F413475

General Info

Members Datasets Scaffolds Average Seq Length
338 202 297 209

Family's Representative Sequence

Representative Sequence 3300009036|Ga0105244_10003675|Ga0105244_1000367510
Length 230
Sequence LILFENLLFIVEGYVLLWNILTYFGDSMLILPTGITLALFMLWKADNPVTALIWLIILGISGLAVSISKLLFLAWGIGSSTFNFTGFSGHTTMSATLWPVMFWLIGQRFQPDGRRLMITAGYFIAIMVGISRLALHAHSVSEVISGLILGSLCSVTFLYTQHDRNMRYFTFTPLAILLILPLSLMSFGKKAPTQQLLEHIATQITGKQPWTREEYQLMAEKPEISKSAWN

Samples

Sample ID Description Type Environment
1 2511231025 Pantoea sp. YR343 Isolate Rhizosphere
2 2511231035 Pantoea sp. GM01 Isolate Rhizosphere
3 2513237150 Cupriavidus taiwanensis STM6018 Isolate Nodule
4 2513237165 Cupriavidus neocaledonicus STM6070 Isolate Nodule
5 2599185299 Pantoea ananatis NFR11 Isolate Rhizoplane
6 2608642108 Pantoea agglomerans NFPP29 Isolate Rhizoplane
7 2643221603 Noviherbaspirillum sp. Root189 Isolate Unclassified
8 2648501693 Pantoea ananatis B1-9 Isolate Rhizosphere
9 2667528173 Rahnella sp. NFIX50 Isolate Rhizoplane
10 2684622997 Pantoea ananatis NFIX48 Isolate Rhizoplane
11 2738543009 Luteibacter sp. OK325 Isolate Unclassified
12 2808606414 Pantoea sp. SJZ147 Isolate Rhizosphere
13 2818991440 Luteibacter yeojuensis 583 Isolate Unclassified
14 2842677519 Variovorax sp. R-72495 Isolate Unclassified
15 2844528606 Pantoea sp. R-72498 v. 2 Isolate Unclassified
16 2847085930 Erwinia persicina B64 Isolate Bulb
17 2847797336 Pantoea ananatis NN08200 Isolate Unclassified
18 2852103415 Edaphovirga cremea DSM 105170 Isolate Rhizosphere
19 2865014394 Pantoea sp. R-71966 Isolate Unclassified
20 2876601092 Pantoea endophytica 596 Isolate Unclassified
21 2881609920 Pantoea sp. ARC607 Isolate Rhizosphere
22 2884338543 Luteibacter pinisoli MAH-14 Isolate Rhizosphere
23 2904463128 Luteibacter yeojuensis 3191 Isolate Unclassified
24 2904474040 Rahnella aquatilis 4485 Isolate Rhizosphere
25 2904504865 Serratia marcescens 1822 Isolate Unclassified
26 2908669403 Pantoea coffeiphila 1480 Isolate Rhizosphere
27 2919150387 Rahnella aceris 1817 Isolate Unclassified
28 2919462493 Variovorax sp. 3319 Isolate Rhizosphere
29 2927143783 Rahnella sp. 2050 Isolate Unclassified
30 2939602548 Pantoea dispersa 1175 Isolate Rhizosphere
31 2945945610 Variovorax paradoxus W1I18 Isolate Rhizosphere
32 2945951305 Pantoea agglomerans W2I1 Isolate Rhizosphere
33 2978975091 Pantoea anthophila SORGH_AS 797 Isolate Unclassified
34 2984494565 Pantoea ananatis SORGH_AS197 Isolate Aerial Root
35 2990261002 Pantoea ananatis SORGH_AS213 Isolate Aerial Root
36 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
37 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
38 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
39 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
40 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
41 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
42 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
43 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
44 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
45 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
46 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
47 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
48 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
49 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
50 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
51 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
52 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
53 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
54 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
55 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
56 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
57 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
58 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
59 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
60 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
61 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
62 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
63 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
64 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
65 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
66 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
67 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
68 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
69 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
70 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
71 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
72 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
73 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
74 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
75 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
76 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
77 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
78 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
79 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
80 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
81 3300016635 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 Metagenome Rhizosphere
82 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
83 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
84 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
85 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
86 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
87 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
88 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
89 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
90 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
91 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
92 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
107 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
109 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
110 3300030734 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 Metagenome Rhizosphere
111 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
112 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
113 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
114 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
115 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
116 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
117 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
118 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
119 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
120 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
121 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
122 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
123 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
124 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
125 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
126 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
127 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
128 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
129 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
130 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
131 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
132 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
133 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
134 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
135 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
136 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
137 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
138 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
139 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
140 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
141 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
142 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
143 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
144 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
145 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
146 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
147 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
148 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
149 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
150 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
151 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
152 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
153 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
154 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
155 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
156 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
157 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
158 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
159 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
160 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
161 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
162 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
163 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
164 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
165 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
166 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
167 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
168 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
169 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
170 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
171 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
172 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
173 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
174 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
175 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
176 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
177 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
178 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
179 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
180 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
181 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
182 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
183 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
184 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
185 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
186 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
187 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
188 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
189 3300059478 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
190 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
191 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
192 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
193 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
194 3300059513 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
195 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
196 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
197 3300059646 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
198 3300059649 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 68R_SW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
199 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
200 644736347 Cupriavidus taiwanensis LMG 19424 Isolate Nodule
201 8016733728 Pantoea sp. SORGH_AS 659 Isolate Unclassified
202 8019499862 Kluyvera sp. 1366 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 84.02
Metatranscriptomes 3.85
Isolates 12.13

Biome Distribution

Category Percentage (%)
Aerial Root 0.59
Bulb 0.3
Endosphere 7.69
Nodule 0.89
Rhizoplane 4.73
Rhizosphere 64.2
Stem 0
Stem Tuber 0
Unclassified 21.6

