
356 Ga0070675_100909422
357 Ga0070675_101769849
358 Ga0070671_100281774
359 Ga0070674_100005123
360 Ga0070674_101148528
361 Ga0070688_100063895
362 Ga0070659_100739123
363 Ga0070713_100022141
364 Ga0070713_100466975
365 Ga0070701_10063537
366 Ga0070701_10124582
367 Ga0070701_10226832
368 Ga0070705_100000075
369 Ga0070705_100015477
370 Ga0070705_100373178
371 Ga0070700_100001638
372 Ga0070700_100071348
373 Ga0070700_100148920
374 Ga0070700_100284781
375 Ga0070700_100451152
376 Ga0070700_100642496
377 Ga0070700_101339180
378 Ga0070694_100019973
379 Ga0070694_100216136
380 Ga0070694_100465146
381 Ga0070694_100472281
382 Ga0070662_100905814
383 Ga0068867_100297869
384 Ga0068867_100653873
385 Ga0070685_10065055
386 Ga0070685_10512212
387 Ga0070706_100418215
388 Ga0070707_100094327
389 Ga0070698_100002432
390 Ga0070699_100009002
391 Ga0070699_100012290
392 Ga0070699_100169070
393 Ga0070699_100380914
394 Ga0070699_101539157
395 Ga0070697_100113667
396 Ga0070672_100038728
397 Ga0070686_100110928
398 Ga0070695_100002719
399 Ga0070695_100003606
400 Ga0070695_101080631
401 Ga0070695_101706178
402 Ga0070696_100007190
403 Ga0070696_100021157
404 Ga0070696_101289811
405 Ga0070704_100007717
406 Ga0070704_100118493
407 Ga0070704_100128522
408 Ga0070664_100025141
409 Ga0070664_100288658
410 Ga0070664_100893597
411 Ga0068857_101162112
412 Ga0070702_100587298
413 Ga0070702_101212049
414 Ga0068852_100870476
415 Ga0068859_100051771
416 Ga0068864_100012348
417 Ga0068861_100036988
418 Ga0068863_100408621
419 Ga0068858_100545966
420 Ga0068860_100374397
421 Ga0081455_10380025
422 Ga0081539_10005027
423 Ga0081539_10010688
424 Ga0070717_10060920
425 Ga0075368_10052652
426 Ga0070712_100337729
427 Ga0075367_10360185
428 Ga0097621_100212644
429 Ga0068871_101153438
430 Ga0068871_101167008
431 Ga0075428_100331424
432 Ga0075431_100609945
433 Ga0075433_10021058
434 Ga0075433_10089405
435 Ga0075433_10167672
436 Ga0075433_10446264
437 Ga0075433_10968087
438 Ga0075434_100009496
439 Ga0075434_100070007
440 Ga0075434_100260902
441 Ga0075434_100621220
442 Ga0075434_100698542
443 Ga0075429_100751472
444 Ga0068865_101007207
445 Ga0097620_100051773
446 Ga0075435_100045867
447 Ga0111539_10017277
448 Ga0111539_10027989
449 Ga0111539_10371954
450 Ga0111539_10909960
451 Ga0111539_11277303
452 Ga0111539_12265104
453 Ga0114129_10004994
454 Ga0114129_10021972
455 Ga0114129_11125011
456 Ga0114129_11188512
457 Ga0114129_11546368
458 Ga0105243_10420182
459 Ga0105241_10533208
460 Ga0105242_10071036
461 Ga0105248_11188305
462 Ga0105249_10055754
463 Ga0105249_10601606
464 Ga0105246_10469356
465 Ga0157378_11806481
466 Ga0163162_11517535
467 Ga0157375_10377543
468 Ga0163163_10035654
469 Ga0157380_10051890
470 Ga0157380_10411216
471 Ga0157377_11446633
472 Ga0157379_11034340
473 Ga0207653_10042542
474 Ga0207682_10054586
475 Ga0207705_10229407
476 Ga0207705_10269875
477 Ga0207684_10898996
478 Ga0207646_10372297
479 Ga0207646_10613251
480 Ga0207681_10709060
481 Ga0207650_10006718
482 Ga0207650_10360337
483 Ga0207650_11869492
484 Ga0207700_10015466
485 Ga0207700_10303482
486 Ga0207644_10288990
487 Ga0207706_10128278
488 Ga0207706_10135059
489 Ga0207686_10049480
490 Ga0207709_10037446
491 Ga0207670_10313545
492 Ga0207669_10591440
493 Ga0207704_10149813
494 Ga0207691_10054165
495 Ga0207679_10376168
496 Ga0207679_11529090
497 Ga0207651_10042733
498 Ga0207712_10839155
499 Ga0207708_10017894
500 Ga0207708_10046992
501 Ga0207708_10047709
502 Ga0207708_10173130
503 Ga0207708_10228994
504 Ga0207708_10828787
505 Ga0207641_10323477
506 Ga0207648_10146742
507 Ga0207648_10320982
508 Ga0207676_10554257