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10000121 3300001989 Bacteria 24174
2 JGI24738J21930_10000444 3300002075 Bacteria 11696
3 JGI25162J39368_1000003 3300002737 Bacteria 575218
4 JGI25162J39368_1001242 3300002737 Bacteria 14656
5 JGI25163J39215_1000065 3300002771 Bacteria 47718
6 JGI25164J39214_1000014 3300002772 Bacteria 219691
7 Ga0055538_1000005 3300003751 Bacteria 575218
8 Ga0055539_1000007 3300003752 Bacteria 575218
9 Ga0055533_1000009 3300003756 Bacteria 575218
10 Ga0055525_1000010 3300003759 Bacteria 575218
11 Ga0055541_1000005 3300003841 Bacteria 575218
12 Ga0058692_1000234 3300003856 Bacteria 32010
13 Ga0058692_1000307 3300003856 Bacteria 24561
14 Ga0058692_1000399 3300003856 Bacteria 20718
15 Ga0058692_1013202 3300003856 Bacteria 1932
16 Ga0065704_10001052 3300005289 Bacteria 20106
17 Ga0070658_10426752 3300005327 Bacteria 1141
18 Ga0070660_100001726 3300005339 Bacteria 14990
19 Ga0070661_100016177 3300005344 Bacteria 5267
20 Ga0070668_100063988 3300005347 Bacteria 2851
21 Ga0070659_100001264 3300005366 Bacteria 18358
22 Ga0070662_100066863 3300005457 Bacteria 2638
23 Ga0068867_100809644 3300005459 Bacteria 836
24 Ga0068853_100240149 3300005539 Bacteria 1660
25 Ga0070665_100176483 3300005548 Bacteria 2137
26 Ga0068855_100009252 3300005563 Bacteria 11904
27 Ga0070664_100006726 3300005564 Bacteria 9265
28 Ga0068857_100147775 3300005577 Bacteria 2127
29 Ga0068852_100017051 3300005616 Bacteria 5688
30 Ga0075364_10006743 3300006051 Bacteria 6771
31 Ga0075364_10074997 3300006051 Bacteria 2231
32 Ga0075367_10059997 3300006178 Bacteria 2266
33 Ga0105251_10000891 3300009011 Bacteria 26739
34 Ga0105251_10009102 3300009011 Bacteria 5908
35 Ga0105251_10015743 3300009011 Bacteria 4120
36 Ga0105251_10035072 3300009011 Bacteria 2477
37 Ga0105251_10105325 3300009011 Bacteria 1288
38 Ga0105244_10001225 3300009036 Bacteria 21042
39 Ga0105244_10001410 3300009036 Bacteria 19453
40 Ga0105244_10003675 3300009036 Bacteria 10832
41 Ga0105244_10019135 3300009036 Bacteria 3830
42 Ga0105250_10000046 3300009092 Bacteria 126280
43 Ga0105250_10007173 3300009092 Bacteria 4806
44 Ga0105250_10048565 3300009092 Bacteria 1702
45 Ga0105240_10124128 3300009093 Bacteria 3106
46 Ga0105247_10001253 3300009101 Bacteria 18813
47 Ga0105243_10697907 3300009148 Bacteria 989
48 Ga0105237_10011182 3300009545 Bacteria 9511
49 Ga0105238_10039728 3300009551 Bacteria 4771
50 Ga0105239_10040145 3300010375 Bacteria 5127
51 Ga0105246_10013565 3300011119 Bacteria 5111
52 Ga0105246_10045442 3300011119 Bacteria 2990
53 Ga0105246_10328788 3300011119 Bacteria 1245
54 Ga0157373_10000511 3300013100 Bacteria 30548
55 Ga0157373_10025568 3300013100 Bacteria 4269
56 Ga0157373_10082127 3300013100 Bacteria 2271
57 Ga0157373_10466752 3300013100 Bacteria 910
58 Ga0157371_10000528 3300013102 Bacteria 45611
59 Ga0157371_10003127 3300013102 Bacteria 15293
60 Ga0157371_10007431 3300013102 Bacteria 8871
61 Ga0157370_10000123 3300013104 Bacteria 91425
62 Ga0157370_10100730 3300013104 Bacteria 2706
63 Ga0157369_10005689 3300013105 Bacteria 14476
64 Ga0157369_10020829 3300013105 Bacteria 7329
65 Ga0163162_10230319 3300013306 Bacteria 1983
66 Ga0163162_10272344 3300013306 Bacteria 1825
67 Ga0163162_10351494 3300013306 Bacteria 1607
68 Ga0157372_10002176 3300013307 Bacteria 21334
69 Ga0157372_10013295 3300013307 Bacteria 8787
70 Ga0157372_10927609 3300013307 Bacteria 1010
71 Ga0157372_11132477 3300013307 Bacteria 905
72 Ga0182008_10012370 3300014497 Bacteria 4505
73 Ga0182006_1006857 3300015261 Bacteria 5257
74 Ga0182006_1072578 3300015261 Bacteria 1272
75 Ga0183361_10305 3300016635 Bacteria 1985
76 Ga0163161_10030869 3300017792 Bacteria 3816
77 Ga0209760_100092 3300025207 Bacteria 71682
78 Ga0209784_100001 3300025224 Bacteria 3600592
79 Ga0209566_100001 3300025225 Bacteria 3600765
80 Ga0209674_100002 3300025226 Bacteria 3600592
81 Ga0209563_100008 3300025230 Bacteria 1554545
82 Ga0207427_100002 3300025231 Bacteria 1355321
83 Ga0209437_100007 3300025233 Bacteria 938377
84 Ga0209437_100238 3300025233 Bacteria 90380
85 Ga0209677_100004 3300025253 Bacteria 1554545
86 Ga0209233_1013677 3300025261 Bacteria 2312
87 Ga0207696_1000058 3300025711 Bacteria 248495
88 Ga0207696_1000418 3300025711 Bacteria 39066
89 Ga0207696_1003039 3300025711 Bacteria 7834
90 Ga0207655_1000007 3300025728 Bacteria 773492
91 Ga0207655_1000011 3300025728 Bacteria 643321
92 Ga0207655_1001328 3300025728 Bacteria 23333
93 Ga0207655_1001689 3300025728 Bacteria 19413
94 Ga0207655_1002216 3300025728 Bacteria 16111
95 Ga0207655_1003869 3300025728 Bacteria 10900
96 Ga0207655_1005007 3300025728 Bacteria 9170
97 Ga0207655_1007096 3300025728 Bacteria 7319
98 Ga0207655_1012724 3300025728 Bacteria 4889
99 Ga0207655_1062649 3300025728 Bacteria 1429
100 Ga0207713_1000001 3300025735 Bacteria 2295391
101 Ga0207713_1013733 3300025735 Bacteria 4252
102 Ga0207713_1015303 3300025735 Bacteria 3945
103 Ga0207713_1030828 3300025735 Bacteria 2382
104 Ga0207713_1059809 3300025735 Bacteria 1460
105 Ga0207695_10097854 3300025913 Bacteria 2934
106 Ga0207671_10024258 3300025914 Bacteria 4564
107 Ga0207657_10138788 3300025919 Bacteria 1987
108 Ga0207690_10028659 3300025932 Bacteria 3530
109 Ga0207706_10565947 3300025933 Bacteria 978
110 Ga0207679_10004027 3300025945 Bacteria 9125
111 Ga0207667_10055197 3300025949 Bacteria 4177
112 Ga0207668_10019976 3300025972 Bacteria 4247
113 Ga0207639_10658914 3300026041 Bacteria 969
114 Ga0207674_10161341 3300026116 Bacteria 2196
115 Ga0207698_10017915 3300026142 Bacteria 4815
116 Ga0209371_1000005 3300027312 Bacteria 1061740
117 Ga0209371_1000099 3300027312 Bacteria 154918
118 Ga0209371_1000100 3300027312 Bacteria 154467
119 Ga0209371_1000120 3300027312 Bacteria 132938
120 Ga0209371_1001663 3300027312 Bacteria 14265
121 Ga0209371_1002037 3300027312 Bacteria 12082
122 Ga0209371_1002421 3300027312 Bacteria 10466
123 Ga0209371_1004270 3300027312 Bacteria 6343
124 Ga0268266_10057653 3300028379 Bacteria 3343
125 Ga0268256_1000006 3300030500 Bacteria 1063991
126 Ga0268256_1000035 3300030500 Bacteria 384794
127 Ga0268256_1000089 3300030500 Bacteria 154491
128 Ga0268256_1000976 3300030500 Bacteria 19431
129 Ga0268256_1001451 3300030500 Bacteria 14265
130 Ga0268256_1001566 3300030500 Bacteria 13412
131 Ga0268256_1004009 3300030500 Bacteria 6343
132 Ga0268256_1007348 3300030500 Bacteria 3943
133 Ga0316177_1131419 3300030731 Bacteria 7359
134 Ga0316179_1114836 3300030734 Bacteria 4308
135 Ga0316178_1040385 3300030735 Bacteria 4371
136 Ga0316180_1082709 3300030736 Bacteria 4537
137 Ga0316183_1162795 3300030742 Bacteria 13759
138 Ga0316181_1018601 3300030744 Bacteria 2935
139 Ga0307408_100192214 3300031548 Bacteria 1645
140 Ga0307405_10595352 3300031731 Bacteria 901
141 Ga0307406_10199270 3300031901 Bacteria 1472
142 Ga0307412_10034151 3300031911 Bacteria 3239
143 Ga0395899_0000799 3300037312 Bacteria 30829
144 Ga0395899_0001545 3300037312 Bacteria 19428
145 Ga0395899_0014722 3300037312 Bacteria 5970
146 Ga0395905_0001092 3300037471 Bacteria 34107
147 Ga0395905_0022056 3300037471 Bacteria 6024
148 Ga0395905_0138494 3300037471 Bacteria 2290
149 Ga0395901_0008180 3300038443 Bacteria 10570
150 Ga0395901_0229200 3300038443 Bacteria 1940
151 Ga0395901_0589235 3300038443 Bacteria 1122
152 Ga0439436_0085907 3300041404 Bacteria 876
153 Ga0439438_000002 3300041405 Bacteria 618223
154 Ga0439438_000660 3300041405 Bacteria 15503
155 Ga0439438_075961 3300041405 Bacteria 827
156 Ga0439447_027503 3300041407 Bacteria 1450
157 Ga0439447_031829 3300041407 Bacteria 1322
158 Ga0439447_091220 3300041407 Bacteria 701
159 Ga0439466_0000001 3300041411 Bacteria 647258
160 Ga0439432_011718 3300042006 Bacteria 3015
161 Ga0439452_000001 3300042010 Bacteria 1725439
162 Ga0439454_003588 3300042011 Bacteria 1739
163 Ga0439463_007968 3300042016 Bacteria 2615
164 Ga0439458_0084978 3300042157 Bacteria 810
165 Ga0450908_000252 3300042184 Bacteria 10576
166 Ga0466965_0025305 3300044683 Bacteria 2873
167 Ga0466966_0003982 3300044684 Bacteria 9754
168 Ga0466971_0180792 3300044719 Unclassified 991
169 Ga0466970_0092568 3300044765 Bacteria 1642
170 Ga0495617_003443 3300046452 Bacteria 5958
171 Ga0495617_004086 3300046452 Bacteria 5358
172 Ga0495591_000001 3300046458 Bacteria 503087
173 Ga0495591_001465 3300046458 Bacteria 14610
174 Ga0495650_0000016 3300046471 Bacteria 554693
175 Ga0495650_0000031 3300046471 Bacteria 433811
176 Ga0495605_0029980 3300046474 Bacteria 2793
177 Ga0495585_0014381 3300046492 Bacteria 4612
178 Ga0495596_0003325 3300046500 Bacteria 8193
179 Ga0495607_0000003 3300046501 Bacteria 366900
180 Ga0495607_0016108 3300046501 Bacteria 4829
181 Ga0495606_0002247 3300046507 Bacteria 22997
182 Ga0495606_0221966 3300046507 Bacteria 1064
183 Ga0495637_0084382 3300046520 Bacteria 1262
184 Ga0495643_0007041 3300046522 Bacteria 7306
185 Ga0495644_0003275 3300046523 Bacteria 6404
186 Ga0495648_0004529 3300046524 Bacteria 11846
187 Ga0495648_0028439 3300046524 Bacteria 3723
188 Ga0495654_0000009 3300046530 Bacteria 381872
189 Ga0495654_0000068 3300046530 Bacteria 125533
190 Ga0495633_0033962 3300046558 Bacteria 2455
191 Ga0495668_0145015 3300046616 Bacteria 1299
192 Ga0495611_0211604 3300046648 Bacteria 903
193 Ga0495661_0259774 3300046665 Unclassified 883
194 Ga0495671_0012799 3300046692 Bacteria 4568
195 Ga0495649_0065942 3300046694 Bacteria 1943
196 Ga0495660_0000007 3300046810 Bacteria 485295
197 Ga0495660_0000015 3300046810 Bacteria 324892
198 Ga0495660_0033323 3300046810 Bacteria 2889
199 Ga0495636_0000840 3300047318 Bacteria 11354
200 Ga0495672_0000001 3300047320 Bacteria 1458820
201 Ga0495672_0000015 3300047320 Bacteria 502855
202 Ga0495679_004646 3300047446 Bacteria 6261
203 Ga0495673_0000019 3300047469 Bacteria 554389
204 Ga0495686_0000026 3300047472 Bacteria 383637
205 Ga0496100_0009069 3300048903 Bacteria 5576
206 Ga0496100_0428496 3300048903 Bacteria 1011
207 Ga0496101_0000236 3300048904 Bacteria 41111
208 Ga0496101_0469205 3300048904 Bacteria 994
209 Ga0496102_0006751 3300048905 Bacteria 9798
210 Ga0496102_0374806 3300048905 Bacteria 1339
211 Ga0496104_0023203 3300048907 Bacteria 5704
212 Ga0496105_0001239 3300048908 Bacteria 17814
213 Ga0496105_0211190 3300048908 Bacteria 1582
214 Ga0496105_0414573 3300048908 Bacteria 1067
215 Ga0496114_0360515 3300048917 Bacteria 1286
216 Ga0496115_0027620 3300048918 Bacteria 4442
217 Ga0496116_0000020 3300048919 Bacteria 501307
218 Ga0496116_0000054 3300048919 Bacteria 289010
219 Ga0496116_0000110 3300048919 Bacteria 185668
220 Ga0496116_0000140 3300048919 Bacteria 151165
221 Ga0496116_0002997 3300048919 Bacteria 17125
222 Ga0496116_0069541 3300048919 Bacteria 2238
223 Ga0496116_0269603 3300048919 Bacteria 833
224 Ga0496117_0000009 3300048920 Bacteria 613759
225 Ga0496117_0000138 3300048920 Bacteria 159456
226 Ga0496117_0000154 3300048920 Bacteria 146606
227 Ga0496117_0002625 3300048920 Bacteria 22300
228 Ga0496117_0030553 3300048920 Bacteria 4131
229 Ga0496117_0066819 3300048920 Bacteria 2436
230 Ga0496117_0080287 3300048920 Bacteria 2146
231 Ga0496118_0000017 3300048921 Bacteria 549445
232 Ga0496118_0000150 3300048921 Bacteria 123251
233 Ga0496118_0000957 3300048921 Bacteria 45130
234 Ga0496118_0017582 3300048921 Bacteria 6498
235 Ga0496118_0034139 3300048921 Bacteria 4157
236 Ga0496118_0105682 3300048921 Bacteria 1886
237 Ga0496119_0000012 3300048922 Bacteria 411917
238 Ga0496119_0000027 3300048922 Bacteria 249124
239 Ga0496119_0000361 3300048922 Bacteria 63778
240 Ga0496119_0001046 3300048922 Bacteria 35388
241 Ga0496119_0001835 3300048922 Bacteria 24589
242 Ga0496119_0002136 3300048922 Bacteria 22256
243 Ga0496119_0013201 3300048922 Bacteria 6604
244 Ga0496120_0000004 3300048923 Bacteria 534793
245 Ga0496120_0000022 3300048923 Bacteria 249124
246 Ga0496120_0000048 3300048923 Bacteria 187988
247 Ga0496120_0000052 3300048923 Bacteria 186071
248 Ga0496120_0000057 3300048923 Bacteria 177460
249 Ga0496120_0000207 3300048923 Bacteria 101327
250 Ga0496120_0000711 3300048923 Bacteria 48821
251 Ga0496120_0099489 3300048923 Bacteria 1539
252 Ga0496121_0002048 3300048924 Bacteria 31910
253 Ga0496121_0112687 3300048924 Bacteria 2072
254 Ga0496122_0000013 3300048925 Bacteria 501039
255 Ga0496122_0004483 3300048925 Bacteria 17262
256 Ga0496122_0009303 3300048925 Bacteria 10386
257 Ga0496123_0000010 3300048926 Bacteria 501039
258 Ga0496123_0001692 3300048926 Bacteria 29490
259 Ga0496123_0007473 3300048926 Bacteria 10270
260 Ga0496123_0259789 3300048926 Bacteria 851
261 Ga0496124_0000010 3300048927 Bacteria 595157
262 Ga0496124_0001694 3300048927 Bacteria 31208
263 Ga0496124_0001896 3300048927 Bacteria 28730
264 Ga0496124_0002160 3300048927 Bacteria 26367
265 Ga0496124_0007435 3300048927 Bacteria 11641
266 Ga0496124_0018266 3300048927 Bacteria 6573
267 Ga0496124_0025220 3300048927 Bacteria 5388
268 Ga0496124_0028783 3300048927 Bacteria 4962
269 Ga0496124_0142734 3300048927 Bacteria 1887
270 Ga0496125_0000019 3300048928 Bacteria 474989
271 Ga0496125_0000054 3300048928 Bacteria 278377
272 Ga0496126_0027030 3300048929 Bacteria 5491
273 Ga0496126_0055132 3300048929 Bacteria 3597
274 Ga0495678_000206 3300049459 Bacteria 68472
275 Ga0495678_027582 3300049459 Bacteria 2408
276 Ga0495682_0000001 3300049460 Bacteria 1559116
277 Ga0501223_018377 3300049663 Bacteria 1376
278 Ga0501249_001394 3300049679 Bacteria 4994
279 Ga0501225_0007970 3300049705 Bacteria 3052
280 Ga0501262_000043 3300049759 Bacteria 16476
281 nmdc:mga00v17_15420_c2 3300050491 Bacteria 2899
282 nmdc:mga0sz30_237363_c1 3300050516 Bacteria 811
283 Ga0500621_000002 3300053126 Bacteria 849473
284 Ga0500634_0000075 3300053161 Bacteria 38614
285 Ga0587093_003348 3300059478 Bacteria 1567
286 Ga0587070_017654 3300059491 Bacteria 1160
287 Ga0587077_001691 3300059493 Bacteria 2434
288 Ga0587090_005131 3300059510 Bacteria 1626
289 Ga0587091_057327 3300059511 Bacteria 818
290 Ga0587094_010221 3300059513 Bacteria 1213
291 Ga0587072_010063 3300059643 Bacteria 1522
292 Ga0587072_014319 3300059643 Bacteria 1335
293 Ga0587076_001554 3300059645 Bacteria 2367
294 Ga0587076_023404 3300059645 Unclassified 1040
295 Ga0587078_005322 3300059646 Bacteria 1370
296 Ga0587102_002787 3300059649 Bacteria 1382
297 Ga0587111_0003981 3300060346 Bacteria 2156