509 Ga0207676_11526647
510 Ga0207674_10331474
511 Ga0207674_10474979
512 Ga0207675_100009516
513 Ga0207683_11213012
514 Ga0207428_10006834
515 Ga0207428_10073472
516 Ga0268266_11568905
517 Ga0268265_10349938
518 Ga0268264_10114784
519 Ga0307511_10391499
520 Ga0307408_100167117
521 Ga0307408_100767891
522 Ga0307405_10513210
523 Ga0307405_11439720
524 Ga0307413_10544439
525 Ga0307413_10635675
526 Ga0307410_10050740
527 Ga0307410_10206162
528 Ga0307410_10554077
529 Ga0307407_10011246
530 Ga0307409_100061897
531 Ga0307409_100071731
532 Ga0307409_100254214
533 Ga0307409_100673184
534 Ga0307409_100982398
535 Ga0307416_100911619
536 Ga0307416_101198614
537 Ga0307416_101979187
538 Ga0307411_10025018
539 Ga0307411_10683062
540 Ga0373959_0197367
541 Ga0373934_0011980
542 Ga0373923_0180564
543 Ga0373936_0467699
544 Ga0373954_0365052
545 Ga0373956_0013635
546 Ga0373943_0493345
547 Ga0373955_0003212
548 Ga0373924_0193947
549 Ga0373933_0052117
550 Ga0373933_0063669
551 Ga0373933_0210901
552 Ga0373937_0001942
553 Ga0373937_0025235
554 Ga0373937_0470636
555 Ga0373925_0002869
556 Ga0373925_0081927
557 Ga0450923_015066
558 Ga0439435_0077603
559 Ga0439444_0004293
560 Ga0450916_033168
561 Ga0453684_0016537
562 Ga0495629_0083885
563 Ga0495653_0427670
564 Ga0495582_0384778
565 Ga0495663_0316379
566 Ga0495665_0400286
567 Ga0495598_0064125
568 Ga0495598_0155697
569 Ga0495645_0082480
570 Ga0495633_0125439
571 Ga0495667_0840062
572 Ga0495659_0088302
573 Ga0495659_0163460
574 Ga0495680_0252788
575 Ga0495680_1021012
576 Ga0495685_197044
577 Ga0495602_0602995
578 Ga0496109_1060073
579 Ga0496109_1456311
580 Ga0496111_0951457
581 Ga0501305_037181
582 Ga0501031_0351795
583 Ga0501033_0180765
584 Ga0501036_0053961
585 Ga0501036_0217127
586 Ga0501037_0705353
587 Ga0501038_1131621
588 Ga0501039_0736643
589 Ga0501039_0994600
590 Ga0501041_0022680
591 Ga0501042_0190828
592 Ga0501042_0224761
593 Ga0501048_0115216
594 Ga0501048_0135047
595 Ga0501072_0568642
596 Ga0501072_0586025
597 Ga0501072_1026964
598 Ga0501073_0005046
599 Ga0501074_0054774
600 Ga0501075_0100694
601 Ga0501075_0292473
602 Ga0501076_0022170
603 Ga0501076_0074532
604 Ga0501076_0228284
605 Ga0501227_090623
606 Ga0501079_0337188
607 Ga0501079_0637783
608 Ga0501079_1322307
609 Ga0501080_0088394
610 Ga0501081_0005355
611 Ga0501279_064505
612 Ga0501045_0051792
613 Ga0501045_0118326
614 nmdc:mga05p37_161_c1
615 nmdc:mga05p37_23171_c1
616 nmdc:mga05p37_31436_c1
617 nmdc:mga05p37_599117_c1
618 nmdc:mga05p37_906494_c1
619 nmdc:mga09592_281650_c1
620 nmdc:mga09592_59123_c1
621 nmdc:mga09592_753606_c1
622 nmdc:mga0qj67_224858_c1
623 nmdc:mga0qj67_255223_c1
624 nmdc:mga0qj67_298431_c1
625 nmdc:mga0qj67_379595_c1
626 nmdc:mga06r32_1416145_c1
627 nmdc:mga08y16_1429038_c1
628 nmdc:mga08y16_20269_c1
629 nmdc:mga08y16_554188_c1
630 nmdc:mga08y16_6527_c1
631 nmdc:mga08y16_707528_c1
632 nmdc:mga0n895_209305_c1
633 nmdc:mga0n895_96669_c1
634 nmdc:mga0rr50_264541_c1
635 nmdc:mga0a205_113882_c1
636 nmdc:mga0a205_1482056_c1
637 nmdc:mga0a205_189613_c1
638 nmdc:mga0a205_29043_c1
639 nmdc:mga0a205_304973_c2
640 Ga0495601_0243848
641 Ga0501084_0141630
642 Ga0587066_145023
643 Ga0587073_0177373
644 Ga0587077_001774
645 Ga0587077_042074
646 Ga0587082_002464
647 Ga0587086_094062
648 Ga0587092_120542
649 Ga0587101_001894
650 Ga0587076_012657
651 Ga0587107_002338
652 Ga0587119_006025
653 Ga0587111_0075960
654 Ga0501082_0036176
655 Ga0501082_0387771
656 Ga0501082_0399044
657 Ga0530510_0133303
658 Ga0530510_0212105

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02472

ExbD

Biopolymer transport protein ExbD/TolR

19

146

0.91

Map