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046501 Ga0495607_0000003 Ga0495607_0000003_284027_284653 174
2 3300046648 Ga0495611_0211604 Ga0495611_0211604_13_570 183
3 iso_pu_bacteria 2818991440 2819562617 190
4 iso_pu_bacteria 2904463128 2904463222 190
5 3300009092 Ga0105250_10000046 Ga0105250_1000004642 191
6 3300041407 Ga0439447_091220 Ga0439447_091220_64_684 192
7 3300048919 Ga0496116_0000140 Ga0496116_0000140_30714_31298 192
8 3300048922 Ga0496119_0001046 Ga0496119_0001046_19258_19842 192
9 3300048923 Ga0496120_0000048 Ga0496120_0000048_96356_96940 192
10 3300042011 Ga0439454_003588 Ga0439454_003588_332_934 193
11 3300050516 nmdc:mga0sz30_237363_c1 nmdc:mga0sz30_237363_c1_18_620 193
12 iso_pu_bacteria 2842677519 2842682121 193
13 iso_pu_bacteria 2884338543 2884340787 193
14 3300006178 Ga0075367_10059997 Ga0075367_100599973 194
15 iso_pu_bacteria 2738543009 2739228568 194
16 iso_pu_bacteria 2643221603 2644028092 195
17 3300030731 Ga0316177_1131419 Ga0316177_11314192 197
18 3300030734 Ga0316179_1114836 Ga0316179_11148365 197
19 3300030735 Ga0316178_1040385 Ga0316178_10403854 197
20 3300030736 Ga0316180_1082709 Ga0316180_10827094 197
21 3300030742 Ga0316183_1162795 Ga0316183_11627959 197
22 3300030744 Ga0316181_1018601 Ga0316181_10186013 197
23 3300031548 Ga0307408_100192214 Ga0307408_1001922141 197
24 3300031901 Ga0307406_10199270 Ga0307406_101992701 197
25 3300031911 Ga0307412_10034151 Ga0307412_100341512 197
26 3300047472 Ga0495686_0000026 Ga0495686_0000026_226299_226916 197
27 3300048920 Ga0496117_0080287 Ga0496117_0080287_1466_2071 197
28 3300048921 Ga0496118_0000957 Ga0496118_0000957_4318_4923 197
29 3300049759 Ga0501262_000043 Ga0501262_000043_14165_14836 197
30 iso_pu_bacteria 2513237150 2513954578 197
31 iso_pu_bacteria 2513237165 2514043470 197
32 iso_pu_bacteria 644736347 644750071 197
33 3300005339 Ga0070660_100001726 Ga0070660_10000172610 198
34 3300005344 Ga0070661_100016177 Ga0070661_1000161771 198
35 3300005366 Ga0070659_100001264 Ga0070659_10000126413 198
36 3300005564 Ga0070664_100006726 Ga0070664_1000067263 198
37 3300009101 Ga0105247_10001253 Ga0105247_1000125316 198
38 3300025919 Ga0207657_10138788 Ga0207657_101387882 198
39 3300025932 Ga0207690_10028659 Ga0207690_100286592 198
40 3300025945 Ga0207679_10004027 Ga0207679_100040279 198
41 3300037312 Ga0395899_0000799 Ga0395899_0000799_398_1039 198
42 3300037312 Ga0395899_0001545 Ga0395899_0001545_15121_15762 198
43 3300037312 Ga0395899_0014722 Ga0395899_0014722_4824_5471 198
44 3300037471 Ga0395905_0001092 Ga0395905_0001092_27851_28507 198
45 3300037471 Ga0395905_0022056 Ga0395905_0022056_461_1108 198
46 3300038443 Ga0395901_0008180 Ga0395901_0008180_7875_8516 198
47 3300038443 Ga0395901_0229200 Ga0395901_0229200_912_1559 198
48 3300038443 Ga0395901_0589235 Ga0395901_0589235_254_895 198
49 3300042157 Ga0439458_0084978 Ga0439458_0084978_13_675 198
50 3300042184 Ga0450908_000252 Ga0450908_000252_9060_9677 198
51 3300044683 Ga0466965_0025305 Ga0466965_0025305_1424_2071 198
52 3300044684 Ga0466966_0003982 Ga0466966_0003982_5315_5962 198
53 3300044719 Ga0466971_0180792 Ga0466971_0180792_14_661 198
54 3300044765 Ga0466970_0092568 Ga0466970_0092568_394_1041 198
55 3300046452 Ga0495617_003443 Ga0495617_003443_4471_5091 198
56 3300046507 Ga0495606_0221966 Ga0495606_0221966_208_828 198
57 3300048917 Ga0496114_0360515 Ga0496114_0360515_412_1038 198
58 3300048918 Ga0496115_0027620 Ga0496115_0027620_1644_2270 198
59 3300059478 Ga0587093_003348 Ga0587093_003348_776_1423 198
60 3300059491 Ga0587070_017654 Ga0587070_017654_148_795 198
61 3300059493 Ga0587077_001691 Ga0587077_001691_1735_2382 198
62 3300059510 Ga0587090_005131 Ga0587090_005131_83_730 198
63 3300059511 Ga0587091_057327 Ga0587091_057327_29_676 198
64 3300059513 Ga0587094_010221 Ga0587094_010221_142_789 198
65 3300059643 Ga0587072_010063 Ga0587072_010063_704_1351 198
66 3300059643 Ga0587072_014319 Ga0587072_014319_259_942 198
67 3300059645 Ga0587076_001554 Ga0587076_001554_1331_1978 198
68 3300059645 Ga0587076_023404 Ga0587076_023404_319_966 198
69 3300059646 Ga0587078_005322 Ga0587078_005322_574_1221 198
70 3300059649 Ga0587102_002787 Ga0587102_002787_586_1233 198
71 3300060346 Ga0587111_0003981 Ga0587111_0003981_1149_1796 198
72 iso_pu_bacteria 2904474040 2904476466 198
73 iso_pu_bacteria 2919150387 2919152635 198
74 iso_pu_bacteria 2927143783 2927146596 198
75 3300002075 JGI24738J21930_10000444 JGI24738J21930_100004446 199
76 3300005327 Ga0070658_10426752 Ga0070658_104267521 199
77 iso_pu_bacteria 2511231025 2511379935 199
78 iso_pu_bacteria 2511231035 2511434787 199
79 iso_pu_bacteria 2667528173 2671108329 199
80 iso_pu_bacteria 2876601092 2876602888 199
81 iso_pu_bacteria 2904474040 2904474999 199
82 iso_pu_bacteria 2904504865 2904506020 199
83 iso_pu_bacteria 2919150387 2919151345 199
84 iso_pu_bacteria 2919462493 2919462724 199
85 iso_pu_bacteria 2927143783 2927146219 199
86 iso_pu_bacteria 2939602548 2939606984 199
87 iso_pu_bacteria 2945945610 2945949476 199
88 iso_pu_bacteria 8016733728 8016735189 199
89 iso_pu_bacteria 8019499862 8019501330 199
90 3300037471 Ga0395905_0138494 Ga0395905_0138494_1371_2039 200
91 3300046558 Ga0495633_0033962 Ga0495633_0033962_1163_1822 200
92 3300046665 Ga0495661_0259774 Ga0495661_0259774_136_795 200
93 3300047318 Ga0495636_0000840 Ga0495636_0000840_5844_6506 200
94 3300053161 Ga0500634_0000075 Ga0500634_0000075_10728_11387 200
95 iso_pu_bacteria 2599185299 2599926389 200
96 iso_pu_bacteria 2608642108 2608669920 200
97 iso_pu_bacteria 2648501693 2650897132 200
98 iso_pu_bacteria 2684622997 2686354040 200
99 iso_pu_bacteria 2808606414 2809125596 200
100 iso_pu_bacteria 2844528606 2844529016 200
101 iso_pu_bacteria 2847797336 2847799104 200
102 iso_pu_bacteria 2852103415 2852107557 200
103 iso_pu_bacteria 2865014394 2865017404 200
104 iso_pu_bacteria 2881609920 2881610407 200
105 iso_pu_bacteria 2945951305 2945952340 200
106 iso_pu_bacteria 2978975091 2978978827 200
107 iso_pu_bacteria 2984494565 2984497401 200
108 iso_pu_bacteria 2990261002 2990261352 200
109 3300015261 Ga0182006_1072578 Ga0182006_10725781 201
110 3300031731 Ga0307405_10595352 Ga0307405_105953522 201
111 3300041404 Ga0439436_0085907 Ga0439436_0085907_79_768 201
112 3300049663 Ga0501223_018377 Ga0501223_018377_479_1168 201
113 3300049679 Ga0501249_001394 Ga0501249_001394_1943_2632 201
114 3300049705 Ga0501225_0007970 Ga0501225_0007970_911_1600 201
115 iso_pu_bacteria 2847085930 2847086751 201
116 iso_pu_bacteria 2908669403 2908672288 201
117 3300005539 Ga0068853_100240149 Ga0068853_1002401492 202
118 3300005563 Ga0068855_100009252 Ga0068855_10000925210 202
119 3300005577 Ga0068857_100147775 Ga0068857_1001477753 202
120 3300005616 Ga0068852_100017051 Ga0068852_1000170513 202
121 3300009093 Ga0105240_10124128 Ga0105240_101241282 202
122 3300009148 Ga0105243_10697907 Ga0105243_106979071 202
123 3300009545 Ga0105237_10011182 Ga0105237_100111828 202
124 3300009551 Ga0105238_10039728 Ga0105238_100397283 202
125 3300010375 Ga0105239_10040145 Ga0105239_100401455 202
126 3300013100 Ga0157373_10025568 Ga0157373_100255684 202
127 3300013104 Ga0157370_10100730 Ga0157370_101007302 202
128 3300013105 Ga0157369_10020829 Ga0157369_100208298 202
129 3300025913 Ga0207695_10097854 Ga0207695_100978543 202
130 3300025914 Ga0207671_10024258 Ga0207671_100242583 202
131 3300025949 Ga0207667_10055197 Ga0207667_100551973 202
132 3300026041 Ga0207639_10658914 Ga0207639_106589142 202
133 3300026116 Ga0207674_10161341 Ga0207674_101613413 202
134 3300026142 Ga0207698_10017915 Ga0207698_100179152 202
135 3300048919 Ga0496116_0000020 Ga0496116_0000020_11112_11765 202
136 3300048920 Ga0496117_0002625 Ga0496117_0002625_10510_11163 202
137 3300048920 Ga0496117_0030553 Ga0496117_0030553_1262_1900 202
138 3300048921 Ga0496118_0017582 Ga0496118_0017582_447_1100 202
139 3300048921 Ga0496118_0105682 Ga0496118_0105682_28_666 202
140 3300048927 Ga0496124_0007435 Ga0496124_0007435_7212_7850 202
141 3300048928 Ga0496125_0000054 Ga0496125_0000054_67247_67933 202
142 3300002737 JGI25162J39368_1000003 JGI25162J39368_1000003339 203
143 3300002771 JGI25163J39215_1000065 JGI25163J39215_100006530 203
144 3300002772 JGI25164J39214_1000014 JGI25164J39214_1000014168 203
145 3300003751 Ga0055538_1000005 Ga0055538_1000005339 203
146 3300003752 Ga0055539_1000007 Ga0055539_1000007339 203
147 3300003756 Ga0055533_1000009 Ga0055533_1000009339 203
148 3300003759 Ga0055525_1000010 Ga0055525_1000010339 203
149 3300003841 Ga0055541_1000005 Ga0055541_1000005226 203
150 3300005289 Ga0065704_10001052 Ga0065704_100010521 203
151 3300006051 Ga0075364_10074997 Ga0075364_100749972 203
152 3300009036 Ga0105244_10001225 Ga0105244_100012252 203
153 3300009036 Ga0105244_10003675 Ga0105244_1000367510 203
154 3300009036 Ga0105244_10019135 Ga0105244_100191353 203
155 3300009092 Ga0105250_10007173 Ga0105250_100071733 203
156 3300009092 Ga0105250_10048565 Ga0105250_100485651 203
157 3300011119 Ga0105246_10045442 Ga0105246_100454422 203
158 3300013100 Ga0157373_10000511 Ga0157373_1000051116 203
159 3300013102 Ga0157371_10000528 Ga0157371_1000052834 203
160 3300013306 Ga0163162_10272344 Ga0163162_102723441 203
161 3300013306 Ga0163162_10351494 Ga0163162_103514942 203
162 3300013307 Ga0157372_10013295 Ga0157372_100132956 203
163 3300013307 Ga0157372_11132477 Ga0157372_111324771 203
164 3300016635 Ga0183361_10305 Ga0183361_103051 203
165 3300025207 Ga0209760_100092 Ga0209760_10009235 203
166 3300025224 Ga0209784_100001 Ga0209784_100001879 203
167 3300025225 Ga0209566_100001 Ga0209566_100001879 203
168 3300025226 Ga0209674_100002 Ga0209674_100002879 203
169 3300025230 Ga0209563_100008 Ga0209563_100008882 203
170 3300025231 Ga0207427_100002 Ga0207427_100002396 203
171 3300025233 Ga0209437_100007 Ga0209437_100007334 203
172 3300025253 Ga0209677_100004 Ga0209677_100004882 203
173 3300025261 Ga0209233_1013677 Ga0209233_10136771 203
174 3300025711 Ga0207696_1000058 Ga0207696_100005839 203
175 3300025711 Ga0207696_1000418 Ga0207696_100041836 203
176 3300025728 Ga0207655_1000007 Ga0207655_1000007483 203
177 3300025728 Ga0207655_1003869 Ga0207655_10038697 203
178 3300025728 Ga0207655_1012724 Ga0207655_10127242 203
179 3300025728 Ga0207655_1062649 Ga0207655_10626491 203
180 3300027312 Ga0209371_1001663 Ga0209371_10016633 203
181 3300030500 Ga0268256_1001451 Ga0268256_10014519 203
182 3300046452 Ga0495617_004086 Ga0495617_004086_745_1356 203
183 3300046458 Ga0495591_000001 Ga0495591_000001_456705_457316 203
184 3300046471 Ga0495650_0000016 Ga0495650_0000016_325860_326552 203
185 3300046530 Ga0495654_0000009 Ga0495654_0000009_144390_145001 203
186 3300046616 Ga0495668_0145015 Ga0495668_0145015_528_1139 203
187 3300046810 Ga0495660_0000007 Ga0495660_0000007_267112_267804 203
188 3300048903 Ga0496100_0428496 Ga0496100_0428496_236_847 203
189 3300048904 Ga0496101_0000236 Ga0496101_0000236_19335_19946 203
190 3300048907 Ga0496104_0023203 Ga0496104_0023203_4573_5265 203
191 3300048919 Ga0496116_0000054 Ga0496116_0000054_180406_181098 203
192 3300048919 Ga0496116_0002997 Ga0496116_0002997_7322_7933 203
193 3300048919 Ga0496116_0069541 Ga0496116_0069541_105_716 203
194 3300048921 Ga0496118_0034139 Ga0496118_0034139_564_1256 203
195 3300048922 Ga0496119_0001835 Ga0496119_0001835_14881_15492 203
196 3300048922 Ga0496119_0013201 Ga0496119_0013201_1464_2075 203
197 3300048923 Ga0496120_0000057 Ga0496120_0000057_122832_123443 203
198 3300048923 Ga0496120_0000207 Ga0496120_0000207_54533_55144 203
199 3300048923 Ga0496120_0099489 Ga0496120_0099489_614_1306 203
200 3300048924 Ga0496121_0112687 Ga0496121_0112687_1237_1848 203
201 3300048925 Ga0496122_0000013 Ga0496122_0000013_315040_315732 203
202 3300048925 Ga0496122_0009303 Ga0496122_0009303_7565_8176 203
203 3300048926 Ga0496123_0000010 Ga0496123_0000010_185308_186000 203
204 3300048926 Ga0496123_0007473 Ga0496123_0007473_8317_8928 203
205 3300048927 Ga0496124_0000010 Ga0496124_0000010_98510_99202 203
206 3300048927 Ga0496124_0001896 Ga0496124_0001896_13531_14142 203
207 3300048927 Ga0496124_0028783 Ga0496124_0028783_529_1140 203
208 3300048928 Ga0496125_0000019 Ga0496125_0000019_256729_257421 203
209 3300048929 Ga0496126_0027030 Ga0496126_0027030_1854_2465 203
210 3300050491 nmdc:mga00v17_15420_c2 nmdc:mga00v17_15420_c2_1300_1911 203
211 3300001989 JGI24739J22299_10000121 JGI24739J22299_1000012116 204
212 3300002737 JGI25162J39368_1001242 JGI25162J39368_10012423 204
213 3300003856 Ga0058692_1000234 Ga0058692_100023416 204
214 3300003856 Ga0058692_1000307 Ga0058692_10003071 204
215 3300003856 Ga0058692_1000399 Ga0058692_10003992 204
216 3300003856 Ga0058692_1013202 Ga0058692_10132022 204
217 3300005347 Ga0070668_100063988 Ga0070668_1000639882 204
218 3300005457 Ga0070662_100066863 Ga0070662_1000668631 204
219 3300005459 Ga0068867_100809644 Ga0068867_1008096441 204
220 3300005548 Ga0070665_100176483 Ga0070665_1001764833 204
221 3300006051 Ga0075364_10006743 Ga0075364_100067432 204
222 3300009011 Ga0105251_10000891 Ga0105251_100008911 204
223 3300009011 Ga0105251_10009102 Ga0105251_100091022 204
224 3300009011 Ga0105251_10015743 Ga0105251_100157431 204
225 3300009011 Ga0105251_10035072 Ga0105251_100350723 204
226 3300009011 Ga0105251_10105325 Ga0105251_101053251 204
227 3300009036 Ga0105244_10001410 Ga0105244_100014109 204
228 3300011119 Ga0105246_10013565 Ga0105246_100135652 204
229 3300011119 Ga0105246_10328788 Ga0105246_103287881 204
230 3300013100 Ga0157373_10082127 Ga0157373_100821272 204
231 3300013100 Ga0157373_10466752 Ga0157373_104667521 204
232 3300013102 Ga0157371_10003127 Ga0157371_1000312712 204
233 3300013102 Ga0157371_10007431 Ga0157371_100074315 204
234 3300013104 Ga0157370_10000123 Ga0157370_1000012351 204
235 3300013105 Ga0157369_10005689 Ga0157369_100056891 204
236 3300013306 Ga0163162_10230319 Ga0163162_102303192 204
237 3300013307 Ga0157372_10002176 Ga0157372_1000217614 204
238 3300013307 Ga0157372_10927609 Ga0157372_109276092 204
239 3300014497 Ga0182008_10012370 Ga0182008_100123702 204
240 3300015261 Ga0182006_1006857 Ga0182006_10068572 204
241 3300017792 Ga0163161_10030869 Ga0163161_100308692 204
242 3300025233 Ga0209437_100238 Ga0209437_10023865 204
243 3300025711 Ga0207696_1003039 Ga0207696_10030393 204
244 3300025728 Ga0207655_1000011 Ga0207655_1000011608 204
245 3300025728 Ga0207655_1001328 Ga0207655_10013286 204
246 3300025728 Ga0207655_1001689 Ga0207655_10016896 204
247 3300025728 Ga0207655_1002216 Ga0207655_10022167 204
248 3300025728 Ga0207655_1005007 Ga0207655_10050076 204
249 3300025728 Ga0207655_1007096 Ga0207655_10070964 204
250 3300025735 Ga0207713_1000001 Ga0207713_10000011722 204
251 3300025735 Ga0207713_1013733 Ga0207713_10137332 204
252 3300025735 Ga0207713_1015303 Ga0207713_10153032 204
253 3300025735 Ga0207713_1030828 Ga0207713_10308282 204
254 3300025735 Ga0207713_1059809 Ga0207713_10598092 204
255 3300025933 Ga0207706_10565947 Ga0207706_105659471 204
256 3300025972 Ga0207668_10019976 Ga0207668_100199762 204
257 3300027312 Ga0209371_1000005 Ga0209371_1000005796 204
258 3300027312 Ga0209371_1000099 Ga0209371_100009987 204
259 3300027312 Ga0209371_1000100 Ga0209371_100010059 204
260 3300027312 Ga0209371_1000120 Ga0209371_100012033 204
261 3300027312 Ga0209371_1002037 Ga0209371_10020377 204
262 3300027312 Ga0209371_1002421 Ga0209371_10024214 204
263 3300027312 Ga0209371_1004270 Ga0209371_10042704 204
264 3300028379 Ga0268266_10057653 Ga0268266_100576532 204
265 3300030500 Ga0268256_1000006 Ga0268256_1000006261 204
266 3300030500 Ga0268256_1000035 Ga0268256_1000035108 204
267 3300030500 Ga0268256_1000089 Ga0268256_100008977 204
268 3300030500 Ga0268256_1000976 Ga0268256_100097615 204
269 3300030500 Ga0268256_1001566 Ga0268256_10015666 204
270 3300030500 Ga0268256_1004009 Ga0268256_10040094 204
271 3300030500 Ga0268256_1007348 Ga0268256_10073482 204
272 3300041405 Ga0439438_000002 Ga0439438_000002_201954_202574 204
273 3300041405 Ga0439438_000660 Ga0439438_000660_6919_7548 204
274 3300041405 Ga0439438_075961 Ga0439438_075961_189_803 204
275 3300041407 Ga0439447_027503 Ga0439447_027503_41_655 204
276 3300041407 Ga0439447_031829 Ga0439447_031829_608_1228 204
277 3300041411 Ga0439466_0000001 Ga0439466_0000001_239843_240457 204
278 3300042006 Ga0439432_011718 Ga0439432_011718_1168_1782 204
279 3300042010 Ga0439452_000001 Ga0439452_000001_1593450_1594064 204
280 3300042016 Ga0439463_007968 Ga0439463_007968_847_1461 204
281 3300046458 Ga0495591_001465 Ga0495591_001465_7132_7761 204
282 3300046471 Ga0495650_0000031 Ga0495650_0000031_404807_405436 204
283 3300046474 Ga0495605_0029980 Ga0495605_0029980_1159_1788 204
284 3300046492 Ga0495585_0014381 Ga0495585_0014381_2294_2908 204
285 3300046500 Ga0495596_0003325 Ga0495596_0003325_6389_7003 204
286 3300046501 Ga0495607_0016108 Ga0495607_0016108_3361_3990 204
287 3300046507 Ga0495606_0002247 Ga0495606_0002247_7706_8335 204
288 3300046520 Ga0495637_0084382 Ga0495637_0084382_87_716 204
289 3300046522 Ga0495643_0007041 Ga0495643_0007041_2710_3324 204
290 3300046523 Ga0495644_0003275 Ga0495644_0003275_5423_6052 204
291 3300046524 Ga0495648_0004529 Ga0495648_0004529_5198_5812 204
292 3300046524 Ga0495648_0028439 Ga0495648_0028439_229_858 204
293 3300046530 Ga0495654_0000068 Ga0495654_0000068_82678_83307 204
294 3300046692 Ga0495671_0012799 Ga0495671_0012799_2968_3597 204
295 3300046694 Ga0495649_0065942 Ga0495649_0065942_646_1275 204
296 3300046810 Ga0495660_0000015 Ga0495660_0000015_159094_159723 204
297 3300046810 Ga0495660_0033323 Ga0495660_0033323_2052_2666 204
298 3300047320 Ga0495672_0000001 Ga0495672_0000001_954932_955561 204
299 3300047320 Ga0495672_0000015 Ga0495672_0000015_497104_497718 204
300 3300047446 Ga0495679_004646 Ga0495679_004646_4010_4624 204
301 3300047469 Ga0495673_0000019 Ga0495673_0000019_60740_61369 204
302 3300048903 Ga0496100_0009069 Ga0496100_0009069_3194_3808 204
303 3300048904 Ga0496101_0469205 Ga0496101_0469205_47_709 204
304 3300048905 Ga0496102_0006751 Ga0496102_0006751_5957_6571 204
305 3300048905 Ga0496102_0374806 Ga0496102_0374806_288_902 204
306 3300048908 Ga0496105_0001239 Ga0496105_0001239_7507_8121 204
307 3300048908 Ga0496105_0211190 Ga0496105_0211190_141_809 204
308 3300048908 Ga0496105_0414573 Ga0496105_0414573_79_693 204
309 3300048919 Ga0496116_0000110 Ga0496116_0000110_54267_54881 204
310 3300048919 Ga0496116_0269603 Ga0496116_0269603_41_655 204
311 3300048920 Ga0496117_0000009 Ga0496117_0000009_339057_339671 204
312 3300048920 Ga0496117_0000138 Ga0496117_0000138_19513_20127 204
313 3300048920 Ga0496117_0000154 Ga0496117_0000154_41436_42050 204
314 3300048920 Ga0496117_0066819 Ga0496117_0066819_1396_2049 204
315 3300048921 Ga0496118_0000017 Ga0496118_0000017_274743_275357 204
316 3300048921 Ga0496118_0000150 Ga0496118_0000150_41436_42050 204
317 3300048922 Ga0496119_0000012 Ga0496119_0000012_120429_121058 204
318 3300048922 Ga0496119_0000027 Ga0496119_0000027_215457_216071 204
319 3300048922 Ga0496119_0000361 Ga0496119_0000361_38581_39195 204
320 3300048922 Ga0496119_0002136 Ga0496119_0002136_1763_2419 204
321 3300048923 Ga0496120_0000004 Ga0496120_0000004_290860_291489 204
322 3300048923 Ga0496120_0000022 Ga0496120_0000022_215457_216071 204
323 3300048923 Ga0496120_0000052 Ga0496120_0000052_103895_104551 204
324 3300048923 Ga0496120_0000711 Ga0496120_0000711_5517_6131 204
325 3300048924 Ga0496121_0002048 Ga0496121_0002048_20574_21188 204
326 3300048925 Ga0496122_0004483 Ga0496122_0004483_15817_16431 204
327 3300048926 Ga0496123_0001692 Ga0496123_0001692_21277_21891 204
328 3300048926 Ga0496123_0259789 Ga0496123_0259789_96_710 204
329 3300048927 Ga0496124_0001694 Ga0496124_0001694_10375_10989 204
330 3300048927 Ga0496124_0002160 Ga0496124_0002160_20576_21190 204
331 3300048927 Ga0496124_0018266 Ga0496124_0018266_157_774 204
332 3300048927 Ga0496124_0025220 Ga0496124_0025220_2177_2791 204
333 3300048927 Ga0496124_0142734 Ga0496124_0142734_1134_1748 204
334 3300048929 Ga0496126_0055132 Ga0496126_0055132_697_1311 204
335 3300049459 Ga0495678_000206 Ga0495678_000206_34350_34979 204
336 3300049459 Ga0495678_027582 Ga0495678_027582_539_1153 204
337 3300049460 Ga0495682_0000001 Ga0495682_0000001_176607_177236 204
338 3300053126 Ga0500621_000002 Ga0500621_000002_172002_172631 204

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01569

PAP2

PAP2 superfamily

50

167

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
5jki-assembly1.cif.gz_A crystal structure of the first transmembrane pap2 type phosphatidylglycerolphosphate phosphatase from bacillus subtilis 0.7588 2 148
6ebu-assembly1.cif.gz_A crystal structure of aquifex aeolicus lpxe 0.6225 2 143
5jki-assembly1.cif.gz_A crystal structure of the first transmembrane pap2 type phosphatidylglycerolphosphate phosphatase from bacillus subtilis 0.5712 2 148
8bm3-assembly4.cif.gz_D h207a mutant of e. coli pgpb, a pap2 type phosphatidyl glycerol phosphate and c55-pp phosphatase, in complex with farnesyl pyrophosphate 0.5531 2 147
7f17-assembly3.cif.gz_C crystal structure of acid phosphatase 0.5373 72 174
ID Description Score Start End Superfamily
af_I1K0M0_44_221_1.20.144.10 Mainly Alpha;Up-down Bundle;Vanadium-containing Chloroperoxidase; domain 1;Phosphatidic acid phosphatase type 2/haloperoxidase 0.7125 3 148 1.20.144.10
af_Q965Q4_174_247_1.20.144.10 Mainly Alpha;Up-down Bundle;Vanadium-containing Chloroperoxidase; domain 1;Phosphatidic acid phosphatase type 2/haloperoxidase 0.7034 72 142 1.20.144.10
af_A4HYG7_136_301_1.20.144.10 Mainly Alpha;Up-down Bundle;Vanadium-containing Chloroperoxidase; domain 1;Phosphatidic acid phosphatase type 2/haloperoxidase 0.6799 31 148 1.20.144.10
af_A0A2R8Q2K8_118_304_1.20.144.10 Mainly Alpha;Up-down Bundle;Vanadium-containing Chloroperoxidase; domain 1;Phosphatidic acid phosphatase type 2/haloperoxidase 0.66 34 148 1.20.144.10
af_Q8VCY8_104_300_1.20.144.10 Mainly Alpha;Up-down Bundle;Vanadium-containing Chloroperoxidase; domain 1;Phosphatidic acid phosphatase type 2/haloperoxidase 0.6485 34 143 1.20.144.10
ID Description Score Start End GO Terms
AF-A0A1Y0LKR3-F1-model_v4 Phosphatidic acid phosphatase type 2/haloperoxidase domain-containing protein 0.9845 1 203 GO:0016020
AF-A0A085JHB4-F1-model_v4 Membrane-associated phospholipid phosphatase 0.9839 1 203 GO:0016020
AF-A0A1Y0LKR3-F1-model_v4 Phosphatidic acid phosphatase type 2/haloperoxidase domain-containing protein 0.975 1 203 GO:0016020
AF-A0A085JHB4-F1-model_v4 Membrane-associated phospholipid phosphatase 0.9744 1 203 GO:0016020
AF-E5B5P1-F1-model_v4 Uncharacterized 22.5 kDa protein in cps region ORF2 0.9578 1 203 GO:0016020

Feature Viewer

pLDDT pTM Quality
89.05 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map